F439620
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 419 | 191 | 838 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0017794|Ga0501070_0017794_1701_2678 |
| Length | 325 |
| Sequence | MVFTTDYMLFLSVSKLTQREHMPLSLEDIRRNCLQARAAMARAREHHFALGAFNLDNQETLVAVCRAAAKKKAPVLVEISQGEADALGLLNVRDLVDNYKRQYGVEMYINLDHSPSVVNAKAGIDAGFEFIHIDVSQANHEASEAEIIQATKEVVEYAKFTGALVESEPHYFGGGSNRFTKAFDYNEIKKTFSTPAGAMAFVDATRIDTYAAAVGNLHGQYPVPKRLDLDLLKKIRAAIDCNISLHGGSGTPGHYFKDAVKIGVSKININSDMRVAYRETLERVLKENKTEYAVVKLMGQVIEAVQAVVESKIDVFNSANKAVVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 58 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 59 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 60 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 111 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 116 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 117 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 118 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 119 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 120 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 124 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 126 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 143 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 144 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 145 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 146 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 147 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 148 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 162 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 163 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 164 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 165 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 167 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 168 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 169 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 170 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 171 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 172 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 173 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 174 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 175 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 176 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 177 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 178 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 179 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 180 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 181 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 182 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 183 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 184 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 185 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 186 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 187 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 188 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
| 189 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 190 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 191 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.9 |
| Nodule | 0.24 |
| Rhizoplane | 0.48 |
| Rhizosphere | 79.24 |
| Stem | 0.24 |
| Stem Tuber | 0 |
| Unclassified | 12.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501070_0017794 | 3300049586 | Bacteria | 5968 |
| 2 | JGI24735J21928_10000035 | 3300002067 | Bacteria | 66299 |
| 3 | JGI24738J21930_10000894 | 3300002075 | Bacteria | 8557 |
| 4 | JGI24738J21930_10005990 | 3300002075 | Bacteria | 2883 |
| 5 | JGI24033J26618_1011828 | 3300002155 | Bacteria | 1045 |
| 6 | JGI25152J39213_1000810 | 3300002773 | Bacteria | 15597 |
| 7 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 8 | rootH2_10006847 | 3300003320 | Bacteria | 155484 |
| 9 | rootL2_10039152 | 3300003322 | Bacteria | 8737 |
| 10 | rootL2_10150960 | 3300003322 | Bacteria | 1531 |
| 11 | rootL2_10372472 | 3300003322 | Unclassified | 1256 |
| 12 | rootH1_10377350 | 3300003323 | Bacteria | 1830 |
| 13 | JGI25405J52794_10035945 | 3300003911 | Unclassified | 1038 |
| 14 | Ga0070658_10000038 | 3300005327 | Bacteria | 137159 |
| 15 | Ga0070658_10030766 | 3300005327 | Unclassified | 4312 |
| 16 | Ga0070676_10004047 | 3300005328 | Bacteria | 7701 |
| 17 | Ga0070683_100003442 | 3300005329 | Bacteria | 12849 |
| 18 | Ga0070666_10114612 | 3300005335 | Unclassified | 1866 |
| 19 | Ga0070680_100032589 | 3300005336 | Bacteria | 4195 |
| 20 | Ga0070682_100035372 | 3300005337 | Bacteria | 3049 |
| 21 | Ga0070682_100130865 | 3300005337 | Bacteria | 1698 |
| 22 | Ga0070660_100000078 | 3300005339 | Bacteria | 58990 |
| 23 | Ga0070660_100000224 | 3300005339 | Bacteria | 37460 |
| 24 | Ga0070660_100000454 | 3300005339 | Bacteria | 27343 |
| 25 | Ga0070660_100011712 | 3300005339 | Bacteria | 6245 |
| 26 | Ga0070660_100081577 | 3300005339 | Bacteria | 2539 |
| 27 | Ga0070691_10005326 | 3300005341 | Bacteria | 5849 |
| 28 | Ga0070661_100006618 | 3300005344 | Bacteria | 7993 |
| 29 | Ga0070661_100131605 | 3300005344 | Bacteria | 1879 |
| 30 | Ga0070674_100013892 | 3300005356 | Unclassified | 4991 |
| 31 | Ga0070673_100000478 | 3300005364 | Bacteria | 21291 |
| 32 | Ga0070688_100093828 | 3300005365 | Bacteria | 1966 |
| 33 | Ga0070659_100001084 | 3300005366 | Bacteria | 19882 |
| 34 | Ga0070659_100001424 | 3300005366 | Bacteria | 17256 |
| 35 | Ga0070659_100037495 | 3300005366 | Unclassified | 3779 |
| 36 | Ga0070678_100000939 | 3300005456 | Bacteria | 14973 |
| 37 | Ga0070662_100002601 | 3300005457 | Bacteria | 11130 |
| 38 | Ga0070681_10046564 | 3300005458 | Bacteria | 4336 |
| 39 | Ga0070681_10312084 | 3300005458 | Unclassified | 1482 |
| 40 | Ga0070681_10473974 | 3300005458 | Bacteria | 1164 |
| 41 | Ga0068867_100176116 | 3300005459 | Archaea | 1697 |
| 42 | Ga0068867_100266613 | 3300005459 | Bacteria | 1398 |
| 43 | Ga0070685_10002053 | 3300005466 | Bacteria | 10422 |
| 44 | Ga0070685_10032393 | 3300005466 | Unclassified | 2927 |
| 45 | Ga0070679_100000730 | 3300005530 | Bacteria | 28399 |
| 46 | Ga0070679_100018926 | 3300005530 | Bacteria | 6687 |
| 47 | Ga0070679_100020085 | 3300005530 | Bacteria | 6510 |
| 48 | Ga0070679_100053925 | 3300005530 | Bacteria | 4003 |
| 49 | Ga0070679_100062827 | 3300005530 | Unclassified | 3702 |
| 50 | Ga0070684_100061525 | 3300005535 | Bacteria | 3286 |
| 51 | Ga0070684_100130815 | 3300005535 | Archaea | 2264 |
| 52 | Ga0068853_100036277 | 3300005539 | Bacteria | 4191 |
| 53 | Ga0070672_100104928 | 3300005543 | Unclassified | 2297 |
| 54 | Ga0070686_100457687 | 3300005544 | Unclassified | 982 |
| 55 | Ga0068855_100000011 | 3300005563 | Bacteria | 244140 |
| 56 | Ga0068855_100000211 | 3300005563 | Bacteria | 74558 |
| 57 | Ga0068855_100022054 | 3300005563 | Bacteria | 7634 |
| 58 | Ga0068855_100095667 | 3300005563 | Bacteria | 3423 |
| 59 | Ga0070664_100000215 | 3300005564 | Bacteria | 41073 |
| 60 | Ga0068857_100000002 | 3300005577 | Bacteria | 241401 |
| 61 | Ga0068857_100000899 | 3300005577 | Bacteria | 22465 |
| 62 | Ga0068857_100004295 | 3300005577 | Bacteria | 12019 |
| 63 | Ga0068857_100011110 | 3300005577 | Bacteria | 7832 |
| 64 | Ga0068856_100000016 | 3300005614 | Bacteria | 155667 |
| 65 | Ga0068856_100000059 | 3300005614 | Bacteria | 101763 |
| 66 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 67 | Ga0068852_100000030 | 3300005616 | Bacteria | 102901 |
| 68 | Ga0068852_100131238 | 3300005616 | Bacteria | 2307 |
| 69 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 70 | Ga0081455_10000003 | 3300005937 | Bacteria | 367763 |
| 71 | Ga0075365_10000001 | 3300006038 | Bacteria | 371589 |
| 72 | Ga0075365_10000014 | 3300006038 | Bacteria | 79945 |
| 73 | Ga0075365_10002182 | 3300006038 | Bacteria | 9431 |
| 74 | Ga0075365_10002844 | 3300006038 | Bacteria | 8686 |
| 75 | Ga0075365_10016993 | 3300006038 | Bacteria | 4443 |
| 76 | Ga0075365_10024832 | 3300006038 | Unclassified | 3787 |
| 77 | Ga0075365_10337367 | 3300006038 | Bacteria | 1062 |
| 78 | Ga0075368_10000476 | 3300006042 | Bacteria | 11899 |
| 79 | Ga0075364_10004369 | 3300006051 | Bacteria | 8116 |
| 80 | Ga0075364_10009942 | 3300006051 | Bacteria | 5723 |
| 81 | Ga0075364_10014021 | 3300006051 | Bacteria | 4943 |
| 82 | Ga0075364_10028428 | 3300006051 | Bacteria | 3580 |
| 83 | Ga0075362_10013861 | 3300006177 | Bacteria | 3238 |
| 84 | Ga0075367_10000484 | 3300006178 | Bacteria | 14907 |
| 85 | Ga0075369_10000006 | 3300006186 | Bacteria | 132271 |
| 86 | Ga0075369_10001586 | 3300006186 | Bacteria | 7812 |
| 87 | Ga0075366_10001205 | 3300006195 | Bacteria | 12830 |
| 88 | Ga0097621_100003413 | 3300006237 | Bacteria | 10943 |
| 89 | Ga0097621_100302345 | 3300006237 | Bacteria | 1413 |
| 90 | Ga0075370_10009462 | 3300006353 | Bacteria | 5062 |
| 91 | Ga0068871_100000156 | 3300006358 | Bacteria | 45103 |
| 92 | Ga0068871_100028100 | 3300006358 | Bacteria | 4406 |
| 93 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 94 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 95 | Ga0105240_10000501 | 3300009093 | Bacteria | 72270 |
| 96 | Ga0105240_10013363 | 3300009093 | Bacteria | 11278 |
| 97 | Ga0105240_10095244 | 3300009093 | Bacteria | 3630 |
| 98 | Ga0105240_10108967 | 3300009093 | Bacteria | 3354 |
| 99 | Ga0105240_10143376 | 3300009093 | Bacteria | 2854 |
| 100 | Ga0105240_10650855 | 3300009093 | Bacteria | 1155 |
| 101 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 102 | Ga0105245_10000122 | 3300009098 | Bacteria | 75415 |
| 103 | Ga0105245_10034602 | 3300009098 | Unclassified | 4482 |
| 104 | Ga0105245_10069362 | 3300009098 | Bacteria | 3196 |
| 105 | Ga0105245_10108573 | 3300009098 | Unclassified | 2577 |
| 106 | Ga0105245_10123222 | 3300009098 | Unclassified | 2424 |
| 107 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 108 | Ga0105241_10005985 | 3300009174 | Bacteria | 8974 |
| 109 | Ga0105241_10007986 | 3300009174 | Bacteria | 7783 |
| 110 | Ga0105241_10170175 | 3300009174 | Bacteria | 1799 |
| 111 | Ga0105242_10000064 | 3300009176 | Bacteria | 74150 |
| 112 | Ga0105242_10116614 | 3300009176 | Unclassified | 2285 |
| 113 | Ga0105248_10387108 | 3300009177 | Bacteria | 1574 |
| 114 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 115 | Ga0105237_10009676 | 3300009545 | Bacteria | 10316 |
| 116 | Ga0105238_10109234 | 3300009551 | Bacteria | 2747 |
| 117 | Ga0105238_10132129 | 3300009551 | Bacteria | 2474 |
| 118 | Ga0105238_10205850 | 3300009551 | Bacteria | 1943 |
| 119 | Ga0105238_10239851 | 3300009551 | Bacteria | 1790 |
| 120 | Ga0105032_100001 | 3300009979 | Bacteria | 472394 |
| 121 | Ga0105032_100054 | 3300009979 | Bacteria | 14092 |
| 122 | Ga0105032_101404 | 3300009979 | Bacteria | 2208 |
| 123 | Ga0105029_100020 | 3300009984 | Bacteria | 8175 |
| 124 | Ga0105033_101693 | 3300009986 | Bacteria | 1813 |
| 125 | Ga0105028_100230 | 3300009993 | Bacteria | 6086 |
| 126 | Ga0105239_10000411 | 3300010375 | Bacteria | 62529 |
| 127 | Ga0105239_10004097 | 3300010375 | Bacteria | 17527 |
| 128 | Ga0105239_10027653 | 3300010375 | Bacteria | 6240 |
| 129 | Ga0105239_10104675 | 3300010375 | Bacteria | 3133 |
| 130 | Ga0105239_10157600 | 3300010375 | Bacteria | 2536 |
| 131 | Ga0105246_10000299 | 3300011119 | Bacteria | 26103 |
| 132 | Ga0105246_10000411 | 3300011119 | Bacteria | 22903 |
| 133 | Ga0105246_10001269 | 3300011119 | Bacteria | 14825 |
| 134 | Ga0157373_10000708 | 3300013100 | Bacteria | 26130 |
| 135 | Ga0157373_10017493 | 3300013100 | Bacteria | 5221 |
| 136 | Ga0157371_10261634 | 3300013102 | Bacteria | 1247 |
| 137 | Ga0157370_10000115 | 3300013104 | Bacteria | 92585 |
| 138 | Ga0157370_10000538 | 3300013104 | Bacteria | 47433 |
| 139 | Ga0157370_10033055 | 3300013104 | Bacteria | 5045 |
| 140 | Ga0157370_10254686 | 3300013104 | Unclassified | 1623 |
| 141 | Ga0157370_10297054 | 3300013104 | Bacteria | 1491 |
| 142 | Ga0157369_10000029 | 3300013105 | Bacteria | 206955 |
| 143 | Ga0157369_10000413 | 3300013105 | Bacteria | 56589 |
| 144 | Ga0157369_10000657 | 3300013105 | Bacteria | 44727 |
| 145 | Ga0157369_10001676 | 3300013105 | Bacteria | 27019 |
| 146 | Ga0157369_10041458 | 3300013105 | Bacteria | 5025 |
| 147 | Ga0157374_10000031 | 3300013296 | Bacteria | 204840 |
| 148 | Ga0157374_10000934 | 3300013296 | Bacteria | 25443 |
| 149 | Ga0157374_10003500 | 3300013296 | Bacteria | 13203 |
| 150 | Ga0157374_10548752 | 3300013296 | Bacteria | 1163 |
| 151 | Ga0157378_10003107 | 3300013297 | Bacteria | 14760 |
| 152 | Ga0157378_10013335 | 3300013297 | Bacteria | 7183 |
| 153 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 154 | Ga0157372_10000086 | 3300013307 | Bacteria | 96247 |
| 155 | Ga0157372_10138568 | 3300013307 | Bacteria | 2803 |
| 156 | Ga0163163_10003002 | 3300014325 | Bacteria | 14278 |
| 157 | Ga0163163_10271521 | 3300014325 | Unclassified | 1747 |
| 158 | Ga0157377_10000130 | 3300014745 | Bacteria | 48543 |
| 159 | Ga0157377_10038737 | 3300014745 | Bacteria | 2633 |
| 160 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 161 | Ga0157376_10000027 | 3300014969 | Bacteria | 204157 |
| 162 | Ga0157376_10016720 | 3300014969 | Bacteria | 5578 |
| 163 | Ga0207680_10036004 | 3300025903 | Unclassified | 2847 |
| 164 | Ga0207647_10000458 | 3300025904 | Bacteria | 33136 |
| 165 | Ga0207647_10001382 | 3300025904 | Bacteria | 18643 |
| 166 | Ga0207645_10007453 | 3300025907 | Bacteria | 7727 |
| 167 | Ga0207705_10000051 | 3300025909 | Bacteria | 169369 |
| 168 | Ga0207705_10000056 | 3300025909 | Bacteria | 157554 |
| 169 | Ga0207705_10003555 | 3300025909 | Bacteria | 11865 |
| 170 | Ga0207705_10004982 | 3300025909 | Bacteria | 9964 |
| 171 | Ga0207705_10017090 | 3300025909 | Bacteria | 5197 |
| 172 | Ga0207705_10017240 | 3300025909 | Bacteria | 5173 |
| 173 | Ga0207705_10018486 | 3300025909 | Bacteria | 4983 |
| 174 | Ga0207705_10024521 | 3300025909 | Unclassified | 4304 |
| 175 | Ga0207654_10007261 | 3300025911 | Bacteria | 5584 |
| 176 | Ga0207654_10097809 | 3300025911 | Bacteria | 1802 |
| 177 | Ga0207707_10009504 | 3300025912 | Bacteria | 8436 |
| 178 | Ga0207707_10043952 | 3300025912 | Bacteria | 3896 |
| 179 | Ga0207707_10068269 | 3300025912 | Unclassified | 3097 |
| 180 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 181 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 182 | Ga0207695_10001249 | 3300025913 | Bacteria | 43466 |
| 183 | Ga0207695_10043167 | 3300025913 | Unclassified | 4807 |
| 184 | Ga0207695_10084073 | 3300025913 | Bacteria | 3214 |
| 185 | Ga0207695_10165066 | 3300025913 | Bacteria | 2143 |
| 186 | Ga0207695_10263780 | 3300025913 | Unclassified | 1619 |
| 187 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 188 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 189 | Ga0207671_10004219 | 3300025914 | Bacteria | 13846 |
| 190 | Ga0207660_10001756 | 3300025917 | Bacteria | 14531 |
| 191 | Ga0207660_10011757 | 3300025917 | Bacteria | 5708 |
| 192 | Ga0207660_10013472 | 3300025917 | Bacteria | 5359 |
| 193 | Ga0207657_10000741 | 3300025919 | Bacteria | 34635 |
| 194 | Ga0207657_10001246 | 3300025919 | Bacteria | 27202 |
| 195 | Ga0207657_10003208 | 3300025919 | Bacteria | 17504 |
| 196 | Ga0207657_10004983 | 3300025919 | Bacteria | 13968 |
| 197 | Ga0207657_10005105 | 3300025919 | Bacteria | 13753 |
| 198 | Ga0207652_10004857 | 3300025921 | Bacteria | 10886 |
| 199 | Ga0207652_10005031 | 3300025921 | Bacteria | 10713 |
| 200 | Ga0207652_10017113 | 3300025921 | Bacteria | 5930 |
| 201 | Ga0207652_10019769 | 3300025921 | Bacteria | 5543 |
| 202 | Ga0207652_10028488 | 3300025921 | Unclassified | 4661 |
| 203 | Ga0207652_10100621 | 3300025921 | Bacteria | 2552 |
| 204 | Ga0207652_10109244 | 3300025921 | Bacteria | 2451 |
| 205 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 206 | Ga0207687_10000111 | 3300025927 | Bacteria | 58083 |
| 207 | Ga0207687_10011782 | 3300025927 | Bacteria | 5721 |
| 208 | Ga0207687_10034524 | 3300025927 | Bacteria | 3434 |
| 209 | Ga0207687_10162655 | 3300025927 | Unclassified | 1714 |
| 210 | Ga0207664_10000269 | 3300025929 | Bacteria | 39220 |
| 211 | Ga0207690_10012264 | 3300025932 | Bacteria | 5128 |
| 212 | Ga0207690_10180139 | 3300025932 | Bacteria | 1590 |
| 213 | Ga0207706_10000180 | 3300025933 | Bacteria | 70244 |
| 214 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 215 | Ga0207686_10070456 | 3300025934 | Unclassified | 2247 |
| 216 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 217 | Ga0207704_10000542 | 3300025938 | Bacteria | 16818 |
| 218 | Ga0207691_10123031 | 3300025940 | Unclassified | 2297 |
| 219 | Ga0207661_10003138 | 3300025944 | Bacteria | 11456 |
| 220 | Ga0207679_10000618 | 3300025945 | Bacteria | 23695 |
| 221 | Ga0207667_10000005 | 3300025949 | Bacteria | 715503 |
| 222 | Ga0207667_10000042 | 3300025949 | Bacteria | 263461 |
| 223 | Ga0207667_10000466 | 3300025949 | Bacteria | 54272 |
| 224 | Ga0207667_10002118 | 3300025949 | Bacteria | 24862 |
| 225 | Ga0207667_10006467 | 3300025949 | Bacteria | 14176 |
| 226 | Ga0207667_10336829 | 3300025949 | Unclassified | 1540 |
| 227 | Ga0207651_10004394 | 3300025960 | Bacteria | 7096 |
| 228 | Ga0207703_10363595 | 3300026035 | Bacteria | 1335 |
| 229 | Ga0207639_10009168 | 3300026041 | Bacteria | 6821 |
| 230 | Ga0207639_10226463 | 3300026041 | Bacteria | 1618 |
| 231 | Ga0207702_10000015 | 3300026078 | Bacteria | 250830 |
| 232 | Ga0207702_10000123 | 3300026078 | Bacteria | 91295 |
| 233 | Ga0207648_10667294 | 3300026089 | Unclassified | 962 |
| 234 | Ga0207674_10000001 | 3300026116 | Bacteria | 616581 |
| 235 | Ga0207674_10006929 | 3300026116 | Bacteria | 13279 |
| 236 | Ga0207674_10008732 | 3300026116 | Bacteria | 11666 |
| 237 | Ga0207674_10011447 | 3300026116 | Bacteria | 9968 |
| 238 | Ga0207683_10002890 | 3300026121 | Bacteria | 14973 |
| 239 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 240 | Ga0207698_10000060 | 3300026142 | Bacteria | 74527 |
| 241 | Ga0209813_10001089 | 3300027866 | Bacteria | 6080 |
| 242 | Ga0268266_10001150 | 3300028379 | Bacteria | 32834 |
| 243 | Ga0265337_1000001 | 3300028556 | Bacteria | 140973 |
| 244 | Ga0265337_1002922 | 3300028556 | Bacteria | 7591 |
| 245 | Ga0265337_1008593 | 3300028556 | Unclassified | 3697 |
| 246 | Ga0265337_1008686 | 3300028556 | Unclassified | 3671 |
| 247 | Ga0265326_10000303 | 3300028558 | Bacteria | 21740 |
| 248 | Ga0265326_10001540 | 3300028558 | Bacteria | 8064 |
| 249 | Ga0265326_10005963 | 3300028558 | Bacteria | 3817 |
| 250 | Ga0265319_1009082 | 3300028563 | Bacteria | 4278 |
| 251 | Ga0265334_10000032 | 3300028573 | Bacteria | 107258 |
| 252 | Ga0265334_10003511 | 3300028573 | Bacteria | 7110 |
| 253 | Ga0265334_10051931 | 3300028573 | Unclassified | 1570 |
| 254 | Ga0265318_10003578 | 3300028577 | Bacteria | 7775 |
| 255 | Ga0265323_10008746 | 3300028653 | Bacteria | 4163 |
| 256 | Ga0265322_10001961 | 3300028654 | Bacteria | 6509 |
| 257 | Ga0265322_10002090 | 3300028654 | Bacteria | 6261 |
| 258 | Ga0265322_10007645 | 3300028654 | Unclassified | 3152 |
| 259 | Ga0265322_10016904 | 3300028654 | Unclassified | 2104 |
| 260 | Ga0265336_10000047 | 3300028666 | Bacteria | 123576 |
| 261 | Ga0265336_10005162 | 3300028666 | Bacteria | 4854 |
| 262 | Ga0265336_10008235 | 3300028666 | Unclassified | 3667 |
| 263 | Ga0265336_10014769 | 3300028666 | Unclassified | 2580 |
| 264 | Ga0265338_10000039 | 3300028800 | Bacteria | 236135 |
| 265 | Ga0265338_10000052 | 3300028800 | Bacteria | 209239 |
| 266 | Ga0265338_10000054 | 3300028800 | Bacteria | 207383 |
| 267 | Ga0265338_10000066 | 3300028800 | Bacteria | 188576 |
| 268 | Ga0265338_10000192 | 3300028800 | Bacteria | 115195 |
| 269 | Ga0265338_10000482 | 3300028800 | Bacteria | 71209 |
| 270 | Ga0265338_10000601 | 3300028800 | Bacteria | 63282 |
| 271 | Ga0265338_10002389 | 3300028800 | Bacteria | 28280 |
| 272 | Ga0265338_10004564 | 3300028800 | Bacteria | 18632 |
| 273 | Ga0265338_10014055 | 3300028800 | Bacteria | 8961 |
| 274 | Ga0265338_10021024 | 3300028800 | Bacteria | 6827 |
| 275 | Ga0265338_10030929 | 3300028800 | Bacteria | 5259 |
| 276 | Ga0265338_10034220 | 3300028800 | Bacteria | 4914 |
| 277 | Ga0265338_10074389 | 3300028800 | Unclassified | 2890 |
| 278 | Ga0265338_10096715 | 3300028800 | Unclassified | 2421 |
| 279 | Ga0265338_10151049 | 3300028800 | Unclassified | 1804 |
| 280 | Ga0265338_10166205 | 3300028800 | Bacteria | 1698 |
| 281 | Ga0265338_10200326 | 3300028800 | Unclassified | 1506 |
| 282 | Ga0265324_10001142 | 3300029957 | Bacteria | 15880 |
| 283 | Ga0265324_10005260 | 3300029957 | Bacteria | 5627 |
| 284 | Ga0265324_10005515 | 3300029957 | Bacteria | 5453 |
| 285 | Ga0265324_10015372 | 3300029957 | Unclassified | 2816 |
| 286 | Ga0316179_1054898 | 3300030734 | Bacteria | 14330 |
| 287 | Ga0316178_1123410 | 3300030735 | Bacteria | 3264 |
| 288 | Ga0316180_1013958 | 3300030736 | Bacteria | 5476 |
| 289 | Ga0316183_1004392 | 3300030742 | Bacteria | 2352 |
| 290 | Ga0316183_1008217 | 3300030742 | Bacteria | 7119 |
| 291 | Ga0316183_1119442 | 3300030742 | Bacteria | 20659 |
| 292 | Ga0316182_1059726 | 3300030745 | Bacteria | 44312 |
| 293 | Ga0316182_1291669 | 3300030745 | Bacteria | 6871 |
| 294 | Ga0265330_10008381 | 3300031235 | Bacteria | 4978 |
| 295 | Ga0265332_10003382 | 3300031238 | Bacteria | 7722 |
| 296 | Ga0265332_10013736 | 3300031238 | Unclassified | 3585 |
| 297 | Ga0265320_10029785 | 3300031240 | Bacteria | 2821 |
| 298 | Ga0265325_10010757 | 3300031241 | Bacteria | 5281 |
| 299 | Ga0265329_10006680 | 3300031242 | Bacteria | 4553 |
| 300 | Ga0265340_10000077 | 3300031247 | Bacteria | 47065 |
| 301 | Ga0265339_10011805 | 3300031249 | Bacteria | 5359 |
| 302 | Ga0265339_10019005 | 3300031249 | Bacteria | 4040 |
| 303 | Ga0265331_10003494 | 3300031250 | Bacteria | 10117 |
| 304 | Ga0265327_10000961 | 3300031251 | Bacteria | 41308 |
| 305 | Ga0265327_10011793 | 3300031251 | Bacteria | 5977 |
| 306 | Ga0265327_10015727 | 3300031251 | Unclassified | 4861 |
| 307 | Ga0265327_10015766 | 3300031251 | Bacteria | 4851 |
| 308 | Ga0265316_10017384 | 3300031344 | Bacteria | 6219 |
| 309 | Ga0265316_10026178 | 3300031344 | Unclassified | 4858 |
| 310 | Ga0265316_10171721 | 3300031344 | Bacteria | 1617 |
| 311 | Ga0265313_10013480 | 3300031595 | Bacteria | 4904 |
| 312 | Ga0265314_10007161 | 3300031711 | Bacteria | 9714 |
| 313 | Ga0265342_10005380 | 3300031712 | Bacteria | 9777 |
| 314 | Ga0307516_10004034 | 3300031730 | Bacteria | 18404 |
| 315 | Ga0307406_10000001 | 3300031901 | Bacteria | 638191 |
| 316 | Ga0307406_10002163 | 3300031901 | Bacteria | 10702 |
| 317 | Ga0307412_10093623 | 3300031911 | Unclassified | 2108 |
| 318 | Ga0373959_0000004 | 3300034820 | Bacteria | 100872 |
| 319 | Ga0395899_0001600 | 3300037312 | Bacteria | 18991 |
| 320 | Ga0395899_0004607 | 3300037312 | Bacteria | 10743 |
| 321 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 322 | Ga0395900_0000232 | 3300037418 | Bacteria | 87268 |
| 323 | Ga0395900_0005799 | 3300037418 | Bacteria | 12900 |
| 324 | Ga0395900_0012514 | 3300037418 | Bacteria | 8678 |
| 325 | Ga0395900_0027630 | 3300037418 | Bacteria | 5812 |
| 326 | Ga0395900_0030765 | 3300037418 | Bacteria | 5512 |
| 327 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 328 | Ga0395898_0011520 | 3300037466 | Bacteria | 9182 |
| 329 | Ga0395898_0060054 | 3300037466 | Bacteria | 3696 |
| 330 | Ga0395905_0002005 | 3300037471 | Bacteria | 23268 |
| 331 | Ga0395905_0091313 | 3300037471 | Bacteria | 2855 |
| 332 | Ga0395901_0000060 | 3300038443 | Bacteria | 152235 |
| 333 | Ga0395901_0000680 | 3300038443 | Bacteria | 39129 |
| 334 | Ga0395901_0001919 | 3300038443 | Bacteria | 21405 |
| 335 | Ga0395901_0010023 | 3300038443 | Bacteria | 9606 |
| 336 | Ga0395901_0023582 | 3300038443 | Bacteria | 6309 |
| 337 | Ga0395901_0043909 | 3300038443 | Bacteria | 4636 |
| 338 | Ga0395901_0075550 | 3300038443 | Unclassified | 3514 |
| 339 | Ga0439438_003952 | 3300041405 | Bacteria | 5835 |
| 340 | Ga0439463_011278 | 3300042016 | Bacteria | 2195 |
| 341 | Ga0439446_0000001 | 3300042156 | Bacteria | 275840 |
| 342 | Ga0439446_0002781 | 3300042156 | Bacteria | 4247 |
| 343 | Ga0439434_0013385 | 3300042435 | Bacteria | 2435 |
| 344 | Ga0439464_0000006 | 3300042439 | Bacteria | 45358 |
| 345 | Ga0439464_0017591 | 3300042439 | Unclassified | 1940 |
| 346 | Ga0450918_003580 | 3300042531 | Unclassified | 2880 |
| 347 | Ga0466963_0094288 | 3300044694 | Bacteria | 2041 |
| 348 | Ga0451576_0016844 | 3300045051 | Bacteria | 8057 |
| 349 | Ga0495638_0000108 | 3300046460 | Bacteria | 132914 |
| 350 | Ga0495658_0191498 | 3300046683 | Unclassified | 1272 |
| 351 | Ga0495660_0000005 | 3300046810 | Bacteria | 574567 |
| 352 | Ga0495660_0017328 | 3300046810 | Bacteria | 4148 |
| 353 | Ga0496100_0052951 | 3300048903 | Bacteria | 2641 |
| 354 | Ga0496100_0094532 | 3300048903 | Bacteria | 2047 |
| 355 | Ga0501034_0000241 | 3300049571 | Bacteria | 101160 |
| 356 | Ga0501034_0001444 | 3300049571 | Bacteria | 31518 |
| 357 | Ga0501034_0003938 | 3300049571 | Bacteria | 16687 |
| 358 | Ga0501037_0000001 | 3300049573 | Bacteria | 753276 |
| 359 | Ga0501038_0017128 | 3300049574 | Bacteria | 6553 |
| 360 | Ga0501080_0000133 | 3300049742 | Bacteria | 52488 |
| 361 | Ga0501080_0134021 | 3300049742 | Unclassified | 2293 |
| 362 | nmdc:mga03683_1629_c3 | 3300050489 | Unclassified | 3479 |
| 363 | nmdc:mga00v17_14163_c1 | 3300050491 | Bacteria | 4445 |
| 364 | nmdc:mga00v17_17105_c1 | 3300050491 | Unclassified | 4096 |
| 365 | nmdc:mga00v17_245_c1 | 3300050491 | Bacteria | 31982 |
| 366 | nmdc:mga00v17_3978_c1 | 3300050491 | Bacteria | 7627 |
| 367 | nmdc:mga00v17_76_c2 | 3300050491 | Bacteria | 52505 |
| 368 | nmdc:mga0yw44_1088_c1 | 3300050492 | Bacteria | 10445 |
| 369 | nmdc:mga0yw44_16_c1 | 3300050492 | Bacteria | 80085 |
| 370 | nmdc:mga0yw44_1_c1 | 3300050492 | Bacteria | 702221 |
| 371 | nmdc:mga0yw44_397_c1 | 3300050492 | Bacteria | 10503 |
| 372 | nmdc:mga0yw44_4_c1 | 3300050492 | Bacteria | 450247 |
| 373 | nmdc:mga0yw44_77194_c1 | 3300050492 | Bacteria | 2080 |
| 374 | nmdc:mga0k408_1216_c1 | 3300050493 | Bacteria | 14098 |
| 375 | nmdc:mga0k408_1619_c1 | 3300050493 | Bacteria | 4503 |
| 376 | nmdc:mga06z11_1965_c1 | 3300050494 | Bacteria | 7765 |
| 377 | nmdc:mga04h51_4396_c1 | 3300050495 | Bacteria | 3504 |
| 378 | nmdc:mga04h51_57923_c1 | 3300050495 | Bacteria | 1319 |
| 379 | nmdc:mga07m45_200_c2 | 3300050496 | Bacteria | 15843 |
| 380 | nmdc:mga07m45_56658_c1 | 3300050496 | Bacteria | 2216 |
| 381 | nmdc:mga07m45_68198_c1 | 3300050496 | Bacteria | 2022 |
| 382 | nmdc:mga0sz30_2_c1 | 3300050516 | Bacteria | 626403 |
| 383 | Ga0500610_0131222 | 3300053079 | Unclassified | 1274 |
| 384 | Ga0500643_000043 | 3300053087 | Bacteria | 157905 |
| 385 | Ga0500643_003847 | 3300053087 | Bacteria | 6988 |
| 386 | Ga0500643_010563 | 3300053087 | Bacteria | 3424 |
| 387 | Ga0500644_0005422 | 3300053088 | Bacteria | 3220 |
| 388 | Ga0500646_0000011 | 3300053090 | Bacteria | 87823 |
| 389 | Ga0500646_0000290 | 3300053090 | Bacteria | 15407 |
| 390 | Ga0500583_0000203 | 3300053092 | Bacteria | 22745 |
| 391 | Ga0500583_0001027 | 3300053092 | Bacteria | 7965 |
| 392 | Ga0500583_0020156 | 3300053092 | Bacteria | 2748 |
| 393 | Ga0500651_0000001 | 3300053093 | Bacteria | 529808 |
| 394 | Ga0500651_0000027 | 3300053093 | Bacteria | 116666 |
| 395 | Ga0500651_0000045 | 3300053093 | Bacteria | 85481 |
| 396 | Ga0500651_0001186 | 3300053093 | Bacteria | 12921 |
| 397 | Ga0500641_0000001 | 3300053096 | Bacteria | 1115973 |
| 398 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 399 | Ga0500650_0038329 | 3300053098 | Bacteria | 2206 |
| 400 | Ga0500555_000006 | 3300053103 | Bacteria | 304416 |
| 401 | Ga0500556_0001227 | 3300053104 | Bacteria | 11950 |
| 402 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 403 | Ga0500593_011627 | 3300053117 | Bacteria | 3719 |
| 404 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 405 | Ga0500594_0000044 | 3300053118 | Bacteria | 39879 |
| 406 | Ga0500614_000180 | 3300053123 | Bacteria | 16268 |
| 407 | Ga0500642_0001619 | 3300053130 | Bacteria | 6494 |
| 408 | Ga0500652_000001 | 3300053131 | Bacteria | 946868 |
| 409 | Ga0500655_002302 | 3300053133 | Bacteria | 3510 |
| 410 | Ga0500577_0003193 | 3300053142 | Bacteria | 4241 |
| 411 | Ga0500579_005181 | 3300053143 | Bacteria | 7989 |
| 412 | Ga0500589_000007 | 3300053147 | Bacteria | 145453 |
| 413 | Ga0500620_007554 | 3300053155 | Bacteria | 2694 |
| 414 | Ga0500570_000005 | 3300053724 | Bacteria | 132994 |
| 415 | Ga0500570_007578 | 3300053724 | Bacteria | 5955 |
| 416 | Ga0500613_000070 | 3300053738 | Bacteria | 4421 |
| 417 | 2547698268 | 2547132181 | Bacteria | 4945084 |
| 418 | 2562465564 | 2561511199 | Bacteria | 5155034 |
| 419 | 2792314039 | 2791355010 | Bacteria | 4864581 |
| 420 | Ga0501070_0017794 | |||
| 421 | JGI24735J21928_10000035 | |||
| 422 | JGI24738J21930_10000894 | |||
| 423 | JGI24738J21930_10005990 | |||
| 424 | JGI24033J26618_1011828 | |||
| 425 | JGI25152J39213_1000810 | |||
| 426 | rootH2_10000244 | |||
| 427 | rootH2_10006847 | |||
| 428 | rootL2_10039152 | |||
| 429 | rootL2_10150960 | |||
| 430 | rootL2_10372472 | |||
| 431 | rootH1_10377350 | |||
| 432 | JGI25405J52794_10035945 | |||
| 433 | Ga0070658_10000038 | |||
| 434 | Ga0070658_10030766 | |||
| 435 | Ga0070676_10004047 | |||
| 436 | Ga0070683_100003442 | |||
| 437 | Ga0070666_10114612 | |||
| 438 | Ga0070680_100032589 | |||
| 439 | Ga0070682_100035372 | |||
| 440 | Ga0070682_100130865 | |||
| 441 | Ga0070660_100000078 | |||
| 442 | Ga0070660_100000224 | |||
| 443 | Ga0070660_100000454 | |||
| 444 | Ga0070660_100011712 | |||
| 445 | Ga0070660_100081577 | |||
| 446 | Ga0070691_10005326 | |||
| 447 | Ga0070661_100006618 | |||
| 448 | Ga0070661_100131605 | |||
| 449 | Ga0070674_100013892 | |||
| 450 | Ga0070673_100000478 | |||
| 451 | Ga0070688_100093828 | |||
| 452 | Ga0070659_100001084 | |||
| 453 | Ga0070659_100001424 | |||
| 454 | Ga0070659_100037495 | |||
| 455 | Ga0070678_100000939 | |||
| 456 | Ga0070662_100002601 | |||
| 457 | Ga0070681_10046564 | |||
| 458 | Ga0070681_10312084 | |||
| 459 | Ga0070681_10473974 | |||
| 460 | Ga0068867_100176116 | |||
| 461 | Ga0068867_100266613 | |||
| 462 | Ga0070685_10002053 | |||
| 463 | Ga0070685_10032393 | |||
| 464 | Ga0070679_100000730 | |||
| 465 | Ga0070679_100018926 | |||
| 466 | Ga0070679_100020085 | |||
| 467 | Ga0070679_100053925 | |||
| 468 | Ga0070679_100062827 | |||
| 469 | Ga0070684_100061525 | |||
| 470 | Ga0070684_100130815 | |||
| 471 | Ga0068853_100036277 | |||
| 472 | Ga0070672_100104928 | |||
| 473 | Ga0070686_100457687 | |||
| 474 | Ga0068855_100000011 | |||
| 475 | Ga0068855_100000211 | |||
| 476 | Ga0068855_100022054 | |||
| 477 | Ga0068855_100095667 | |||
| 478 | Ga0070664_100000215 | |||
| 479 | Ga0068857_100000002 | |||
| 480 | Ga0068857_100000899 | |||
| 481 | Ga0068857_100004295 | |||
| 482 | Ga0068857_100011110 | |||
| 483 | Ga0068856_100000016 | |||
| 484 | Ga0068856_100000059 | |||
| 485 | Ga0068852_100000001 | |||
| 486 | Ga0068852_100000030 | |||
| 487 | Ga0068852_100131238 | |||
| 488 | Ga0081455_10000001 | |||
| 489 | Ga0081455_10000003 | |||
| 490 | Ga0075365_10000001 | |||
| 491 | Ga0075365_10000014 | |||
| 492 | Ga0075365_10002182 | |||
| 493 | Ga0075365_10002844 | |||
| 494 | Ga0075365_10016993 | |||
| 495 | Ga0075365_10024832 | |||
| 496 | Ga0075365_10337367 | |||
| 497 | Ga0075368_10000476 | |||
| 498 | Ga0075364_10004369 | |||
| 499 | Ga0075364_10009942 | |||
| 500 | Ga0075364_10014021 | |||
| 501 | Ga0075364_10028428 | |||
| 502 | Ga0075362_10013861 | |||
| 503 | Ga0075367_10000484 | |||
| 504 | Ga0075369_10000006 | |||
| 505 | Ga0075369_10001586 | |||
| 506 | Ga0075366_10001205 | |||
| 507 | Ga0097621_100003413 | |||
| 508 | Ga0097621_100302345 | |||
| 509 | Ga0075370_10009462 | |||
| 510 | Ga0068871_100000156 | |||
| 511 | Ga0068871_100028100 | |||
| 512 | Ga0105240_10000003 | |||
| 513 | Ga0105240_10000004 | |||
| 514 | Ga0105240_10000501 | |||
| 515 | Ga0105240_10013363 | |||
| 516 | Ga0105240_10095244 | |||
| 517 | Ga0105240_10108967 | |||
| 518 | Ga0105240_10143376 | |||
| 519 | Ga0105240_10650855 | |||
| 520 | Ga0105245_10000002 | |||
| 521 | Ga0105245_10000122 | |||
| 522 | Ga0105245_10034602 | |||
| 523 | Ga0105245_10069362 | |||
| 524 | Ga0105245_10108573 | |||
| 525 | Ga0105245_10123222 | |||
| 526 | Ga0105243_10000001 | |||
| 527 | Ga0105241_10005985 | |||
| 528 | Ga0105241_10007986 | |||
| 529 | Ga0105241_10170175 | |||
| 530 | Ga0105242_10000064 | |||
| 531 | Ga0105242_10116614 | |||
| 532 | Ga0105248_10387108 | |||
| 533 | Ga0105237_10000001 | |||
| 534 | Ga0105237_10009676 | |||
| 535 | Ga0105238_10109234 | |||
| 536 | Ga0105238_10132129 | |||
| 537 | Ga0105238_10205850 | |||
| 538 | Ga0105238_10239851 | |||
| 539 | Ga0105032_100001 | |||
| 540 | Ga0105032_100054 | |||
| 541 | Ga0105032_101404 | |||
| 542 | Ga0105029_100020 | |||
| 543 | Ga0105033_101693 | |||
| 544 | Ga0105028_100230 | |||
| 545 | Ga0105239_10000411 | |||
| 546 | Ga0105239_10004097 | |||
| 547 | Ga0105239_10027653 | |||
| 548 | Ga0105239_10104675 | |||
| 549 | Ga0105239_10157600 | |||
| 550 | Ga0105246_10000299 | |||
| 551 | Ga0105246_10000411 | |||
| 552 | Ga0105246_10001269 | |||
| 553 | Ga0157373_10000708 | |||
| 554 | Ga0157373_10017493 | |||
| 555 | Ga0157371_10261634 | |||
| 556 | Ga0157370_10000115 | |||
| 557 | Ga0157370_10000538 | |||
| 558 | Ga0157370_10033055 | |||
| 559 | Ga0157370_10254686 | |||
| 560 | Ga0157370_10297054 | |||
| 561 | Ga0157369_10000029 | |||
| 562 | Ga0157369_10000413 | |||
| 563 | Ga0157369_10000657 | |||
| 564 | Ga0157369_10001676 | |||
| 565 | Ga0157369_10041458 | |||
| 566 | Ga0157374_10000031 | |||
| 567 | Ga0157374_10000934 | |||
| 568 | Ga0157374_10003500 | |||
| 569 | Ga0157374_10548752 | |||
| 570 | Ga0157378_10003107 | |||
| 571 | Ga0157378_10013335 | |||
| 572 | Ga0157372_10000002 | |||
| 573 | Ga0157372_10000086 | |||
| 574 | Ga0157372_10138568 | |||
| 575 | Ga0163163_10003002 | |||
| 576 | Ga0163163_10271521 | |||
| 577 | Ga0157377_10000130 | |||
| 578 | Ga0157377_10038737 | |||
| 579 | Ga0157376_10000001 | |||
| 580 | Ga0157376_10000027 | |||
| 581 | Ga0157376_10016720 | |||
| 582 | Ga0207680_10036004 | |||
| 583 | Ga0207647_10000458 | |||
| 584 | Ga0207647_10001382 | |||
| 585 | Ga0207645_10007453 | |||
| 586 | Ga0207705_10000051 | |||
| 587 | Ga0207705_10000056 | |||
| 588 | Ga0207705_10003555 | |||
| 589 | Ga0207705_10004982 | |||
| 590 | Ga0207705_10017090 | |||
| 591 | Ga0207705_10017240 | |||
| 592 | Ga0207705_10018486 | |||
| 593 | Ga0207705_10024521 | |||
| 594 | Ga0207654_10007261 | |||
| 595 | Ga0207654_10097809 | |||
| 596 | Ga0207707_10009504 | |||
| 597 | Ga0207707_10043952 | |||
| 598 | Ga0207707_10068269 | |||
| 599 | Ga0207695_10000005 | |||
| 600 | Ga0207695_10000009 | |||
| 601 | Ga0207695_10001249 | |||
| 602 | Ga0207695_10043167 | |||
| 603 | Ga0207695_10084073 | |||
| 604 | Ga0207695_10165066 | |||
| 605 | Ga0207695_10263780 | |||
| 606 | Ga0207671_10000003 | |||
| 607 | Ga0207671_10000008 | |||
| 608 | Ga0207671_10004219 | |||
| 609 | Ga0207660_10001756 | |||
| 610 | Ga0207660_10011757 | |||
| 611 | Ga0207660_10013472 | |||
| 612 | Ga0207657_10000741 | |||
| 613 | Ga0207657_10001246 | |||
| 614 | Ga0207657_10003208 | |||
| 615 | Ga0207657_10004983 | |||
| 616 | Ga0207657_10005105 | |||
| 617 | Ga0207652_10004857 | |||
| 618 | Ga0207652_10005031 | |||
| 619 | Ga0207652_10017113 | |||
| 620 | Ga0207652_10019769 | |||
| 621 | Ga0207652_10028488 | |||
| 622 | Ga0207652_10100621 | |||
| 623 | Ga0207652_10109244 | |||
| 624 | Ga0207687_10000001 | |||
| 625 | Ga0207687_10000111 | |||
| 626 | Ga0207687_10011782 | |||
| 627 | Ga0207687_10034524 | |||
| 628 | Ga0207687_10162655 | |||
| 629 | Ga0207664_10000269 | |||
| 630 | Ga0207690_10012264 | |||
| 631 | Ga0207690_10180139 | |||
| 632 | Ga0207706_10000180 | |||
| 633 | Ga0207686_10000001 | |||
| 634 | Ga0207686_10070456 | |||
| 635 | Ga0207709_10000002 | |||
| 636 | Ga0207704_10000542 | |||
| 637 | Ga0207691_10123031 | |||
| 638 | Ga0207661_10003138 | |||
| 639 | Ga0207679_10000618 | |||
| 640 | Ga0207667_10000005 | |||
| 641 | Ga0207667_10000042 | |||
| 642 | Ga0207667_10000466 | |||
| 643 | Ga0207667_10002118 | |||
| 644 | Ga0207667_10006467 | |||
| 645 | Ga0207667_10336829 | |||
| 646 | Ga0207651_10004394 | |||
| 647 | Ga0207703_10363595 | |||
| 648 | Ga0207639_10009168 | |||
| 649 | Ga0207639_10226463 | |||
| 650 | Ga0207702_10000015 | |||
| 651 | Ga0207702_10000123 | |||
| 652 | Ga0207648_10667294 | |||
| 653 | Ga0207674_10000001 | |||
| 654 | Ga0207674_10006929 | |||
| 655 | Ga0207674_10008732 | |||
| 656 | Ga0207674_10011447 | |||
| 657 | Ga0207683_10002890 | |||
| 658 | Ga0207698_10000001 | |||
| 659 | Ga0207698_10000060 | |||
| 660 | Ga0209813_10001089 | |||
| 661 | Ga0268266_10001150 | |||
| 662 | Ga0265337_1000001 | |||
| 663 | Ga0265337_1002922 | |||
| 664 | Ga0265337_1008593 | |||
| 665 | Ga0265337_1008686 | |||
| 666 | Ga0265326_10000303 | |||
| 667 | Ga0265326_10001540 | |||
| 668 | Ga0265326_10005963 | |||
| 669 | Ga0265319_1009082 | |||
| 670 | Ga0265334_10000032 | |||
| 671 | Ga0265334_10003511 | |||
| 672 | Ga0265334_10051931 | |||
| 673 | Ga0265318_10003578 | |||
| 674 | Ga0265323_10008746 | |||
| 675 | Ga0265322_10001961 | |||
| 676 | Ga0265322_10002090 | |||
| 677 | Ga0265322_10007645 | |||
| 678 | Ga0265322_10016904 | |||
| 679 | Ga0265336_10000047 | |||
| 680 | Ga0265336_10005162 | |||
| 681 | Ga0265336_10008235 | |||
| 682 | Ga0265336_10014769 | |||
| 683 | Ga0265338_10000039 | |||
| 684 | Ga0265338_10000052 | |||
| 685 | Ga0265338_10000054 | |||
| 686 | Ga0265338_10000066 | |||
| 687 | Ga0265338_10000192 | |||
| 688 | Ga0265338_10000482 | |||
| 689 | Ga0265338_10000601 | |||
| 690 | Ga0265338_10002389 | |||
| 691 | Ga0265338_10004564 | |||
| 692 | Ga0265338_10014055 | |||
| 693 | Ga0265338_10021024 | |||
| 694 | Ga0265338_10030929 | |||
| 695 | Ga0265338_10034220 | |||
| 696 | Ga0265338_10074389 | |||
| 697 | Ga0265338_10096715 | |||
| 698 | Ga0265338_10151049 | |||
| 699 | Ga0265338_10166205 | |||
| 700 | Ga0265338_10200326 | |||
| 701 | Ga0265324_10001142 | |||
| 702 | Ga0265324_10005260 | |||
| 703 | Ga0265324_10005515 | |||
| 704 | Ga0265324_10015372 | |||
| 705 | Ga0316179_1054898 | |||
| 706 | Ga0316178_1123410 | |||
| 707 | Ga0316180_1013958 | |||
| 708 | Ga0316183_1004392 | |||
| 709 | Ga0316183_1008217 | |||
| 710 | Ga0316183_1119442 | |||
| 711 | Ga0316182_1059726 | |||
| 712 | Ga0316182_1291669 | |||
| 713 | Ga0265330_10008381 | |||
| 714 | Ga0265332_10003382 | |||
| 715 | Ga0265332_10013736 | |||
| 716 | Ga0265320_10029785 | |||
| 717 | Ga0265325_10010757 | |||
| 718 | Ga0265329_10006680 | |||
| 719 | Ga0265340_10000077 | |||
| 720 | Ga0265339_10011805 | |||
| 721 | Ga0265339_10019005 | |||
| 722 | Ga0265331_10003494 | |||
| 723 | Ga0265327_10000961 | |||
| 724 | Ga0265327_10011793 | |||
| 725 | Ga0265327_10015727 | |||
| 726 | Ga0265327_10015766 | |||
| 727 | Ga0265316_10017384 | |||
| 728 | Ga0265316_10026178 | |||
| 729 | Ga0265316_10171721 | |||
| 730 | Ga0265313_10013480 | |||
| 731 | Ga0265314_10007161 | |||
| 732 | Ga0265342_10005380 | |||
| 733 | Ga0307516_10004034 | |||
| 734 | Ga0307406_10000001 | |||
| 735 | Ga0307406_10002163 | |||
| 736 | Ga0307412_10093623 | |||
| 737 | Ga0373959_0000004 | |||
| 738 | Ga0395899_0001600 | |||
| 739 | Ga0395899_0004607 | |||
| 740 | Ga0395900_0000001 | |||
| 741 | Ga0395900_0000232 | |||
| 742 | Ga0395900_0005799 | |||
| 743 | Ga0395900_0012514 | |||
| 744 | Ga0395900_0027630 | |||
| 745 | Ga0395900_0030765 | |||
| 746 | Ga0395898_0000002 | |||
| 747 | Ga0395898_0011520 | |||
| 748 | Ga0395898_0060054 | |||
| 749 | Ga0395905_0002005 | |||
| 750 | Ga0395905_0091313 | |||
| 751 | Ga0395901_0000060 | |||
| 752 | Ga0395901_0000680 | |||
| 753 | Ga0395901_0001919 | |||
| 754 | Ga0395901_0010023 | |||
| 755 | Ga0395901_0023582 | |||
| 756 | Ga0395901_0043909 | |||
| 757 | Ga0395901_0075550 | |||
| 758 | Ga0439438_003952 | |||
| 759 | Ga0439463_011278 | |||
| 760 | Ga0439446_0000001 | |||
| 761 | Ga0439446_0002781 | |||
| 762 | Ga0439434_0013385 | |||
| 763 | Ga0439464_0000006 | |||
| 764 | Ga0439464_0017591 | |||
| 765 | Ga0450918_003580 | |||
| 766 | Ga0466963_0094288 | |||
| 767 | Ga0451576_0016844 | |||
| 768 | Ga0495638_0000108 | |||
| 769 | Ga0495658_0191498 | |||
| 770 | Ga0495660_0000005 | |||
| 771 | Ga0495660_0017328 | |||
| 772 | Ga0496100_0052951 | |||
| 773 | Ga0496100_0094532 | |||
| 774 | Ga0501034_0000241 | |||
| 775 | Ga0501034_0001444 | |||
| 776 | Ga0501034_0003938 | |||
| 777 | Ga0501037_0000001 | |||
| 778 | Ga0501038_0017128 | |||
| 779 | Ga0501080_0000133 | |||
| 780 | Ga0501080_0134021 | |||
| 781 | nmdc:mga03683_1629_c3 | |||
| 782 | nmdc:mga00v17_14163_c1 | |||
| 783 | nmdc:mga00v17_17105_c1 | |||
| 784 | nmdc:mga00v17_245_c1 | |||
| 785 | nmdc:mga00v17_3978_c1 | |||
| 786 | nmdc:mga00v17_76_c2 | |||
| 787 | nmdc:mga0yw44_1088_c1 | |||
| 788 | nmdc:mga0yw44_16_c1 | |||
| 789 | nmdc:mga0yw44_1_c1 | |||
| 790 | nmdc:mga0yw44_397_c1 | |||
| 791 | nmdc:mga0yw44_4_c1 | |||
| 792 | nmdc:mga0yw44_77194_c1 | |||
| 793 | nmdc:mga0k408_1216_c1 | |||
| 794 | nmdc:mga0k408_1619_c1 | |||
| 795 | nmdc:mga06z11_1965_c1 | |||
| 796 | nmdc:mga04h51_4396_c1 | |||
| 797 | nmdc:mga04h51_57923_c1 | |||
| 798 | nmdc:mga07m45_200_c2 | |||
| 799 | nmdc:mga07m45_56658_c1 | |||
| 800 | nmdc:mga07m45_68198_c1 | |||
| 801 | nmdc:mga0sz30_2_c1 | |||
| 802 | Ga0500610_0131222 | |||
| 803 | Ga0500643_000043 | |||
| 804 | Ga0500643_003847 | |||
| 805 | Ga0500643_010563 | |||
| 806 | Ga0500644_0005422 | |||
| 807 | Ga0500646_0000011 | |||
| 808 | Ga0500646_0000290 | |||
| 809 | Ga0500583_0000203 | |||
| 810 | Ga0500583_0001027 | |||
| 811 | Ga0500583_0020156 | |||
| 812 | Ga0500651_0000001 | |||
| 813 | Ga0500651_0000027 | |||
| 814 | Ga0500651_0000045 | |||
| 815 | Ga0500651_0001186 | |||
| 816 | Ga0500641_0000001 | |||
| 817 | Ga0500650_0000001 | |||
| 818 | Ga0500650_0038329 | |||
| 819 | Ga0500555_000006 | |||
| 820 | Ga0500556_0001227 | |||
| 821 | Ga0500562_000001 | |||
| 822 | Ga0500593_011627 | |||
| 823 | Ga0500594_0000001 | |||
| 824 | Ga0500594_0000044 | |||
| 825 | Ga0500614_000180 | |||
| 826 | Ga0500642_0001619 | |||
| 827 | Ga0500652_000001 | |||
| 828 | Ga0500655_002302 | |||
| 829 | Ga0500577_0003193 | |||
| 830 | Ga0500579_005181 | |||
| 831 | Ga0500589_000007 | |||
| 832 | Ga0500620_007554 | |||
| 833 | Ga0500570_000005 | |||
| 834 | Ga0500570_007578 | |||
| 835 | Ga0500613_000070 | |||
| 836 | 2547698268 | |||
| 837 | 2562465564 | |||
| 838 | 2792314039 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8q5a-assembly1.cif.gz_A | crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) | 0.9478 | 17 | 301 |
| 1gvf-assembly1.cif.gz_A-2 | structure of tagatose-1,6-bisphosphate aldolase | 0.9473 | 17 | 302 |
| 1gvf-assembly1.cif.gz_B-2 | structure of tagatose-1,6-bisphosphate aldolase | 0.9391 | 17 | 300 |
| 8q58-assembly1.cif.gz_A | crystal structure of metal-dependent classii sulfofructosephosphate aldolase (sfpa) from hafnia paralvei hpsqia-zn | 0.9369 | 17 | 301 |
| 8q59-assembly1.cif.gz_A-2 | crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) | 0.9366 | 17 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gvfB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9391 | 17 | 300 | 3.20.20.70 |
| 3q94B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9304 | 19 | 301 | 3.20.20.70 |
| 6ofuA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9135 | 15 | 302 | 3.20.20.70 |
| 1gvfB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9125 | 17 | 300 | 3.20.20.70 |
| 3q94B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9072 | 19 | 301 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G6C6T3-F1-model_v4 | Ketose-bisphosphate aldolase | 0.9979 | 35 | 303 |
GO:0005975
GO:0008270 GO:0016832 |
| AF-A0A258BPP3-F1-model_v4 | Ketose-bisphosphate aldolase | 0.9943 | 179 | 303 |
GO:0005975
GO:0008270 GO:0016832 |
| AF-A0A1F7R0G4-F1-model_v4 | Ketose-bisphosphate aldolase | 0.9924 | 3 | 303 |
GO:0005975
GO:0008270 GO:0016832 |
| AF-A0A2G6C6T3-F1-model_v4 | Ketose-bisphosphate aldolase | 0.9905 | 35 | 303 |
GO:0005975
GO:0008270 GO:0016832 |
| AF-A0A563ADC7-F1-model_v4 | Class II fructose-bisphosphate aldolase | 0.9869 | 111 | 303 |
GO:0005975
GO:0008270 GO:0016832 |