F439602

General Info

Members Datasets Scaffolds Average Seq Length
419 185 838 255

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0032160|Ga0496103_0032160_232_1101
Length 289
Sequence MTAVSAKNFMKIPLGVRAPAPDSGAGGKGHPIRRESMMSEHVRVQRGGGVLSLTLARPERRNAITVAMYAALAEAITGAADDPAVRLITIEGDGEDFTAGNDLADFLSGGSTLADGDDAPVAWLLKALAKNQVPMLAAVHGNAVGIGTTLLFHCDLVIAEQGAKFRMPFVDLGLVPEAASSLLLPRLAGRRAAARHLLLGEPFGAEEALAMGIASHVAPAGELLAMFDRIRSALLAKPAKALRLTQDLLRTDASTEILERMDLENGHFAERLTSDEVKQAIASFYAKKR

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
125 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
185 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.72
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 98.57
Stem 0
Stem Tuber 0.24
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0032160 3300048906 Bacteria 3201
2 JGI24741J21665_1022713 3300001915 Bacteria 971
3 JGI24740J21852_10057965 3300001979 Bacteria 1079
4 JGI24739J22299_10003721 3300001989 Bacteria 5825
5 JGI24737J22298_10002883 3300001990 Bacteria 6101
6 JGI24738J21930_10000992 3300002075 Bacteria 8135
7 JGI24738J21930_10001169 3300002075 Bacteria 7396
8 Ga0065715_10000902 3300005293 Bacteria 21505
9 Ga0070658_10000205 3300005327 Bacteria 52211
10 Ga0070658_10061099 3300005327 Bacteria 3069
11 Ga0070658_10189262 3300005327 Bacteria 1734
12 Ga0070658_10562075 3300005327 Bacteria 987
13 Ga0070676_10031551 3300005328 Bacteria 3029
14 Ga0070683_100040869 3300005329 Bacteria 4264
15 Ga0070683_100455356 3300005329 Bacteria 1221
16 Ga0070670_100001324 3300005331 Bacteria 19783
17 Ga0070670_100213039 3300005331 Bacteria 1680
18 Ga0070677_10004585 3300005333 Bacteria 4517
19 Ga0070666_10001012 3300005335 Bacteria 17220
20 Ga0070680_100030315 3300005336 Bacteria 4345
21 Ga0070680_100036698 3300005336 Bacteria 3960
22 Ga0070682_100004951 3300005337 Bacteria 7401
23 Ga0070682_100159597 3300005337 Bacteria 1556
24 Ga0070660_100000009 3300005339 Bacteria 145691
25 Ga0070660_100106557 3300005339 Bacteria 2226
26 Ga0070689_100193756 3300005340 Bacteria 1656
27 Ga0070661_100000100 3300005344 Bacteria 70585
28 Ga0070661_100078415 3300005344 Bacteria 2436
29 Ga0070668_100021267 3300005347 Bacteria 4904
30 Ga0070668_100223410 3300005347 Bacteria 1554
31 Ga0070669_100003256 3300005353 Bacteria 11670
32 Ga0070675_100000241 3300005354 Bacteria 35442
33 Ga0070671_100007655 3300005355 Bacteria 8635
34 Ga0070671_100016850 3300005355 Bacteria 5910
35 Ga0070671_100020808 3300005355 Bacteria 5351
36 Ga0070674_100001601 3300005356 Bacteria 12151
37 Ga0070674_100439592 3300005356 Bacteria 1074
38 Ga0070673_100619916 3300005364 Bacteria 988
39 Ga0070659_100000048 3300005366 Bacteria 98245
40 Ga0070659_100121158 3300005366 Bacteria 2119
41 Ga0070659_100134019 3300005366 Bacteria 2014
42 Ga0070659_100258348 3300005366 Bacteria 1445
43 Ga0070659_100346461 3300005366 Bacteria 1246
44 Ga0070667_100003299 3300005367 Bacteria 13798
45 Ga0070667_100046148 3300005367 Bacteria 3664
46 Ga0070667_100132210 3300005367 Bacteria 2179
47 Ga0070709_10418429 3300005434 Bacteria 1004
48 Ga0070714_100101755 3300005435 Bacteria 2532
49 Ga0070714_100184037 3300005435 Bacteria 1902
50 Ga0070714_100227017 3300005435 Bacteria 1719
51 Ga0070714_100282223 3300005435 Bacteria 1543
52 Ga0070694_100232342 3300005444 Bacteria 1388
53 Ga0070663_100000620 3300005455 Bacteria 19036
54 Ga0070663_100057821 3300005455 Bacteria 2783
55 Ga0070663_100095572 3300005455 Bacteria 2209
56 Ga0070663_100245615 3300005455 Unclassified 1415
57 Ga0070678_100087818 3300005456 Bacteria 2375
58 Ga0070662_100000035 3300005457 Bacteria 77342
59 Ga0070662_100002266 3300005457 Bacteria 11804
60 Ga0070681_10125544 3300005458 Bacteria 2499
61 Ga0070679_100228555 3300005530 Bacteria 1820
62 Ga0070679_100735765 3300005530 Bacteria 929
63 Ga0070684_100068157 3300005535 Bacteria 3127
64 Ga0068853_100001248 3300005539 Bacteria 18175
65 Ga0070672_100006537 3300005543 Bacteria 7839
66 Ga0070672_100059260 3300005543 Bacteria 3012
67 Ga0070696_100589206 3300005546 Bacteria 895
68 Ga0070693_100008697 3300005547 Bacteria 5024
69 Ga0070693_100197027 3300005547 Bacteria 1306
70 Ga0070665_100012074 3300005548 Bacteria 8714
71 Ga0068855_100001487 3300005563 Bacteria 29322
72 Ga0068855_100264175 3300005563 Bacteria 1916
73 Ga0068855_100283596 3300005563 Bacteria 1838
74 Ga0068855_100491251 3300005563 Bacteria 1335
75 Ga0070664_100000025 3300005564 Bacteria 93173
76 Ga0068857_100082474 3300005577 Bacteria 2872
77 Ga0068857_100101839 3300005577 Bacteria 2577
78 Ga0068854_100002456 3300005578 Bacteria 11472
79 Ga0068854_100015176 3300005578 Bacteria 5097
80 Ga0068854_100123786 3300005578 Bacteria 1967
81 Ga0068856_100000124 3300005614 Bacteria 77469
82 Ga0068856_100037364 3300005614 Bacteria 4766
83 Ga0068856_100348319 3300005614 Bacteria 1500
84 Ga0068856_100801369 3300005614 Unclassified 962
85 Ga0068852_100180121 3300005616 Bacteria 1987
86 Ga0068852_100292492 3300005616 Bacteria 1574
87 Ga0068852_100347941 3300005616 Bacteria 1446
88 Ga0068852_100443970 3300005616 Bacteria 1283
89 Ga0068859_100005035 3300005617 Bacteria 13407
90 Ga0068859_100066847 3300005617 Bacteria 3630
91 Ga0068859_100242891 3300005617 Bacteria 1890
92 Ga0068864_100062136 3300005618 Bacteria 3236
93 Ga0068864_100068106 3300005618 Bacteria 3092
94 Ga0068864_100163866 3300005618 Bacteria 2023
95 Ga0068861_100042736 3300005719 Bacteria 3398
96 Ga0068851_10005842 3300005834 Bacteria 5606
97 Ga0068851_10104304 3300005834 Bacteria 1507
98 Ga0068863_100599716 3300005841 Bacteria 1090
99 Ga0068858_100031238 3300005842 Bacteria 4945
100 Ga0068860_100357212 3300005843 Bacteria 1439
101 Ga0068862_100060831 3300005844 Bacteria 3246
102 Ga0068862_100234167 3300005844 Bacteria 1667
103 Ga0068871_100545029 3300006358 Bacteria 1050
104 Ga0075431_100264559 3300006847 Bacteria 1744
105 Ga0097620_100005035 3300006931 Bacteria 13407
106 Ga0097620_100242891 3300006931 Bacteria 1890
107 Ga0105240_11018592 3300009093 Unclassified 885
108 Ga0111539_10295231 3300009094 Bacteria 1886
109 Ga0105248_10000163 3300009177 Bacteria 77658
110 Ga0105248_10165199 3300009177 Bacteria 2496
111 Ga0105248_10221100 3300009177 Bacteria 2132
112 Ga0105238_10497823 3300009551 Bacteria 1219
113 Ga0105249_10201237 3300009553 Bacteria 1949
114 Ga0105239_11305756 3300010375 Bacteria 837
115 Ga0157373_10008474 3300013100 Bacteria 7635
116 Ga0157371_10000722 3300013102 Bacteria 38724
117 Ga0157371_10035630 3300013102 Bacteria 3566
118 Ga0157371_10045026 3300013102 Bacteria 3141
119 Ga0157370_10126609 3300013104 Bacteria 2384
120 Ga0157369_10192684 3300013105 Bacteria 2141
121 Ga0157374_10151117 3300013296 Bacteria 2258
122 Ga0157374_10188540 3300013296 Bacteria 2017
123 Ga0163162_10060569 3300013306 Bacteria 3821
124 Ga0157372_10040947 3300013307 Bacteria 5120
125 Ga0157372_10138586 3300013307 Bacteria 2802
126 Ga0163163_10000173 3300014325 Bacteria 67717
127 Ga0163163_10785382 3300014325 Bacteria 1016
128 Ga0157380_10022685 3300014326 Bacteria 4731
129 Ga0157380_10038860 3300014326 Bacteria 3697
130 Ga0157380_10231460 3300014326 Bacteria 1660
131 Ga0157380_10846894 3300014326 Unclassified 936
132 Ga0157379_10059356 3300014968 Bacteria 3420
133 Ga0163161_10001171 3300017792 Bacteria 19685
134 Ga0206354_11099638 3300020081 Bacteria 1454
135 Ga0206353_10418501 3300020082 Bacteria 989
136 Ga0206353_11678682 3300020082 Bacteria 2231
137 Ga0207666_1004644 3300025271 Bacteria 1729
138 Ga0207697_10003251 3300025315 Bacteria 8077
139 Ga0207682_10000726 3300025893 Bacteria 15278
140 Ga0207680_10000588 3300025903 Bacteria 17169
141 Ga0207647_10014024 3300025904 Bacteria 5545
142 Ga0207647_10079033 3300025904 Bacteria 1975
143 Ga0207645_10015919 3300025907 Bacteria 4984
144 Ga0207643_10068575 3300025908 Bacteria 2037
145 Ga0207705_10000114 3300025909 Bacteria 90132
146 Ga0207705_10322966 3300025909 Bacteria 1186
147 Ga0207705_10454217 3300025909 Bacteria 994
148 Ga0207707_10273421 3300025912 Bacteria 1464
149 Ga0207660_10641945 3300025917 Bacteria 865
150 Ga0207657_10000071 3300025919 Bacteria 93725
151 Ga0207657_10014979 3300025919 Bacteria 7533
152 Ga0207657_10081399 3300025919 Unclassified 2720
153 Ga0207657_10259149 3300025919 Unclassified 1384
154 Ga0207649_10000301 3300025920 Bacteria 37967
155 Ga0207652_10243862 3300025921 Bacteria 1620
156 Ga0207652_10467016 3300025921 Bacteria 1137
157 Ga0207681_10006608 3300025923 Bacteria 7119
158 Ga0207694_10080864 3300025924 Bacteria 2551
159 Ga0207650_10000997 3300025925 Bacteria 21289
160 Ga0207650_10087257 3300025925 Bacteria 2377
161 Ga0207659_10000824 3300025926 Bacteria 18378
162 Ga0207664_10055293 3300025929 Bacteria 3149
163 Ga0207664_10143163 3300025929 Bacteria 2025
164 Ga0207644_10021816 3300025931 Bacteria 4367
165 Ga0207644_10058878 3300025931 Bacteria 2777
166 Ga0207690_10000045 3300025932 Bacteria 116965
167 Ga0207690_10102002 3300025932 Bacteria 2051
168 Ga0207706_10000086 3300025933 Bacteria 95284
169 Ga0207706_10000401 3300025933 Bacteria 46630
170 Ga0207706_10153549 3300025933 Bacteria 2025
171 Ga0207691_10009772 3300025940 Bacteria 9209
172 Ga0207691_10073024 3300025940 Bacteria 3094
173 Ga0207711_10003283 3300025941 Bacteria 14060
174 Ga0207711_10010347 3300025941 Bacteria 7748
175 Ga0207661_10001017 3300025944 Bacteria 18588
176 Ga0207679_10000315 3300025945 Bacteria 36328
177 Ga0207679_10187913 3300025945 Bacteria 1715
178 Ga0207667_10001152 3300025949 Bacteria 33245
179 Ga0207667_10134676 3300025949 Bacteria 2544
180 Ga0207651_10002250 3300025960 Bacteria 9163
181 Ga0207712_10120399 3300025961 Bacteria 1985
182 Ga0207668_10000673 3300025972 Bacteria 20991
183 Ga0207668_10226221 3300025972 Bacteria 1505
184 Ga0207640_10001884 3300025981 Bacteria 11249
185 Ga0207640_10267222 3300025981 Bacteria 1336
186 Ga0207703_10165285 3300026035 Bacteria 1941
187 Ga0207639_10000330 3300026041 Bacteria 32864
188 Ga0207639_10462315 3300026041 Bacteria 1154
189 Ga0207678_10000311 3300026067 Bacteria 43860
190 Ga0207678_10058320 3300026067 Bacteria 3322
191 Ga0207678_10112281 3300026067 Bacteria 2325
192 Ga0207678_10147977 3300026067 Bacteria 2005
193 Ga0207678_10253992 3300026067 Bacteria 1506
194 Ga0207708_10034885 3300026075 Bacteria 3827
195 Ga0207702_10000254 3300026078 Bacteria 61680
196 Ga0207702_10058590 3300026078 Bacteria 3278
197 Ga0207702_10088481 3300026078 Bacteria 2706
198 Ga0207702_10109098 3300026078 Bacteria 2457
199 Ga0207702_10265872 3300026078 Bacteria 1616
200 Ga0207641_10655755 3300026088 Bacteria 1031
201 Ga0207648_10006943 3300026089 Bacteria 11212
202 Ga0207676_10049453 3300026095 Bacteria 3271
203 Ga0207676_10293743 3300026095 Bacteria 1481
204 Ga0207674_10145594 3300026116 Bacteria 2328
205 Ga0207674_10153501 3300026116 Bacteria 2259
206 Ga0207675_100020785 3300026118 Bacteria 6120
207 Ga0207683_10008299 3300026121 Bacteria 8885
208 Ga0207698_10112778 3300026142 Bacteria 2283
209 Ga0207698_10237400 3300026142 Bacteria 1659
210 Ga0207698_10255549 3300026142 Bacteria 1606
211 Ga0207698_10351179 3300026142 Bacteria 1393
212 Ga0209966_1010319 3300027695 Bacteria 1682
213 Ga0209974_10000666 3300027876 Bacteria 11642
214 Ga0209974_10014468 3300027876 Bacteria 2625
215 Ga0268266_10010254 3300028379 Bacteria 8206
216 Ga0268265_10044474 3300028380 Bacteria 3307
217 Ga0268265_10163425 3300028380 Bacteria 1894
218 Ga0268264_10065610 3300028381 Bacteria 3059
219 Ga0268264_10278787 3300028381 Bacteria 1565
220 Ga0316178_1150520 3300030735 Bacteria 1984
221 Ga0316182_1074290 3300030745 Bacteria 1782
222 Ga0307408_100030264 3300031548 Bacteria 3758
223 Ga0307408_100036047 3300031548 Bacteria 3474
224 Ga0307408_100442928 3300031548 Bacteria 1125
225 Ga0307405_10004902 3300031731 Bacteria 6391
226 Ga0307405_10011755 3300031731 Bacteria 4606
227 Ga0307405_10012236 3300031731 Bacteria 4533
228 Ga0307405_10015712 3300031731 Bacteria 4107
229 Ga0307405_10058010 3300031731 Bacteria 2434
230 Ga0307405_10380093 3300031731 Bacteria 1099
231 Ga0307413_10002752 3300031824 Bacteria 7231
232 Ga0307413_10023212 3300031824 Bacteria 3358
233 Ga0307413_10125626 3300031824 Bacteria 1746
234 Ga0307413_10135675 3300031824 Bacteria 1692
235 Ga0307413_10172554 3300031824 Bacteria 1532
236 Ga0307413_10211981 3300031824 Bacteria 1408
237 Ga0307410_10003874 3300031852 Bacteria 7612
238 Ga0307410_10022424 3300031852 Bacteria 3903
239 Ga0307410_10040793 3300031852 Bacteria 3057
240 Ga0307410_10048451 3300031852 Bacteria 2846
241 Ga0307410_10110549 3300031852 Bacteria 1988
242 Ga0307410_10123876 3300031852 Bacteria 1889
243 Ga0307406_10039739 3300031901 Bacteria 2921
244 Ga0307406_10063310 3300031901 Bacteria 2395
245 Ga0307406_10118390 3300031901 Bacteria 1836
246 Ga0307406_10160890 3300031901 Bacteria 1614
247 Ga0307406_10197124 3300031901 Bacteria 1479
248 Ga0307406_10351201 3300031901 Bacteria 1152
249 Ga0307407_10001400 3300031903 Bacteria 8698
250 Ga0307407_10008573 3300031903 Bacteria 4704
251 Ga0307407_10009336 3300031903 Bacteria 4561
252 Ga0307407_10014205 3300031903 Bacteria 3892
253 Ga0307407_10027744 3300031903 Bacteria 3018
254 Ga0307407_10074907 3300031903 Bacteria 2027
255 Ga0307407_10125694 3300031903 Bacteria 1633
256 Ga0307407_10218272 3300031903 Bacteria 1288
257 Ga0307412_10004881 3300031911 Bacteria 7492
258 Ga0307412_10011492 3300031911 Bacteria 5131
259 Ga0307412_10030148 3300031911 Bacteria 3411
260 Ga0307412_10145114 3300031911 Bacteria 1743
261 Ga0307412_10166507 3300031911 Bacteria 1644
262 Ga0307412_10269274 3300031911 Bacteria 1332
263 Ga0307412_10378030 3300031911 Bacteria 1146
264 Ga0307412_10477908 3300031911 Bacteria 1033
265 Ga0307412_10573932 3300031911 Bacteria 951
266 Ga0307409_100004490 3300031995 Bacteria 7853
267 Ga0307409_100006996 3300031995 Bacteria 6704
268 Ga0307409_100026745 3300031995 Bacteria 4075
269 Ga0307409_100061859 3300031995 Bacteria 2928
270 Ga0307409_100070637 3300031995 Bacteria 2772
271 Ga0307409_100109350 3300031995 Bacteria 2314
272 Ga0307409_100132931 3300031995 Bacteria 2130
273 Ga0307409_100144335 3300031995 Bacteria 2056
274 Ga0307409_100165515 3300031995 Bacteria 1940
275 Ga0307409_100215402 3300031995 Bacteria 1729
276 Ga0307409_100229851 3300031995 Bacteria 1681
277 Ga0307409_100383679 3300031995 Bacteria 1337
278 Ga0307409_100458071 3300031995 Bacteria 1232
279 Ga0307409_100676397 3300031995 Bacteria 1029
280 Ga0307416_100006854 3300032002 Bacteria 7170
281 Ga0307416_100009644 3300032002 Bacteria 6333
282 Ga0307416_100012783 3300032002 Bacteria 5676
283 Ga0307416_100021704 3300032002 Bacteria 4616
284 Ga0307416_100030250 3300032002 Bacteria 4060
285 Ga0307416_100149962 3300032002 Bacteria 2137
286 Ga0307416_100185560 3300032002 Bacteria 1954
287 Ga0307416_100627993 3300032002 Bacteria 1157
288 Ga0307414_10014018 3300032004 Bacteria 4790
289 Ga0307414_10015448 3300032004 Bacteria 4609
290 Ga0307414_10016458 3300032004 Bacteria 4495
291 Ga0307414_10054709 3300032004 Bacteria 2791
292 Ga0307414_10065705 3300032004 Bacteria 2589
293 Ga0307414_10120222 3300032004 Bacteria 2018
294 Ga0307414_10167659 3300032004 Bacteria 1752
295 Ga0307414_10267653 3300032004 Bacteria 1429
296 Ga0307414_10316118 3300032004 Bacteria 1327
297 Ga0307414_10356405 3300032004 Bacteria 1257
298 Ga0307414_10374901 3300032004 Bacteria 1228
299 Ga0307414_10715119 3300032004 Bacteria 908
300 Ga0307411_10003924 3300032005 Bacteria 7018
301 Ga0307411_10003978 3300032005 Bacteria 6979
302 Ga0307411_10014888 3300032005 Bacteria 4346
303 Ga0307411_10023388 3300032005 Bacteria 3659
304 Ga0307411_10049917 3300032005 Bacteria 2722
305 Ga0307411_10091289 3300032005 Bacteria 2127
306 Ga0307411_10161423 3300032005 Bacteria 1679
307 Ga0307411_10220366 3300032005 Bacteria 1471
308 Ga0307411_10417940 3300032005 Bacteria 1113
309 Ga0307415_100002358 3300032126 Bacteria 9392
310 Ga0307415_100006688 3300032126 Bacteria 6241
311 Ga0307415_100017251 3300032126 Bacteria 4324
312 Ga0307415_100027841 3300032126 Bacteria 3586
313 Ga0307415_100282842 3300032126 Bacteria 1365
314 Ga0307415_100403643 3300032126 Bacteria 1167
315 Ga0373949_0021112 3300035090 Bacteria 1495
316 Ga0373931_0011133 3300035691 Bacteria 4339
317 Ga0395899_0018132 3300037312 Bacteria 5356
318 Ga0395899_0022673 3300037312 Bacteria 4756
319 Ga0395899_0032217 3300037312 Bacteria 3938
320 Ga0395899_0045104 3300037312 Bacteria 3284
321 Ga0395899_0286365 3300037312 Bacteria 1119
322 Ga0395899_0351147 3300037312 Bacteria 986
323 Ga0395900_0002008 3300037418 Bacteria 22966
324 Ga0395900_0012506 3300037418 Bacteria 8681
325 Ga0395900_0017346 3300037418 Bacteria 7350
326 Ga0395900_0021947 3300037418 Bacteria 6527
327 Ga0395900_0067997 3300037418 Bacteria 3660
328 Ga0395900_0108794 3300037418 Bacteria 2847
329 Ga0395900_0110813 3300037418 Bacteria 2819
330 Ga0395900_0177611 3300037418 Bacteria 2165
331 Ga0395900_0261692 3300037418 Bacteria 1727
332 Ga0395900_0281336 3300037418 Bacteria 1655
333 Ga0395898_0036672 3300037466 Bacteria 4868
334 Ga0395898_0072840 3300037466 Bacteria 3318
335 Ga0395898_0491409 3300037466 Bacteria 1167
336 Ga0395905_0004032 3300037471 Bacteria 15414
337 Ga0395905_0006173 3300037471 Bacteria 12097
338 Ga0395905_0015950 3300037471 Bacteria 7139
339 Ga0395905_0039027 3300037471 Bacteria 4455
340 Ga0395905_0075399 3300037471 Bacteria 3161
341 Ga0395905_0150788 3300037471 Bacteria 2187
342 Ga0395905_0217955 3300037471 Bacteria 1787
343 Ga0395905_0261528 3300037471 Bacteria 1615
344 Ga0395905_0328880 3300037471 Bacteria 1418
345 Ga0395905_0340624 3300037471 Bacteria 1391
346 Ga0395905_0352122 3300037471 Bacteria 1365
347 Ga0395905_0505812 3300037471 Bacteria 1108
348 Ga0395901_0005237 3300038443 Bacteria 13091
349 Ga0395901_0042483 3300038443 Bacteria 4713
350 Ga0395901_0057733 3300038443 Bacteria 4036
351 Ga0395901_0122941 3300038443 Bacteria 2727
352 Ga0395901_0257913 3300038443 Bacteria 1815
353 Ga0395901_0296267 3300038443 Bacteria 1677
354 Ga0395901_0353813 3300038443 Bacteria 1515
355 Ga0395901_0393535 3300038443 Bacteria 1424
356 Ga0395901_0423570 3300038443 Bacteria 1365
357 Ga0436360_0839717 3300039438 Bacteria 946
358 Ga0436361_0901402 3300039447 Bacteria 1348
359 Ga0436361_0941092 3300039447 Bacteria 1486
360 Ga0439465_0172210 3300041413 Bacteria 780
361 Ga0439445_0009185 3300042004 Bacteria 2326
362 Ga0439449_0073591 3300042007 Bacteria 1259
363 Ga0451577_0004056 3300042876 Bacteria 15746
364 Ga0451577_0124633 3300042876 Bacteria 2308
365 Ga0451577_0443083 3300042876 Bacteria 1179
366 Ga0466969_0065588 3300044656 Bacteria 1755
367 Ga0466966_0015374 3300044684 Bacteria 5060
368 Ga0466966_0321642 3300044684 Unclassified 929
369 Ga0466961_0091612 3300044693 Bacteria 1919
370 Ga0466961_0094673 3300044693 Bacteria 1884
371 Ga0466963_0012823 3300044694 Bacteria 5135
372 Ga0466963_0015218 3300044694 Bacteria 4759
373 Ga0466963_0037166 3300044694 Bacteria 3178
374 Ga0466963_0306591 3300044694 Bacteria 1117
375 Ga0466963_0343080 3300044694 Unclassified 1052
376 Ga0453684_0103888 3300044712 Bacteria 3470
377 Ga0466971_0004306 3300044719 Bacteria 6135
378 Ga0466971_0200010 3300044719 Bacteria 943
379 Ga0466970_0005939 3300044765 Bacteria 6087
380 Ga0466970_0054926 3300044765 Bacteria 2127
381 Ga0466957_0009525 3300044842 Bacteria 5547
382 Ga0466959_0035229 3300045049 Bacteria 3703
383 Ga0451576_0113772 3300045051 Bacteria 2817
384 Ga0466958_0139061 3300045836 Bacteria 1528
385 Ga0466967_0007548 3300045976 Bacteria 7855
386 Ga0466967_0015201 3300045976 Bacteria 6028
387 Ga0466967_0038312 3300045976 Bacteria 4110
388 Ga0466967_0149093 3300045976 Bacteria 2185
389 Ga0466967_0212065 3300045976 Bacteria 1837
390 Ga0466967_0221872 3300045976 Bacteria 1797
391 Ga0495585_0058822 3300046492 Bacteria 2120
392 Ga0495663_0000735 3300046525 Bacteria 11246
393 Ga0495642_0068226 3300046528 Bacteria 1484
394 Ga0495621_0000238 3300046539 Bacteria 13007
395 Ga0495633_0088670 3300046558 Bacteria 1438
396 Ga0495668_0051594 3300046616 Bacteria 2277
397 Ga0495659_0111436 3300046664 Bacteria 1069
398 Ga0495659_0123696 3300046664 Bacteria 1021
399 Ga0495669_0010340 3300046684 Bacteria 3943
400 Ga0495669_0028324 3300046684 Bacteria 2453
401 Ga0495670_0027389 3300046691 Bacteria 2823
402 Ga0495670_0134964 3300046691 Bacteria 1288
403 Ga0495670_0142874 3300046691 Bacteria 1252
404 Ga0495677_0013496 3300047445 Bacteria 2975
405 Ga0495677_0015923 3300047445 Bacteria 2729
406 Ga0496104_0287144 3300048907 Bacteria 1558
407 Ga0496108_0065704 3300048911 Unclassified 3058
408 Ga0496109_0078308 3300048912 Bacteria 3044
409 Ga0496114_0001548 3300048917 Bacteria 17437
410 Ga0501041_0044891 3300049577 Bacteria 2686
411 Ga0501041_0418217 3300049577 Bacteria 850
412 Ga0501074_0524634 3300049590 Bacteria 839
413 Ga0501249_003289 3300049679 Bacteria 3250
414 Ga0501267_005201 3300049764 Bacteria 1226
415 Ga0501045_0434464 3300049824 Bacteria 976
416 nmdc:mga08x19_145610_c1 3300050514 Bacteria 1602
417 Ga0466962_0018606 3300061719 Bacteria 3341
418 2885427881 2885427238 Bacteria 2291351
419 2896430737 2896429255 Bacteria 2557483
420 Ga0496103_0032160
421 JGI24741J21665_1022713
422 JGI24740J21852_10057965
423 JGI24739J22299_10003721
424 JGI24737J22298_10002883
425 JGI24738J21930_10000992
426 JGI24738J21930_10001169
427 Ga0065715_10000902
428 Ga0070658_10000205
429 Ga0070658_10061099
430 Ga0070658_10189262
431 Ga0070658_10562075
432 Ga0070676_10031551
433 Ga0070683_100040869
434 Ga0070683_100455356
435 Ga0070670_100001324
436 Ga0070670_100213039
437 Ga0070677_10004585
438 Ga0070666_10001012
439 Ga0070680_100030315
440 Ga0070680_100036698
441 Ga0070682_100004951
442 Ga0070682_100159597
443 Ga0070660_100000009
444 Ga0070660_100106557
445 Ga0070689_100193756
446 Ga0070661_100000100
447 Ga0070661_100078415
448 Ga0070668_100021267
449 Ga0070668_100223410
450 Ga0070669_100003256
451 Ga0070675_100000241
452 Ga0070671_100007655
453 Ga0070671_100016850
454 Ga0070671_100020808
455 Ga0070674_100001601
456 Ga0070674_100439592
457 Ga0070673_100619916
458 Ga0070659_100000048
459 Ga0070659_100121158
460 Ga0070659_100134019
461 Ga0070659_100258348
462 Ga0070659_100346461
463 Ga0070667_100003299
464 Ga0070667_100046148
465 Ga0070667_100132210
466 Ga0070709_10418429
467 Ga0070714_100101755
468 Ga0070714_100184037
469 Ga0070714_100227017
470 Ga0070714_100282223
471 Ga0070694_100232342
472 Ga0070663_100000620
473 Ga0070663_100057821
474 Ga0070663_100095572
475 Ga0070663_100245615
476 Ga0070678_100087818
477 Ga0070662_100000035
478 Ga0070662_100002266
479 Ga0070681_10125544
480 Ga0070679_100228555
481 Ga0070679_100735765
482 Ga0070684_100068157
483 Ga0068853_100001248
484 Ga0070672_100006537
485 Ga0070672_100059260
486 Ga0070696_100589206
487 Ga0070693_100008697
488 Ga0070693_100197027
489 Ga0070665_100012074
490 Ga0068855_100001487
491 Ga0068855_100264175
492 Ga0068855_100283596
493 Ga0068855_100491251
494 Ga0070664_100000025
495 Ga0068857_100082474
496 Ga0068857_100101839
497 Ga0068854_100002456
498 Ga0068854_100015176
499 Ga0068854_100123786
500 Ga0068856_100000124
501 Ga0068856_100037364
502 Ga0068856_100348319
503 Ga0068856_100801369
504 Ga0068852_100180121
505 Ga0068852_100292492
506 Ga0068852_100347941
507 Ga0068852_100443970
508 Ga0068859_100005035
509 Ga0068859_100066847
510 Ga0068859_100242891
511 Ga0068864_100062136
512 Ga0068864_100068106
513 Ga0068864_100163866
514 Ga0068861_100042736
515 Ga0068851_10005842
516 Ga0068851_10104304
517 Ga0068863_100599716
518 Ga0068858_100031238
519 Ga0068860_100357212
520 Ga0068862_100060831
521 Ga0068862_100234167
522 Ga0068871_100545029
523 Ga0075431_100264559
524 Ga0097620_100005035
525 Ga0097620_100242891
526 Ga0105240_11018592
527 Ga0111539_10295231
528 Ga0105248_10000163
529 Ga0105248_10165199
530 Ga0105248_10221100
531 Ga0105238_10497823
532 Ga0105249_10201237
533 Ga0105239_11305756
534 Ga0157373_10008474
535 Ga0157371_10000722
536 Ga0157371_10035630
537 Ga0157371_10045026
538 Ga0157370_10126609
539 Ga0157369_10192684
540 Ga0157374_10151117
541 Ga0157374_10188540
542 Ga0163162_10060569
543 Ga0157372_10040947
544 Ga0157372_10138586
545 Ga0163163_10000173
546 Ga0163163_10785382
547 Ga0157380_10022685
548 Ga0157380_10038860
549 Ga0157380_10231460
550 Ga0157380_10846894
551 Ga0157379_10059356
552 Ga0163161_10001171
553 Ga0206354_11099638
554 Ga0206353_10418501
555 Ga0206353_11678682
556 Ga0207666_1004644
557 Ga0207697_10003251
558 Ga0207682_10000726
559 Ga0207680_10000588
560 Ga0207647_10014024
561 Ga0207647_10079033
562 Ga0207645_10015919
563 Ga0207643_10068575
564 Ga0207705_10000114
565 Ga0207705_10322966
566 Ga0207705_10454217
567 Ga0207707_10273421
568 Ga0207660_10641945
569 Ga0207657_10000071
570 Ga0207657_10014979
571 Ga0207657_10081399
572 Ga0207657_10259149
573 Ga0207649_10000301
574 Ga0207652_10243862
575 Ga0207652_10467016
576 Ga0207681_10006608
577 Ga0207694_10080864
578 Ga0207650_10000997
579 Ga0207650_10087257
580 Ga0207659_10000824
581 Ga0207664_10055293
582 Ga0207664_10143163
583 Ga0207644_10021816
584 Ga0207644_10058878
585 Ga0207690_10000045
586 Ga0207690_10102002
587 Ga0207706_10000086
588 Ga0207706_10000401
589 Ga0207706_10153549
590 Ga0207691_10009772
591 Ga0207691_10073024
592 Ga0207711_10003283
593 Ga0207711_10010347
594 Ga0207661_10001017
595 Ga0207679_10000315
596 Ga0207679_10187913
597 Ga0207667_10001152
598 Ga0207667_10134676
599 Ga0207651_10002250
600 Ga0207712_10120399
601 Ga0207668_10000673
602 Ga0207668_10226221
603 Ga0207640_10001884
604 Ga0207640_10267222
605 Ga0207703_10165285
606 Ga0207639_10000330
607 Ga0207639_10462315
608 Ga0207678_10000311
609 Ga0207678_10058320
610 Ga0207678_10112281
611 Ga0207678_10147977
612 Ga0207678_10253992
613 Ga0207708_10034885
614 Ga0207702_10000254
615 Ga0207702_10058590
616 Ga0207702_10088481
617 Ga0207702_10109098
618 Ga0207702_10265872
619 Ga0207641_10655755
620 Ga0207648_10006943
621 Ga0207676_10049453
622 Ga0207676_10293743
623 Ga0207674_10145594
624 Ga0207674_10153501
625 Ga0207675_100020785
626 Ga0207683_10008299
627 Ga0207698_10112778
628 Ga0207698_10237400
629 Ga0207698_10255549
630 Ga0207698_10351179
631 Ga0209966_1010319
632 Ga0209974_10000666
633 Ga0209974_10014468
634 Ga0268266_10010254
635 Ga0268265_10044474
636 Ga0268265_10163425
637 Ga0268264_10065610
638 Ga0268264_10278787
639 Ga0316178_1150520
640 Ga0316182_1074290
641 Ga0307408_100030264
642 Ga0307408_100036047
643 Ga0307408_100442928
644 Ga0307405_10004902
645 Ga0307405_10011755
646 Ga0307405_10012236
647 Ga0307405_10015712
648 Ga0307405_10058010
649 Ga0307405_10380093
650 Ga0307413_10002752
651 Ga0307413_10023212
652 Ga0307413_10125626
653 Ga0307413_10135675
654 Ga0307413_10172554
655 Ga0307413_10211981
656 Ga0307410_10003874
657 Ga0307410_10022424
658 Ga0307410_10040793
659 Ga0307410_10048451
660 Ga0307410_10110549
661 Ga0307410_10123876
662 Ga0307406_10039739
663 Ga0307406_10063310
664 Ga0307406_10118390
665 Ga0307406_10160890
666 Ga0307406_10197124
667 Ga0307406_10351201
668 Ga0307407_10001400
669 Ga0307407_10008573
670 Ga0307407_10009336
671 Ga0307407_10014205
672 Ga0307407_10027744
673 Ga0307407_10074907
674 Ga0307407_10125694
675 Ga0307407_10218272
676 Ga0307412_10004881
677 Ga0307412_10011492
678 Ga0307412_10030148
679 Ga0307412_10145114
680 Ga0307412_10166507
681 Ga0307412_10269274
682 Ga0307412_10378030
683 Ga0307412_10477908
684 Ga0307412_10573932
685 Ga0307409_100004490
686 Ga0307409_100006996
687 Ga0307409_100026745
688 Ga0307409_100061859
689 Ga0307409_100070637
690 Ga0307409_100109350
691 Ga0307409_100132931
692 Ga0307409_100144335
693 Ga0307409_100165515
694 Ga0307409_100215402
695 Ga0307409_100229851
696 Ga0307409_100383679
697 Ga0307409_100458071
698 Ga0307409_100676397
699 Ga0307416_100006854
700 Ga0307416_100009644
701 Ga0307416_100012783
702 Ga0307416_100021704
703 Ga0307416_100030250
704 Ga0307416_100149962
705 Ga0307416_100185560
706 Ga0307416_100627993
707 Ga0307414_10014018
708 Ga0307414_10015448
709 Ga0307414_10016458
710 Ga0307414_10054709
711 Ga0307414_10065705
712 Ga0307414_10120222
713 Ga0307414_10167659
714 Ga0307414_10267653
715 Ga0307414_10316118
716 Ga0307414_10356405
717 Ga0307414_10374901
718 Ga0307414_10715119
719 Ga0307411_10003924
720 Ga0307411_10003978
721 Ga0307411_10014888
722 Ga0307411_10023388
723 Ga0307411_10049917
724 Ga0307411_10091289
725 Ga0307411_10161423
726 Ga0307411_10220366
727 Ga0307411_10417940
728 Ga0307415_100002358
729 Ga0307415_100006688
730 Ga0307415_100017251
731 Ga0307415_100027841
732 Ga0307415_100282842
733 Ga0307415_100403643
734 Ga0373949_0021112
735 Ga0373931_0011133
736 Ga0395899_0018132
737 Ga0395899_0022673
738 Ga0395899_0032217
739 Ga0395899_0045104
740 Ga0395899_0286365
741 Ga0395899_0351147
742 Ga0395900_0002008
743 Ga0395900_0012506
744 Ga0395900_0017346
745 Ga0395900_0021947
746 Ga0395900_0067997
747 Ga0395900_0108794
748 Ga0395900_0110813
749 Ga0395900_0177611
750 Ga0395900_0261692
751 Ga0395900_0281336
752 Ga0395898_0036672
753 Ga0395898_0072840
754 Ga0395898_0491409
755 Ga0395905_0004032
756 Ga0395905_0006173
757 Ga0395905_0015950
758 Ga0395905_0039027
759 Ga0395905_0075399
760 Ga0395905_0150788
761 Ga0395905_0217955
762 Ga0395905_0261528
763 Ga0395905_0328880
764 Ga0395905_0340624
765 Ga0395905_0352122
766 Ga0395905_0505812
767 Ga0395901_0005237
768 Ga0395901_0042483
769 Ga0395901_0057733
770 Ga0395901_0122941
771 Ga0395901_0257913
772 Ga0395901_0296267
773 Ga0395901_0353813
774 Ga0395901_0393535
775 Ga0395901_0423570
776 Ga0436360_0839717
777 Ga0436361_0901402
778 Ga0436361_0941092
779 Ga0439465_0172210
780 Ga0439445_0009185
781 Ga0439449_0073591
782 Ga0451577_0004056
783 Ga0451577_0124633
784 Ga0451577_0443083
785 Ga0466969_0065588
786 Ga0466966_0015374
787 Ga0466966_0321642
788 Ga0466961_0091612
789 Ga0466961_0094673
790 Ga0466963_0012823
791 Ga0466963_0015218
792 Ga0466963_0037166
793 Ga0466963_0306591
794 Ga0466963_0343080
795 Ga0453684_0103888
796 Ga0466971_0004306
797 Ga0466971_0200010
798 Ga0466970_0005939
799 Ga0466970_0054926
800 Ga0466957_0009525
801 Ga0466959_0035229
802 Ga0451576_0113772
803 Ga0466958_0139061
804 Ga0466967_0007548
805 Ga0466967_0015201
806 Ga0466967_0038312
807 Ga0466967_0149093
808 Ga0466967_0212065
809 Ga0466967_0221872
810 Ga0495585_0058822
811 Ga0495663_0000735
812 Ga0495642_0068226
813 Ga0495621_0000238
814 Ga0495633_0088670
815 Ga0495668_0051594
816 Ga0495659_0111436
817 Ga0495659_0123696
818 Ga0495669_0010340
819 Ga0495669_0028324
820 Ga0495670_0027389
821 Ga0495670_0134964
822 Ga0495670_0142874
823 Ga0495677_0013496
824 Ga0495677_0015923
825 Ga0496104_0287144
826 Ga0496108_0065704
827 Ga0496109_0078308
828 Ga0496114_0001548
829 Ga0501041_0044891
830 Ga0501041_0418217
831 Ga0501074_0524634
832 Ga0501249_003289
833 Ga0501267_005201
834 Ga0501045_0434464
835 nmdc:mga08x19_145610_c1
836 Ga0466962_0018606
837 2885427881
838 2896430737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

45

289

0.98

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

50

289

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdu-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9512 4 232
5ve2-assembly3.cif.gz_I crystal structure of enoyl-coa hydratase/isomerase from pseudoalteromonas atlantica t6c at 2.3 a resolution. 0.9508 3 248
6lvo-assembly1.cif.gz_A enoyl-coa isomerase (boeci) from bosea sp. pamc 26642 0.9488 3 246
4u1a-assembly1.cif.gz_C crystal structure of human peroxisomal delta3,delta2, enoyl-coa isomerase helix-10 deletion mutant (isob-eci2) 0.9487 3 238
3fdu-assembly1.cif.gz_B crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9476 1 238
ID Description Score Start End Superfamily
3fduF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9512 4 232 3.90.226.10
5ve2I00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9495 3 248 3.90.226.10
3fduF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9469 4 232 3.90.226.10
4nekC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9466 2 198 3.90.226.10
3fduC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9436 1 179 3.90.226.10
ID Description Score Start End GO Terms
AF-W7QGA5-F1-model_v4 Enoyl-CoA hydratase 0.9732 83 250 GO:0004165
GO:0005777
AF-A0A850KFA2-F1-model_v4 Enoyl-CoA hydratase 0.9726 1 246 GO:0004165
GO:0005777
AF-A0A6A7S9K2-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36) 0.97 1 250 GO:0004165
GO:0005777
GO:0008935
AF-A0A381A8A3-F1-model_v4 Probable enoyl-CoA hydratase echA8 (EC 4.2.1.17) 0.9698 3 246 GO:0004165
GO:0004300
GO:0005777
AF-A0A151QJB5-F1-model_v4 Enoyl-CoA hydratase 0.9688 3 248 GO:0004165
GO:0005777

Map