F439625

General Info

Members Datasets Scaffolds Average Seq Length
419 249 406 192

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0097956|Ga0501035_0097956_1121_1822
Length 233
Sequence MAPWTLNQVQGGRQEERRRSPGDIGISVPLDPAALARHMGAMLIETEPTPNPATLKFLPGRTVMAAGTRDFSSPEEAEASPLAIALFNLGDVTGVFFGRDFISVTAAPGVDWAVLKPDVLTLLLDHFSANMPLFMPGSASGIAVPAEDEPAFADDPADEDIIVQIKDLIETRIRPAVANDGGDIIYRGFDHGKVYLKMQGACSGCPSSTATLKNGIEQLLKYYVPEVTEVRAI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
12 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
13 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
90 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
224 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
225 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
226 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
227 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
228 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
242 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
243 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
244 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.11
Nodule 0
Rhizoplane 6.68
Rhizosphere 60.38
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1298373 2162886007 Bacteria 2548
2 JGI24736J21556_1000425 3300001904 Bacteria 7917
3 JGI24737J22298_10002088 3300001990 Bacteria 7138
4 JGI24735J21928_10009445 3300002067 Bacteria 3131
5 JGI24735J21928_10012493 3300002067 Bacteria 2684
6 JGI24748J21848_1005421 3300002074 Bacteria 1481
7 JGI24738J21930_10002048 3300002075 Bacteria 5405
8 JGI24034J26672_10008304 3300002239 Bacteria 1516
9 JGI24751J29686_10000118 3300002459 Bacteria 41570
10 JGI25165J46597_1000208 3300003214 Bacteria 84386
11 Ga0055529_1003973 3300003763 Bacteria 2323
12 Ga0055531_10003343 3300003794 Bacteria 10266
13 Ga0055531_10053397 3300003794 Bacteria 1044
14 Ga0065704_10000954 3300005289 Bacteria 13239
15 Ga0065704_10079357 3300005289 Bacteria 4186
16 Ga0065712_10276735 3300005290 Bacteria 892
17 Ga0070658_10002923 3300005327 Bacteria 14159
18 Ga0070658_10017856 3300005327 Bacteria 5673
19 Ga0070658_10049304 3300005327 Bacteria 3411
20 Ga0070666_10393582 3300005335 Bacteria 995
21 Ga0068868_100181563 3300005338 Bacteria 1746
22 Ga0070689_100064045 3300005340 Bacteria 2861
23 Ga0070668_100009926 3300005347 Bacteria 7052
24 Ga0070668_100103895 3300005347 Bacteria 2254
25 Ga0070668_100564807 3300005347 Bacteria 992
26 Ga0070669_100000620 3300005353 Bacteria 26234
27 Ga0070669_100001027 3300005353 Bacteria 20334
28 Ga0070669_100023467 3300005353 Bacteria 4417
29 Ga0070669_100096589 3300005353 Bacteria 2223
30 Ga0070671_100002850 3300005355 Bacteria 13435
31 Ga0070671_100090809 3300005355 Bacteria 2557
32 Ga0070674_100694572 3300005356 Bacteria 869
33 Ga0070667_100042137 3300005367 Bacteria 3830
34 Ga0068867_100119579 3300005459 Bacteria 2034
35 Ga0070685_10008587 3300005466 Bacteria 5257
36 Ga0070679_100262816 3300005530 Bacteria 1681
37 Ga0068853_100002615 3300005539 Bacteria 13544
38 Ga0068853_100014640 3300005539 Bacteria 6432
39 Ga0070672_100083198 3300005543 Bacteria 2568
40 Ga0070686_100012071 3300005544 Bacteria 4914
41 Ga0070665_100105570 3300005548 Bacteria 2819
42 Ga0070665_100163657 3300005548 Bacteria 2227
43 Ga0070665_100436350 3300005548 Bacteria 1319
44 Ga0070665_100439245 3300005548 Bacteria 1314
45 Ga0068855_100020437 3300005563 Bacteria 7940
46 Ga0068855_100083512 3300005563 Bacteria 3700
47 Ga0068855_100694858 3300005563 Bacteria 1089
48 Ga0068857_100040987 3300005577 Bacteria 4105
49 Ga0068854_100002421 3300005578 Bacteria 11519
50 Ga0068854_100010433 3300005578 Bacteria 6025
51 Ga0068854_100011559 3300005578 Bacteria 5755
52 Ga0068854_100125372 3300005578 Bacteria 1955
53 Ga0068852_100000824 3300005616 Bacteria 20475
54 Ga0068852_100013242 3300005616 Bacteria 6306
55 Ga0068852_100039629 3300005616 Bacteria 3968
56 Ga0068852_100079378 3300005616 Bacteria 2907
57 Ga0068852_100138051 3300005616 Bacteria 2253
58 Ga0068852_100490548 3300005616 Bacteria 1222
59 Ga0068859_100031721 3300005617 Bacteria 5307
60 Ga0068864_100219545 3300005618 Bacteria 1754
61 Ga0068851_10263961 3300005834 Bacteria 980
62 Ga0068863_100192645 3300005841 Bacteria 1959
63 Ga0068858_100002472 3300005842 Bacteria 18656
64 Ga0068858_100006609 3300005842 Bacteria 11283
65 Ga0068858_100038872 3300005842 Bacteria 4414
66 Ga0068858_100046469 3300005842 Bacteria 4024
67 Ga0068860_100382512 3300005843 Bacteria 1389
68 Ga0068862_100332190 3300005844 Bacteria 1406
69 Ga0081538_10011359 3300005981 Bacteria 7220
70 Ga0075365_10196726 3300006038 Bacteria 1412
71 Ga0075368_10000902 3300006042 Bacteria 9208
72 Ga0075368_10003977 3300006042 Bacteria 4977
73 Ga0075363_100009080 3300006048 Bacteria 4666
74 Ga0075363_100013123 3300006048 Bacteria 4007
75 Ga0075363_100089757 3300006048 Bacteria 1690
76 Ga0075364_10017687 3300006051 Bacteria 4457
77 Ga0075364_10035375 3300006051 Bacteria 3227
78 Ga0075364_10274414 3300006051 Bacteria 1147
79 Ga0075362_10019814 3300006177 Bacteria 2803
80 Ga0075362_10042886 3300006177 Bacteria 2001
81 Ga0075367_10002698 3300006178 Bacteria 8185
82 Ga0075367_10006559 3300006178 Bacteria 5891
83 Ga0075367_10109184 3300006178 Bacteria 1697
84 Ga0075369_10060083 3300006186 Bacteria 1657
85 Ga0075366_10012444 3300006195 Bacteria 4826
86 Ga0075366_10032442 3300006195 Bacteria 3074
87 Ga0097621_100017464 3300006237 Bacteria 5448
88 Ga0075370_10081095 3300006353 Bacteria 1865
89 Ga0068871_100010432 3300006358 Bacteria 6780
90 Ga0068871_100374203 3300006358 Bacteria 1264
91 Ga0075430_100497017 3300006846 Bacteria 1007
92 Ga0075431_100266347 3300006847 Bacteria 1738
93 Ga0075431_100276265 3300006847 Bacteria 1701
94 Ga0075429_100739655 3300006880 Bacteria 862
95 Ga0097620_100031721 3300006931 Bacteria 5307
96 Ga0105250_10007046 3300009092 Bacteria 4855
97 Ga0105240_10004776 3300009093 Bacteria 20437
98 Ga0105240_10043035 3300009093 Bacteria 5750
99 Ga0105240_10419402 3300009093 Bacteria 1504
100 Ga0105240_10850582 3300009093 Bacteria 985
101 Ga0105240_11437048 3300009093 Bacteria 724
102 Ga0111539_10038634 3300009094 Bacteria 5759
103 Ga0105245_10100168 3300009098 Bacteria 2680
104 Ga0105247_10311725 3300009101 Bacteria 1095
105 Ga0114129_10548535 3300009147 Bacteria 1504
106 Ga0114129_11099757 3300009147 Bacteria 995
107 Ga0105243_10014502 3300009148 Bacteria 5963
108 Ga0105242_10115876 3300009176 Bacteria 2291
109 Ga0105248_10024882 3300009177 Bacteria 6654
110 Ga0105248_10234175 3300009177 Bacteria 2067
111 Ga0105248_10334980 3300009177 Bacteria 1704
112 Ga0105238_10017709 3300009551 Bacteria 7243
113 Ga0105238_10027982 3300009551 Bacteria 5744
114 Ga0105238_10626701 3300009551 Bacteria 1084
115 Ga0105249_10076425 3300009553 Bacteria 3104
116 Ga0105249_11091376 3300009553 Bacteria 868
117 Ga0105239_10042265 3300010375 Bacteria 4995
118 Ga0157370_10000080 3300013104 Bacteria 105872
119 Ga0157374_10059840 3300013296 Bacteria 3563
120 Ga0157378_10236784 3300013297 Bacteria 1742
121 Ga0163162_10006378 3300013306 Bacteria 11420
122 Ga0163162_10036423 3300013306 Bacteria 4904
123 Ga0163162_10757767 3300013306 Bacteria 1090
124 Ga0163162_10951015 3300013306 Bacteria 970
125 Ga0157372_10304537 3300013307 Bacteria 1854
126 Ga0157375_10335558 3300013308 Bacteria 1677
127 Ga0157380_10194303 3300014326 Bacteria 1794
128 Ga0157379_10178058 3300014968 Bacteria 1921
129 Ga0183363_1001 3300015690 Bacteria 611534
130 Ga0183361_10207 3300016635 Bacteria 2181
131 Ga0163161_10003204 3300017792 Bacteria 11504
132 Ga0163161_10207685 3300017792 Bacteria 1512
133 Ga0209148_1001541 3300025254 Bacteria 11199
134 Ga0209233_1000186 3300025261 Bacteria 133572
135 Ga0209455_1000971 3300025272 Bacteria 14523
136 Ga0209676_1054317 3300025292 Bacteria 1032
137 Ga0209257_1000877 3300025304 Bacteria 42562
138 Ga0209257_1002782 3300025304 Bacteria 16521
139 Ga0209257_1082318 3300025304 Bacteria 823
140 Ga0207713_1025621 3300025735 Bacteria 2719
141 Ga0207680_10193091 3300025903 Bacteria 1383
142 Ga0207647_10013128 3300025904 Bacteria 5756
143 Ga0207647_10211811 3300025904 Bacteria 1119
144 Ga0207647_10363465 3300025904 Bacteria 819
145 Ga0207705_10000458 3300025909 Bacteria 34979
146 Ga0207705_10003669 3300025909 Bacteria 11682
147 Ga0207705_10059436 3300025909 Bacteria 2759
148 Ga0207695_10019296 3300025913 Bacteria 7852
149 Ga0207695_10116140 3300025913 Bacteria 2650
150 Ga0207695_11057766 3300025913 Bacteria 691
151 Ga0207652_10207033 3300025921 Bacteria 1766
152 Ga0207681_10000147 3300025923 Bacteria 58825
153 Ga0207681_10000558 3300025923 Bacteria 25541
154 Ga0207681_10111426 3300025923 Bacteria 1991
155 Ga0207694_10036377 3300025924 Bacteria 3779
156 Ga0207687_10058637 3300025927 Bacteria 2709
157 Ga0207644_10000005 3300025931 Bacteria 441948
158 Ga0207644_10008635 3300025931 Bacteria 6665
159 Ga0207644_10077676 3300025931 Bacteria 2445
160 Ga0207686_10115828 3300025934 Bacteria 1815
161 Ga0207669_10596412 3300025937 Bacteria 897
162 Ga0207711_10168171 3300025941 Bacteria 1988
163 Ga0207711_10333838 3300025941 Bacteria 1402
164 Ga0207711_10373762 3300025941 Bacteria 1322
165 Ga0207667_10002049 3300025949 Bacteria 25269
166 Ga0207667_10065138 3300025949 Bacteria 3802
167 Ga0207667_10122304 3300025949 Bacteria 2682
168 Ga0207667_10211107 3300025949 Bacteria 1990
169 Ga0207651_10467458 3300025960 Bacteria 1085
170 Ga0207668_10046135 3300025972 Bacteria 2976
171 Ga0207668_10061979 3300025972 Bacteria 2632
172 Ga0207640_10000118 3300025981 Bacteria 59872
173 Ga0207640_10010580 3300025981 Bacteria 5204
174 Ga0207640_10016090 3300025981 Bacteria 4343
175 Ga0207640_10168087 3300025981 Bacteria 1631
176 Ga0207640_10210945 3300025981 Bacteria 1479
177 Ga0207640_10428388 3300025981 Bacteria 1085
178 Ga0207658_10005375 3300025986 Bacteria 8795
179 Ga0207658_10894664 3300025986 Bacteria 808
180 Ga0207677_10043555 3300026023 Bacteria 2985
181 Ga0207703_10002142 3300026035 Bacteria 17354
182 Ga0207703_10005884 3300026035 Bacteria 9827
183 Ga0207703_10027276 3300026035 Bacteria 4498
184 Ga0207703_10072821 3300026035 Bacteria 2841
185 Ga0207639_10003373 3300026041 Bacteria 10743
186 Ga0207639_10214084 3300026041 Bacteria 1660
187 Ga0207702_10014676 3300026078 Bacteria 6501
188 Ga0207641_10259676 3300026088 Bacteria 1626
189 Ga0207648_10225681 3300026089 Bacteria 1666
190 Ga0207676_10167212 3300026095 Bacteria 1912
191 Ga0207676_11084821 3300026095 Bacteria 791
192 Ga0207674_10034442 3300026116 Bacteria 5293
193 Ga0207674_10089235 3300026116 Bacteria 3075
194 Ga0207674_10274229 3300026116 Bacteria 1634
195 Ga0207674_10387550 3300026116 Bacteria 1351
196 Ga0207683_10827668 3300026121 Bacteria 859
197 Ga0207698_10000005 3300026142 Bacteria 295687
198 Ga0207698_10201690 3300026142 Bacteria 1782
199 Ga0207698_10321627 3300026142 Bacteria 1449
200 Ga0207698_10728218 3300026142 Bacteria 989
201 Ga0209813_10000044 3300027866 Bacteria 50649
202 Ga0209813_10000174 3300027866 Bacteria 20909
203 Ga0268265_10074438 3300028380 Bacteria 2656
204 Ga0268264_10025478 3300028381 Bacteria 4832
205 Ga0307515_10552182 3300028794 Bacteria 762
206 Ga0265327_10068214 3300031251 Bacteria 1790
207 Ga0307508_10007476 3300031616 Bacteria 10170
208 Ga0307412_10057201 3300031911 Bacteria 2602
209 Ga0307414_10000422 3300032004 Bacteria 22803
210 Ga0307414_10001083 3300032004 Bacteria 13923
211 Ga0307414_10047615 3300032004 Bacteria 2952
212 Ga0307415_100888124 3300032126 Bacteria 821
213 Ga0373931_0190929 3300035691 Bacteria 1219
214 Ga0395900_0158879 3300037418 Bacteria 2307
215 Ga0395905_0232039 3300037471 Bacteria 1725
216 Ga0395901_0093894 3300038443 Bacteria 3142
217 Ga0395901_0103063 3300038443 Bacteria 2994
218 Ga0237819_01733 3300038705 Bacteria 5183
219 Ga0436363_0701941 3300039450 Bacteria 793
220 Ga0451793_1307971 3300041452 Bacteria 1841
221 Ga0451800_1520610 3300041459 Bacteria 740
222 Ga0495627_000270 3300046453 Bacteria 52984
223 Ga0495627_058808 3300046453 Bacteria 1141
224 Ga0495638_0000613 3300046460 Bacteria 39830
225 Ga0495638_0036901 3300046460 Bacteria 3110
226 Ga0495638_0182666 3300046460 Bacteria 1195
227 Ga0495650_0000281 3300046471 Bacteria 97226
228 Ga0495610_0000052 3300046512 Bacteria 143261
229 Ga0495610_0000619 3300046512 Bacteria 35124
230 Ga0495610_0111837 3300046512 Bacteria 1209
231 Ga0495620_0047961 3300046515 Bacteria 1835
232 Ga0495632_0001359 3300046519 Bacteria 20574
233 Ga0495643_0000023 3300046522 Bacteria 288590
234 Ga0495663_0003910 3300046525 Bacteria 4245
235 Ga0495663_0026012 3300046525 Bacteria 1711
236 Ga0495666_0092786 3300046526 Bacteria 1424
237 Ga0495654_0052099 3300046530 Bacteria 1995
238 Ga0495654_0055900 3300046530 Bacteria 1909
239 Ga0495654_0205317 3300046530 Bacteria 841
240 Ga0495597_0196671 3300046542 Bacteria 809
241 Ga0495622_0028670 3300046557 Bacteria 2600
242 Ga0495633_0097208 3300046558 Bacteria 1367
243 Ga0495668_0000002 3300046616 Bacteria 763179
244 Ga0495625_0001441 3300046660 Bacteria 28927
245 Ga0495625_0143276 3300046660 Bacteria 1611
246 Ga0495625_0225500 3300046660 Bacteria 1226
247 Ga0495683_0190767 3300047323 Bacteria 930
248 Ga0495681_0000012 3300047470 Bacteria 200275
249 Ga0495681_0091130 3300047470 Bacteria 1346
250 Ga0495686_0035573 3300047472 Bacteria 3200
251 Ga0495686_0084502 3300047472 Bacteria 1934
252 Ga0495686_0097891 3300047472 Bacteria 1773
253 Ga0496100_0003548 3300048903 Bacteria 8146
254 Ga0496100_0019995 3300048903 Bacteria 4007
255 Ga0496100_0754232 3300048903 Bacteria 761
256 Ga0496101_0001646 3300048904 Bacteria 13387
257 Ga0496101_0089279 3300048904 Bacteria 2290
258 Ga0496102_0000445 3300048905 Bacteria 47017
259 Ga0496103_0000021 3300048906 Bacteria 229062
260 Ga0496104_0008535 3300048907 Bacteria 9105
261 Ga0496105_0000396 3300048908 Bacteria 28674
262 Ga0496105_0778729 3300048908 Bacteria 729
263 Ga0496106_0003336 3300048909 Bacteria 11965
264 Ga0496107_0004595 3300048910 Bacteria 9357
265 Ga0496107_0016762 3300048910 Bacteria 5150
266 Ga0496108_0125944 3300048911 Bacteria 2199
267 Ga0496108_0439608 3300048911 Bacteria 1139
268 Ga0496109_0242660 3300048912 Bacteria 1696
269 Ga0496110_0231031 3300048913 Bacteria 1682
270 Ga0496110_0468747 3300048913 Bacteria 1147
271 Ga0496111_0029763 3300048914 Bacteria 3879
272 Ga0496111_0190764 3300048914 Bacteria 1523
273 Ga0496112_0017064 3300048915 Bacteria 6815
274 Ga0496112_0183909 3300048915 Bacteria 2053
275 Ga0496113_0000070 3300048916 Bacteria 44958
276 Ga0496113_0063012 3300048916 Bacteria 2801
277 Ga0496113_0098888 3300048916 Bacteria 2259
278 Ga0496115_0470022 3300048918 Bacteria 1014
279 Ga0496116_0096566 3300048919 Bacteria 1779
280 Ga0496117_0000642 3300048920 Bacteria 56330
281 Ga0496117_0017380 3300048920 Bacteria 6006
282 Ga0496118_0023332 3300048921 Bacteria 5377
283 Ga0496118_0027684 3300048921 Bacteria 4789
284 Ga0496118_0487128 3300048921 Bacteria 617
285 Ga0496119_0000718 3300048922 Bacteria 44530
286 Ga0496119_0097932 3300048922 Bacteria 1652
287 Ga0496120_0000714 3300048923 Bacteria 48706
288 Ga0496121_0003186 3300048924 Bacteria 23650
289 Ga0496121_0015763 3300048924 Bacteria 7874
290 Ga0496121_0186668 3300048924 Bacteria 1491
291 Ga0496122_0000216 3300048925 Bacteria 128675
292 Ga0496122_0001043 3300048925 Bacteria 48546
293 Ga0496123_0000233 3300048926 Bacteria 112582
294 Ga0496123_0000952 3300048926 Bacteria 45010
295 Ga0496124_0004129 3300048927 Bacteria 17156
296 Ga0496124_0025889 3300048927 Bacteria 5301
297 Ga0496124_0425955 3300048927 Bacteria 913
298 Ga0496125_0001024 3300048928 Bacteria 43453
299 Ga0496125_0258089 3300048928 Bacteria 1094
300 Ga0496126_0000367 3300048929 Bacteria 93102
301 Ga0496126_0905705 3300048929 Bacteria 668
302 Ga0501031_0212821 3300049568 Bacteria 1259
303 Ga0501033_0018554 3300049570 Bacteria 5257
304 Ga0501034_0009685 3300049571 Bacteria 10078
305 Ga0501034_0015740 3300049571 Bacteria 7766
306 Ga0501037_0018972 3300049573 Bacteria 5069
307 Ga0501038_0010812 3300049574 Bacteria 8341
308 Ga0501039_0248920 3300049575 Bacteria 1397
309 Ga0501039_0466269 3300049575 Bacteria 992
310 Ga0501040_0857905 3300049576 Bacteria 657
311 Ga0501043_0700913 3300049579 Bacteria 739
312 Ga0501046_0403361 3300049580 Bacteria 987
313 Ga0501046_0425973 3300049580 Bacteria 956
314 Ga0501046_0442849 3300049580 Bacteria 935
315 Ga0501047_0597269 3300049581 Bacteria 926
316 Ga0501048_0572250 3300049582 Bacteria 811
317 Ga0501070_0683405 3300049586 Bacteria 813
318 Ga0501072_0004481 3300049588 Bacteria 10608
319 Ga0501073_0532117 3300049589 Bacteria 812
320 Ga0501083_0267196 3300049744 Bacteria 1113
321 Ga0501083_0366758 3300049744 Bacteria 936
322 Ga0501262_020140 3300049759 Bacteria 909
323 Ga0501035_0011229 3300049822 Bacteria 8296
324 Ga0501035_0097956 3300049822 Bacteria 2575
325 Ga0501044_0014443 3300049823 Bacteria 8526
326 Ga0501044_1040059 3300049823 Bacteria 690
327 nmdc:mga03683_1109_c1 3300050489 Bacteria 7881
328 nmdc:mga03683_14084_c2 3300050489 Bacteria 1938
329 nmdc:mga03n38_20855_c1 3300050490 Bacteria 2628
330 nmdc:mga03n38_330793_c1 3300050490 Bacteria 825
331 nmdc:mga03n38_97380_c1 3300050490 Bacteria 1413
332 nmdc:mga00v17_155485_c1 3300050491 Bacteria 1470
333 nmdc:mga00v17_18474_c1 3300050491 Bacteria 3962
334 nmdc:mga00v17_23425_c1 3300050491 Bacteria 3571
335 nmdc:mga00v17_56103_c1 3300050491 Bacteria 2407
336 nmdc:mga0yw44_61412_c1 3300050492 Bacteria 2306
337 nmdc:mga0k408_227994_c1 3300050493 Bacteria 1112
338 nmdc:mga0k408_28317_c1 3300050493 Bacteria 3185
339 nmdc:mga0k408_2858_c1 3300050493 Bacteria 9168
340 nmdc:mga06z11_5730_c1 3300050494 Bacteria 5004
341 nmdc:mga06z11_666_c1 3300050494 Bacteria 12499
342 nmdc:mga04h51_31_c1 3300050495 Bacteria 48962
343 nmdc:mga04h51_86_c1 3300050495 Bacteria 28364
344 nmdc:mga07m45_152525_c1 3300050496 Bacteria 1340
345 nmdc:mga07m45_23_c1 3300050496 Bacteria 115627
346 nmdc:mga07m45_36605_c1 3300050496 Bacteria 2734
347 nmdc:mga09592_413600_c1 3300050508 Bacteria 1165
348 nmdc:mga0qj67_49229_c1 3300050509 Bacteria 3331
349 nmdc:mga06r32_86655_c1 3300050510 Bacteria 3054
350 nmdc:mga06r32_99217_c1 3300050510 Bacteria 2856
351 nmdc:mga08y16_25558_c1 3300050511 Bacteria 6229
352 nmdc:mga0sz30_38669_c1 3300050516 Bacteria 2000
353 Ga0495655_0057180 3300053083 Bacteria 1052
354 Ga0500643_000226 3300053087 Bacteria 52820
355 Ga0500643_000821 3300053087 Bacteria 20070
356 Ga0500643_001135 3300053087 Bacteria 15888
357 Ga0500643_008199 3300053087 Bacteria 4131
358 Ga0500651_0291368 3300053093 Bacteria 939
359 Ga0500651_0307165 3300053093 Bacteria 909
360 Ga0500651_0461859 3300053093 Bacteria 705
361 Ga0500654_074863 3300053099 Bacteria 1623
362 Ga0500556_0000044 3300053104 Bacteria 132744
363 Ga0500562_011328 3300053108 Bacteria 2264
364 Ga0500592_003436 3300053116 Bacteria 2530
365 Ga0500594_0001390 3300053118 Bacteria 5251
366 Ga0500594_0036743 3300053118 Bacteria 1320
367 Ga0500597_018180 3300053120 Bacteria 2721
368 Ga0500607_000116 3300053121 Bacteria 63505
369 Ga0500607_101401 3300053121 Bacteria 1429
370 Ga0500608_000157 3300053122 Bacteria 28193
371 Ga0500608_022390 3300053122 Bacteria 2929
372 Ga0500642_0000008 3300053130 Bacteria 293258
373 Ga0500642_0124108 3300053130 Bacteria 1209
374 Ga0500655_019434 3300053133 Bacteria 1266
375 Ga0500658_0000225 3300053134 Bacteria 27052
376 Ga0500559_0006965 3300053136 Bacteria 5055
377 Ga0500559_0011158 3300053136 Bacteria 3844
378 Ga0500559_0340377 3300053136 Bacteria 702
379 Ga0500564_000340 3300053138 Bacteria 13114
380 Ga0500568_0001920 3300053139 Bacteria 12747
381 Ga0500568_0041166 3300053139 Bacteria 1858
382 Ga0500568_0228996 3300053139 Bacteria 678
383 Ga0500588_0019816 3300053146 Bacteria 1795
384 Ga0500604_0062487 3300053151 Bacteria 1172
385 Ga0500619_104434 3300053154 Bacteria 962
386 Ga0500622_0023430 3300053156 Bacteria 3270
387 Ga0500624_000013 3300053157 Bacteria 165889
388 Ga0500624_000130 3300053157 Bacteria 32645
389 Ga0500624_000194 3300053157 Bacteria 23992
390 Ga0500627_0000006 3300053158 Bacteria 165989
391 Ga0500627_0244935 3300053158 Bacteria 795
392 Ga0500636_0003917 3300053177 Bacteria 8391
393 Ga0500636_0044809 3300053177 Bacteria 2609
394 Ga0500636_0300341 3300053177 Bacteria 791
395 Ga0500637_0000040 3300053178 Bacteria 46821
396 Ga0500567_002808 3300053723 Bacteria 7598
397 Ga0500611_164516 3300053727 Bacteria 615
398 Ga0500625_000009 3300053729 Bacteria 159296
399 Ga0500645_000379 3300053730 Bacteria 31290
400 Ga0500645_036322 3300053730 Bacteria 1466
401 Ga0500645_059825 3300053730 Bacteria 1103
402 Ga0501084_0170578 3300054114 Bacteria 1836
403 Ga0500661_001475 3300055283 Bacteria 4417
404 Ga0501082_0000145 3300060353 Bacteria 58967
405 Ga0501082_0233599 3300060353 Bacteria 1600
406 Ga0501082_0297619 3300060353 Bacteria 1405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_1307971 Ga0451793_1307971_351_842 162
2 3300041459 Ga0451800_1520610 Ga0451800_1520610_26_532 166
3 3300048921 Ga0496118_0487128 Ga0496118_0487128_26_532 168
4 3300049576 Ga0501040_0857905 Ga0501040_0857905_124_645 169
5 3300049580 Ga0501046_0403361 Ga0501046_0403361_14_535 169
6 3300053083 Ga0495655_0057180 Ga0495655_0057180_151_711 178
7 3300046542 Ga0495597_0196671 Ga0495597_0196671_88_675 180
8 3300046557 Ga0495622_0028670 Ga0495622_0028670_1039_1626 180
9 3300046660 Ga0495625_0225500 Ga0495625_0225500_232_819 180
10 3300053118 Ga0500594_0001390 Ga0500594_0001390_3358_3945 180
11 3300005356 Ga0070674_100694572 Ga0070674_1006945721 182
12 3300006846 Ga0075430_100497017 Ga0075430_1004970172 182
13 3300006847 Ga0075431_100266347 Ga0075431_1002663472 182
14 3300009094 Ga0111539_10038634 Ga0111539_100386342 182
15 3300025937 Ga0207669_10596412 Ga0207669_105964122 182
16 3300049575 Ga0501039_0466269 Ga0501039_0466269_86_646 182
17 3300049582 Ga0501048_0572250 Ga0501048_0572250_112_672 182
18 3300049744 Ga0501083_0267196 Ga0501083_0267196_411_971 182
19 3300050511 nmdc:mga08y16_25558_c1 nmdc:mga08y16_25558_c1_371_931 182
20 3300060353 Ga0501082_0233599 Ga0501082_0233599_264_824 182
21 3300005290 Ga0065712_10276735 Ga0065712_102767351 184
22 3300005338 Ga0068868_100181563 Ga0068868_1001815633 184
23 3300005543 Ga0070672_100083198 Ga0070672_1000831983 184
24 3300005548 Ga0070665_100436350 Ga0070665_1004363502 184
25 3300005981 Ga0081538_10011359 Ga0081538_100113595 184
26 3300006038 Ga0075365_10196726 Ga0075365_101967262 184
27 3300006048 Ga0075363_100013123 Ga0075363_1000131235 184
28 3300006051 Ga0075364_10017687 Ga0075364_100176876 184
29 3300006177 Ga0075362_10042886 Ga0075362_100428864 184
30 3300006178 Ga0075367_10109184 Ga0075367_101091842 184
31 3300006195 Ga0075366_10012444 Ga0075366_100124446 184
32 3300006847 Ga0075431_100276265 Ga0075431_1002762652 184
33 3300006880 Ga0075429_100739655 Ga0075429_1007396552 184
34 3300026023 Ga0207677_10043555 Ga0207677_100435555 184
35 3300028794 Ga0307515_10552182 Ga0307515_105521822 184
36 3300035691 Ga0373931_0190929 Ga0373931_0190929_145_705 184
37 3300039450 Ga0436363_0701941 Ga0436363_0701941_119_685 184
38 3300046460 Ga0495638_0036901 Ga0495638_0036901_188_748 184
39 3300049580 Ga0501046_0442849 Ga0501046_0442849_69_629 184
40 3300049588 Ga0501072_0004481 Ga0501072_0004481_7892_8452 184
41 3300049589 Ga0501073_0532117 Ga0501073_0532117_37_597 184
42 3300049744 Ga0501083_0366758 Ga0501083_0366758_106_666 184
43 3300050489 nmdc:mga03683_14084_c2 nmdc:mga03683_14084_c2_279_839 184
44 3300050490 nmdc:mga03n38_20855_c1 nmdc:mga03n38_20855_c1_944_1504 184
45 3300050491 nmdc:mga00v17_23425_c1 nmdc:mga00v17_23425_c1_2008_2568 184
46 3300050493 nmdc:mga0k408_2858_c1 nmdc:mga0k408_2858_c1_3948_4508 184
47 3300050508 nmdc:mga09592_413600_c1 nmdc:mga09592_413600_c1_413_973 184
48 3300050509 nmdc:mga0qj67_49229_c1 nmdc:mga0qj67_49229_c1_365_925 184
49 3300050510 nmdc:mga06r32_86655_c1 nmdc:mga06r32_86655_c1_1566_2126 184
50 3300050510 nmdc:mga06r32_99217_c1 nmdc:mga06r32_99217_c1_539_1099 184
51 3300053099 Ga0500654_074863 Ga0500654_074863_1040_1600 184
52 3300053118 Ga0500594_0036743 Ga0500594_0036743_395_955 184
53 3300053130 Ga0500642_0124108 Ga0500642_0124108_366_926 184
54 3300053133 Ga0500655_019434 Ga0500655_019434_447_1007 184
55 3300053139 Ga0500568_0041166 Ga0500568_0041166_384_944 184
56 3300053146 Ga0500588_0019816 Ga0500588_0019816_134_694 184
57 3300053151 Ga0500604_0062487 Ga0500604_0062487_370_930 184
58 3300053156 Ga0500622_0023430 Ga0500622_0023430_64_624 184
59 3300053158 Ga0500627_0244935 Ga0500627_0244935_219_779 184
60 3300053727 Ga0500611_164516 Ga0500611_164516_34_594 184
61 3300053730 Ga0500645_059825 Ga0500645_059825_120_680 184
62 3300054114 Ga0501084_0170578 Ga0501084_0170578_200_760 184
63 3300060353 Ga0501082_0000145 Ga0501082_0000145_20214_20774 184
64 3300060353 Ga0501082_0297619 Ga0501082_0297619_422_982 184
65 3300026121 Ga0207683_10827668 Ga0207683_108276682 185
66 iso_pu_bacteria 2512564014 2512641987 185
67 3300005466 Ga0070685_10008587 Ga0070685_100085874 186
68 3300047472 Ga0495686_0084502 Ga0495686_0084502_773_1351 186
69 3300047472 Ga0495686_0097891 Ga0495686_0097891_396_974 186
70 iso_pu_bacteria 8054302542 8054302787 186
71 3300005353 Ga0070669_100096589 Ga0070669_1000965894 187
72 3300009147 Ga0114129_10548535 Ga0114129_105485352 187
73 3300053120 Ga0500597_018180 Ga0500597_018180_996_1565 187
74 3300053157 Ga0500624_000013 Ga0500624_000013_34252_34821 187
75 3300053178 Ga0500637_0000040 Ga0500637_0000040_33991_34560 187
76 iso_pu_bacteria 2738541275 2738709886 187
77 iso_pu_bacteria 2738541301 2738848311 187
78 iso_pu_bacteria 2738541304 2738864040 187
79 iso_pu_bacteria 2738543022 2739296558 187
80 iso_pu_bacteria 2738543033 2739358236 187
81 iso_pu_bacteria 2739367664 2739649263 187
82 iso_pu_bacteria 2739367865 2740027736 187
83 iso_pu_bacteria 2895880812 2895885997 187
84 iso_pu_bacteria 2928100450 2928101434 187
85 iso_pu_bacteria 2928959182 2928960155 187
86 3300050496 nmdc:mga07m45_36605_c1 nmdc:mga07m45_36605_c1_1348_1917 188
87 3300001904 JGI24736J21556_1000425 JGI24736J21556_10004258 189
88 3300002075 JGI24738J21930_10002048 JGI24738J21930_100020484 189
89 3300005530 Ga0070679_100262816 Ga0070679_1002628162 189
90 3300005578 Ga0068854_100010433 Ga0068854_1000104335 189
91 3300005616 Ga0068852_100490548 Ga0068852_1004905482 189
92 3300005834 Ga0068851_10263961 Ga0068851_102639611 189
93 3300005842 Ga0068858_100006609 Ga0068858_1000066099 189
94 3300006042 Ga0075368_10003977 Ga0075368_100039777 189
95 3300006048 Ga0075363_100089757 Ga0075363_1000897573 189
96 3300006178 Ga0075367_10002698 Ga0075367_100026987 189
97 3300006237 Ga0097621_100017464 Ga0097621_1000174642 189
98 3300006353 Ga0075370_10081095 Ga0075370_100810953 189
99 3300006358 Ga0068871_100010432 Ga0068871_1000104327 189
100 3300009093 Ga0105240_10850582 Ga0105240_108505821 189
101 3300009098 Ga0105245_10100168 Ga0105245_101001682 189
102 3300009148 Ga0105243_10014502 Ga0105243_100145028 189
103 3300009176 Ga0105242_10115876 Ga0105242_101158763 189
104 3300009551 Ga0105238_10027982 Ga0105238_100279828 189
105 3300013297 Ga0157378_10236784 Ga0157378_102367842 189
106 3300013306 Ga0163162_10951015 Ga0163162_109510152 189
107 3300013308 Ga0157375_10335558 Ga0157375_103355583 189
108 3300025304 Ga0209257_1000877 Ga0209257_100087725 189
109 3300025909 Ga0207705_10059436 Ga0207705_100594364 189
110 3300025913 Ga0207695_10116140 Ga0207695_101161403 189
111 3300025913 Ga0207695_11057766 Ga0207695_110577661 189
112 3300025921 Ga0207652_10207033 Ga0207652_102070332 189
113 3300025924 Ga0207694_10036377 Ga0207694_100363775 189
114 3300025927 Ga0207687_10058637 Ga0207687_100586374 189
115 3300025934 Ga0207686_10115828 Ga0207686_101158283 189
116 3300025960 Ga0207651_10467458 Ga0207651_104674582 189
117 3300025981 Ga0207640_10000118 Ga0207640_100001188 189
118 3300025981 Ga0207640_10168087 Ga0207640_101680872 189
119 3300026035 Ga0207703_10005884 Ga0207703_100058846 189
120 3300026041 Ga0207639_10214084 Ga0207639_102140842 189
121 3300026142 Ga0207698_10728218 Ga0207698_107282182 189
122 3300027866 Ga0209813_10000174 Ga0209813_100001745 189
123 3300046460 Ga0495638_0000613 Ga0495638_0000613_20061_20636 189
124 3300046512 Ga0495610_0111837 Ga0495610_0111837_147_722 189
125 3300046525 Ga0495663_0003910 Ga0495663_0003910_301_876 189
126 3300046526 Ga0495666_0092786 Ga0495666_0092786_546_1121 189
127 3300046530 Ga0495654_0055900 Ga0495654_0055900_540_1115 189
128 3300046558 Ga0495633_0097208 Ga0495633_0097208_746_1321 189
129 3300046616 Ga0495668_0000002 Ga0495668_0000002_315186_315761 189
130 3300046660 Ga0495625_0143276 Ga0495625_0143276_577_1152 189
131 3300047470 Ga0495681_0091130 Ga0495681_0091130_483_1058 189
132 3300048924 Ga0496121_0015763 Ga0496121_0015763_5853_6428 189
133 3300050490 nmdc:mga03n38_330793_c1 nmdc:mga03n38_330793_c1_233_811 189
134 3300050494 nmdc:mga06z11_666_c1 nmdc:mga06z11_666_c1_6264_6842 189
135 3300050495 nmdc:mga04h51_86_c1 nmdc:mga04h51_86_c1_26302_26880 189
136 3300050496 nmdc:mga07m45_152525_c1 nmdc:mga07m45_152525_c1_227_805 189
137 3300053116 Ga0500592_003436 Ga0500592_003436_811_1386 189
138 3300053121 Ga0500607_101401 Ga0500607_101401_595_1164 189
139 3300053134 Ga0500658_0000225 Ga0500658_0000225_20106_20681 189
140 3300053136 Ga0500559_0340377 Ga0500559_0340377_92_664 189
141 3300053157 Ga0500624_000130 Ga0500624_000130_237_812 189
142 3300053158 Ga0500627_0000006 Ga0500627_0000006_152610_153185 189
143 iso_pu_bacteria 2643221560 2643821154 189
144 3300005289 Ga0065704_10079357 Ga0065704_100793572 190
145 3300005327 Ga0070658_10002923 Ga0070658_100029235 190
146 3300005335 Ga0070666_10393582 Ga0070666_103935821 190
147 3300005340 Ga0070689_100064045 Ga0070689_1000640453 190
148 3300005347 Ga0070668_100103895 Ga0070668_1001038952 190
149 3300005353 Ga0070669_100000620 Ga0070669_10000062012 190
150 3300005544 Ga0070686_100012071 Ga0070686_1000120712 190
151 3300005548 Ga0070665_100163657 Ga0070665_1001636572 190
152 3300005548 Ga0070665_100439245 Ga0070665_1004392452 190
153 3300005563 Ga0068855_100083512 Ga0068855_1000835124 190
154 3300005578 Ga0068854_100002421 Ga0068854_1000024212 190
155 3300005616 Ga0068852_100000824 Ga0068852_10000082415 190
156 3300005616 Ga0068852_100013242 Ga0068852_1000132427 190
157 3300005616 Ga0068852_100079378 Ga0068852_1000793784 190
158 3300005618 Ga0068864_100219545 Ga0068864_1002195452 190
159 3300005841 Ga0068863_100192645 Ga0068863_1001926452 190
160 3300005844 Ga0068862_100332190 Ga0068862_1003321902 190
161 3300009093 Ga0105240_10004776 Ga0105240_100047768 190
162 3300009177 Ga0105248_10334980 Ga0105248_103349802 190
163 3300009551 Ga0105238_10017709 Ga0105238_100177092 190
164 3300013306 Ga0163162_10757767 Ga0163162_107577672 190
165 3300014326 Ga0157380_10194303 Ga0157380_101943033 190
166 3300014968 Ga0157379_10178058 Ga0157379_101780582 190
167 3300015690 Ga0183363_1001 Ga0183363_1001393 190
168 3300025903 Ga0207680_10193091 Ga0207680_101930911 190
169 3300025904 Ga0207647_10013128 Ga0207647_100131282 190
170 3300025904 Ga0207647_10211811 Ga0207647_102118111 190
171 3300025904 Ga0207647_10363465 Ga0207647_103634651 190
172 3300025909 Ga0207705_10000458 Ga0207705_1000045835 190
173 3300025913 Ga0207695_10019296 Ga0207695_100192962 190
174 3300025923 Ga0207681_10000558 Ga0207681_1000055811 190
175 3300025931 Ga0207644_10000005 Ga0207644_10000005101 190
176 3300025941 Ga0207711_10333838 Ga0207711_103338382 190
177 3300025941 Ga0207711_10373762 Ga0207711_103737622 190
178 3300025949 Ga0207667_10065138 Ga0207667_100651382 190
179 3300025949 Ga0207667_10122304 Ga0207667_101223041 190
180 3300025972 Ga0207668_10046135 Ga0207668_100461352 190
181 3300025981 Ga0207640_10016090 Ga0207640_100160906 190
182 3300025981 Ga0207640_10210945 Ga0207640_102109452 190
183 3300025981 Ga0207640_10428388 Ga0207640_104283882 190
184 3300026078 Ga0207702_10014676 Ga0207702_100146761 190
185 3300026088 Ga0207641_10259676 Ga0207641_102596762 190
186 3300026095 Ga0207676_10167212 Ga0207676_101672122 190
187 3300026116 Ga0207674_10089235 Ga0207674_100892354 190
188 3300026142 Ga0207698_10000005 Ga0207698_10000005261 190
189 3300046453 Ga0495627_000270 Ga0495627_000270_18023_18598 190
190 3300046471 Ga0495650_0000281 Ga0495650_0000281_92640_93215 190
191 3300046512 Ga0495610_0000052 Ga0495610_0000052_92171_92746 190
192 3300046512 Ga0495610_0000619 Ga0495610_0000619_12285_12860 190
193 3300046515 Ga0495620_0047961 Ga0495620_0047961_643_1218 190
194 3300046519 Ga0495632_0001359 Ga0495632_0001359_1641_2216 190
195 3300046522 Ga0495643_0000023 Ga0495643_0000023_282181_282756 190
196 3300046530 Ga0495654_0052099 Ga0495654_0052099_552_1127 190
197 3300047323 Ga0495683_0190767 Ga0495683_0190767_103_678 190
198 3300047470 Ga0495681_0000012 Ga0495681_0000012_119539_120114 190
199 3300048903 Ga0496100_0019995 Ga0496100_0019995_2567_3139 190
200 3300048904 Ga0496101_0089279 Ga0496101_0089279_1225_1797 190
201 3300048909 Ga0496106_0003336 Ga0496106_0003336_7896_8468 190
202 3300048910 Ga0496107_0016762 Ga0496107_0016762_3636_4208 190
203 3300048911 Ga0496108_0125944 Ga0496108_0125944_502_1074 190
204 3300048913 Ga0496110_0231031 Ga0496110_0231031_1097_1669 190
205 3300048914 Ga0496111_0190764 Ga0496111_0190764_385_957 190
206 3300048915 Ga0496112_0183909 Ga0496112_0183909_1423_1995 190
207 3300048916 Ga0496113_0063012 Ga0496113_0063012_1579_2151 190
208 3300048924 Ga0496121_0186668 Ga0496121_0186668_469_1041 190
209 3300048928 Ga0496125_0258089 Ga0496125_0258089_158_736 190
210 3300053087 Ga0500643_000226 Ga0500643_000226_2674_3246 190
211 3300053087 Ga0500643_001135 Ga0500643_001135_1191_1769 190
212 3300053093 Ga0500651_0291368 Ga0500651_0291368_87_665 190
213 3300053136 Ga0500559_0006965 Ga0500559_0006965_2297_2869 190
214 3300055283 Ga0500661_001475 Ga0500661_001475_1235_1807 190
215 3300002459 JGI24751J29686_10000118 JGI24751J29686_1000011815 191
216 3300005347 Ga0070668_100564807 Ga0070668_1005648071 191
217 3300005355 Ga0070671_100090809 Ga0070671_1000908092 191
218 3300005539 Ga0068853_100002615 Ga0068853_10000261514 191
219 3300005548 Ga0070665_100105570 Ga0070665_1001055703 191
220 3300005563 Ga0068855_100020437 Ga0068855_1000204378 191
221 3300005563 Ga0068855_100694858 Ga0068855_1006948582 191
222 3300005577 Ga0068857_100040987 Ga0068857_1000409872 191
223 3300005578 Ga0068854_100125372 Ga0068854_1001253722 191
224 3300005616 Ga0068852_100039629 Ga0068852_1000396292 191
225 3300005616 Ga0068852_100138051 Ga0068852_1001380512 191
226 3300005617 Ga0068859_100031721 Ga0068859_1000317213 191
227 3300005842 Ga0068858_100002472 Ga0068858_1000024725 191
228 3300005842 Ga0068858_100038872 Ga0068858_1000388723 191
229 3300005843 Ga0068860_100382512 Ga0068860_1003825122 191
230 3300006042 Ga0075368_10000902 Ga0075368_100009025 191
231 3300006048 Ga0075363_100009080 Ga0075363_1000090803 191
232 3300006051 Ga0075364_10035375 Ga0075364_100353752 191
233 3300006051 Ga0075364_10274414 Ga0075364_102744142 191
234 3300006177 Ga0075362_10019814 Ga0075362_100198143 191
235 3300006178 Ga0075367_10006559 Ga0075367_100065594 191
236 3300006186 Ga0075369_10060083 Ga0075369_100600832 191
237 3300006195 Ga0075366_10032442 Ga0075366_100324424 191
238 3300006931 Ga0097620_100031721 Ga0097620_1000317214 191
239 3300009093 Ga0105240_10419402 Ga0105240_104194022 191
240 3300009093 Ga0105240_11437048 Ga0105240_114370481 191
241 3300009177 Ga0105248_10024882 Ga0105248_100248822 191
242 3300009551 Ga0105238_10626701 Ga0105238_106267012 191
243 3300009553 Ga0105249_11091376 Ga0105249_110913762 191
244 3300013306 Ga0163162_10036423 Ga0163162_100364234 191
245 3300017792 Ga0163161_10003204 Ga0163161_100032047 191
246 3300025923 Ga0207681_10111426 Ga0207681_101114262 191
247 3300025931 Ga0207644_10077676 Ga0207644_100776762 191
248 3300025941 Ga0207711_10168171 Ga0207711_101681712 191
249 3300025949 Ga0207667_10002049 Ga0207667_100020492 191
250 3300025949 Ga0207667_10211107 Ga0207667_102111072 191
251 3300025986 Ga0207658_10894664 Ga0207658_108946642 191
252 3300026035 Ga0207703_10002142 Ga0207703_100021424 191
253 3300026035 Ga0207703_10027276 Ga0207703_100272764 191
254 3300026041 Ga0207639_10003373 Ga0207639_100033733 191
255 3300026095 Ga0207676_11084821 Ga0207676_110848211 191
256 3300026116 Ga0207674_10034442 Ga0207674_100344427 191
257 3300026116 Ga0207674_10274229 Ga0207674_102742293 191
258 3300026142 Ga0207698_10201690 Ga0207698_102016901 191
259 3300027866 Ga0209813_10000044 Ga0209813_1000004424 191
260 3300028381 Ga0268264_10025478 Ga0268264_100254782 191
261 3300031251 Ga0265327_10068214 Ga0265327_100682142 191
262 3300032004 Ga0307414_10000422 Ga0307414_1000042214 191
263 3300046453 Ga0495627_058808 Ga0495627_058808_541_1122 191
264 3300046530 Ga0495654_0205317 Ga0495654_0205317_136_723 191
265 3300048903 Ga0496100_0754232 Ga0496100_0754232_170_748 191
266 3300048908 Ga0496105_0778729 Ga0496105_0778729_120_698 191
267 3300048911 Ga0496108_0439608 Ga0496108_0439608_311_889 191
268 3300048912 Ga0496109_0242660 Ga0496109_0242660_564_1142 191
269 3300048913 Ga0496110_0468747 Ga0496110_0468747_490_1068 191
270 3300048914 Ga0496111_0029763 Ga0496111_0029763_276_854 191
271 3300048916 Ga0496113_0098888 Ga0496113_0098888_802_1380 191
272 3300048925 Ga0496122_0000216 Ga0496122_0000216_102291_102875 191
273 3300048926 Ga0496123_0000233 Ga0496123_0000233_102349_102933 191
274 3300048927 Ga0496124_0425955 Ga0496124_0425955_127_705 191
275 3300048929 Ga0496126_0905705 Ga0496126_0905705_59_643 191
276 3300050493 nmdc:mga0k408_227994_c1 nmdc:mga0k408_227994_c1_126_713 191
277 3300053087 Ga0500643_000821 Ga0500643_000821_9435_10019 191
278 3300053087 Ga0500643_008199 Ga0500643_008199_2498_3079 191
279 3300053121 Ga0500607_000116 Ga0500607_000116_3032_3610 191
280 3300053122 Ga0500608_000157 Ga0500608_000157_26813_27400 191
281 3300053136 Ga0500559_0011158 Ga0500559_0011158_1367_1951 191
282 3300053138 Ga0500564_000340 Ga0500564_000340_5811_6398 191
283 3300053139 Ga0500568_0228996 Ga0500568_0228996_70_654 191
284 3300053154 Ga0500619_104434 Ga0500619_104434_67_654 191
285 3300053157 Ga0500624_000194 Ga0500624_000194_15515_16096 191
286 3300053177 Ga0500636_0003917 Ga0500636_0003917_2430_3011 191
287 3300053177 Ga0500636_0044809 Ga0500636_0044809_860_1438 191
288 3300053723 Ga0500567_002808 Ga0500567_002808_454_1041 191
289 3300053729 Ga0500625_000009 Ga0500625_000009_154306_154893 191
290 3300001990 JGI24737J22298_10002088 JGI24737J22298_100020885 192
291 3300002067 JGI24735J21928_10009445 JGI24735J21928_100094454 192
292 3300002067 JGI24735J21928_10012493 JGI24735J21928_100124933 192
293 3300003214 JGI25165J46597_1000208 JGI25165J46597_100020891 192
294 3300003763 Ga0055529_1003973 Ga0055529_10039732 192
295 3300003794 Ga0055531_10003343 Ga0055531_100033436 192
296 3300005327 Ga0070658_10017856 Ga0070658_100178567 192
297 3300005327 Ga0070658_10049304 Ga0070658_100493042 192
298 3300005459 Ga0068867_100119579 Ga0068867_1001195793 192
299 3300005539 Ga0068853_100014640 Ga0068853_1000146405 192
300 3300005842 Ga0068858_100046469 Ga0068858_1000464695 192
301 3300006358 Ga0068871_100374203 Ga0068871_1003742032 192
302 3300009093 Ga0105240_10043035 Ga0105240_100430356 192
303 3300009147 Ga0114129_11099757 Ga0114129_110997571 192
304 3300010375 Ga0105239_10042265 Ga0105239_100422652 192
305 3300013104 Ga0157370_10000080 Ga0157370_1000008098 192
306 3300013296 Ga0157374_10059840 Ga0157374_100598403 192
307 3300013307 Ga0157372_10304537 Ga0157372_103045372 192
308 3300025254 Ga0209148_1001541 Ga0209148_10015415 192
309 3300025261 Ga0209233_1000186 Ga0209233_100018647 192
310 3300025272 Ga0209455_1000971 Ga0209455_100097110 192
311 3300025909 Ga0207705_10003669 Ga0207705_100036698 192
312 3300026035 Ga0207703_10072821 Ga0207703_100728212 192
313 3300026089 Ga0207648_10225681 Ga0207648_102256812 192
314 3300026142 Ga0207698_10321627 Ga0207698_103216272 192
315 3300031616 Ga0307508_10007476 Ga0307508_1000747611 192
316 3300031911 Ga0307412_10057201 Ga0307412_100572011 192
317 3300032004 Ga0307414_10001083 Ga0307414_1000108310 192
318 3300032004 Ga0307414_10047615 Ga0307414_100476154 192
319 3300037418 Ga0395900_0158879 Ga0395900_0158879_1192_1779 192
320 3300037471 Ga0395905_0232039 Ga0395905_0232039_1060_1647 192
321 3300038443 Ga0395901_0093894 Ga0395901_0093894_755_1333 192
322 3300038443 Ga0395901_0103063 Ga0395901_0103063_648_1226 192
323 3300038705 Ga0237819_01733 Ga0237819_01733_976_1557 192
324 3300046525 Ga0495663_0026012 Ga0495663_0026012_206_790 192
325 3300046660 Ga0495625_0001441 Ga0495625_0001441_25803_26387 192
326 3300047472 Ga0495686_0035573 Ga0495686_0035573_1394_2038 192
327 3300048920 Ga0496117_0017380 Ga0496117_0017380_4943_5617 192
328 3300048921 Ga0496118_0023332 Ga0496118_0023332_144_818 192
329 3300048922 Ga0496119_0097932 Ga0496119_0097932_219_893 192
330 3300048927 Ga0496124_0025889 Ga0496124_0025889_1415_2089 192
331 3300049586 Ga0501070_0683405 Ga0501070_0683405_114_692 192
332 3300053093 Ga0500651_0307165 Ga0500651_0307165_235_819 192
333 3300053139 Ga0500568_0001920 Ga0500568_0001920_111_695 192
334 3300003794 Ga0055531_10053397 Ga0055531_100533972 193
335 3300005578 Ga0068854_100011559 Ga0068854_1000115593 193
336 3300009177 Ga0105248_10234175 Ga0105248_102341754 193
337 3300016635 Ga0183361_10207 Ga0183361_102072 193
338 3300025292 Ga0209676_1054317 Ga0209676_10543172 193
339 3300025304 Ga0209257_1002782 Ga0209257_100278213 193
340 3300025304 Ga0209257_1082318 Ga0209257_10823182 193
341 3300025981 Ga0207640_10010580 Ga0207640_100105808 193
342 3300026116 Ga0207674_10387550 Ga0207674_103875502 193
343 3300046460 Ga0495638_0182666 Ga0495638_0182666_457_1059 193
344 3300049568 Ga0501031_0212821 Ga0501031_0212821_383_970 193
345 3300049570 Ga0501033_0018554 Ga0501033_0018554_3634_4221 193
346 3300049571 Ga0501034_0009685 Ga0501034_0009685_8512_9171 193
347 3300049571 Ga0501034_0015740 Ga0501034_0015740_3529_4116 193
348 3300049573 Ga0501037_0018972 Ga0501037_0018972_4313_4900 193
349 3300049574 Ga0501038_0010812 Ga0501038_0010812_6493_7080 193
350 3300049575 Ga0501039_0248920 Ga0501039_0248920_772_1359 193
351 3300049579 Ga0501043_0700913 Ga0501043_0700913_137_724 193
352 3300049580 Ga0501046_0425973 Ga0501046_0425973_76_663 193
353 3300049581 Ga0501047_0597269 Ga0501047_0597269_253_876 193
354 3300049759 Ga0501262_020140 Ga0501262_020140_140_727 193
355 3300049822 Ga0501035_0011229 Ga0501035_0011229_2901_3488 193
356 3300049822 Ga0501035_0097956 Ga0501035_0097956_1121_1822 193
357 3300049823 Ga0501044_0014443 Ga0501044_0014443_4328_4915 193
358 3300049823 Ga0501044_1040059 Ga0501044_1040059_55_648 193
359 3300053093 Ga0500651_0461859 Ga0500651_0461859_28_630 193
360 3300053104 Ga0500556_0000044 Ga0500556_0000044_9301_9903 193
361 3300053108 Ga0500562_011328 Ga0500562_011328_583_1185 193
362 3300053122 Ga0500608_022390 Ga0500608_022390_127_729 193
363 3300053130 Ga0500642_0000008 Ga0500642_0000008_219610_220212 193
364 3300053730 Ga0500645_000379 Ga0500645_000379_26654_27256 193
365 2162886007 SwRhRL2b_contig_1298373 SwRhRL2b_0978.00000620 194
366 3300002074 JGI24748J21848_1005421 JGI24748J21848_10054212 194
367 3300002239 JGI24034J26672_10008304 JGI24034J26672_100083042 194
368 3300005289 Ga0065704_10000954 Ga0065704_100009545 194
369 3300005347 Ga0070668_100009926 Ga0070668_1000099262 194
370 3300005353 Ga0070669_100001027 Ga0070669_1000010271 194
371 3300005353 Ga0070669_100023467 Ga0070669_1000234677 194
372 3300005355 Ga0070671_100002850 Ga0070671_1000028506 194
373 3300005367 Ga0070667_100042137 Ga0070667_1000421373 194
374 3300009092 Ga0105250_10007046 Ga0105250_100070465 194
375 3300009101 Ga0105247_10311725 Ga0105247_103117252 194
376 3300009553 Ga0105249_10076425 Ga0105249_100764253 194
377 3300013306 Ga0163162_10006378 Ga0163162_100063789 194
378 3300017792 Ga0163161_10207685 Ga0163161_102076852 194
379 3300025735 Ga0207713_1025621 Ga0207713_10256213 194
380 3300025923 Ga0207681_10000147 Ga0207681_1000014713 194
381 3300025931 Ga0207644_10008635 Ga0207644_100086357 194
382 3300025972 Ga0207668_10061979 Ga0207668_100619792 194
383 3300025986 Ga0207658_10005375 Ga0207658_100053759 194
384 3300028380 Ga0268265_10074438 Ga0268265_100744382 194
385 3300032126 Ga0307415_100888124 Ga0307415_1008881241 194
386 3300048903 Ga0496100_0003548 Ga0496100_0003548_4689_5273 194
387 3300048904 Ga0496101_0001646 Ga0496101_0001646_6029_6613 194
388 3300048905 Ga0496102_0000445 Ga0496102_0000445_45285_45869 194
389 3300048906 Ga0496103_0000021 Ga0496103_0000021_36679_37263 194
390 3300048907 Ga0496104_0008535 Ga0496104_0008535_7193_7777 194
391 3300048908 Ga0496105_0000396 Ga0496105_0000396_5349_5933 194
392 3300048910 Ga0496107_0004595 Ga0496107_0004595_6526_7110 194
393 3300048915 Ga0496112_0017064 Ga0496112_0017064_2312_2896 194
394 3300048916 Ga0496113_0000070 Ga0496113_0000070_15177_15761 194
395 3300048918 Ga0496115_0470022 Ga0496115_0470022_419_1003 194
396 3300048919 Ga0496116_0096566 Ga0496116_0096566_1178_1762 194
397 3300048920 Ga0496117_0000642 Ga0496117_0000642_15140_15724 194
398 3300048921 Ga0496118_0027684 Ga0496118_0027684_2264_2848 194
399 3300048922 Ga0496119_0000718 Ga0496119_0000718_37143_37727 194
400 3300048923 Ga0496120_0000714 Ga0496120_0000714_47214_47798 194
401 3300048924 Ga0496121_0003186 Ga0496121_0003186_8618_9202 194
402 3300048925 Ga0496122_0001043 Ga0496122_0001043_28566_29150 194
403 3300048926 Ga0496123_0000952 Ga0496123_0000952_30125_30709 194
404 3300048927 Ga0496124_0004129 Ga0496124_0004129_8186_8770 194
405 3300048928 Ga0496125_0001024 Ga0496125_0001024_28568_29152 194
406 3300048929 Ga0496126_0000367 Ga0496126_0000367_45308_45892 194
407 3300050489 nmdc:mga03683_1109_c1 nmdc:mga03683_1109_c1_2709_3299 194
408 3300050490 nmdc:mga03n38_97380_c1 nmdc:mga03n38_97380_c1_621_1211 194
409 3300050491 nmdc:mga00v17_155485_c1 nmdc:mga00v17_155485_c1_548_1153 194
410 3300050491 nmdc:mga00v17_18474_c1 nmdc:mga00v17_18474_c1_2752_3342 194
411 3300050491 nmdc:mga00v17_56103_c1 nmdc:mga00v17_56103_c1_354_959 194
412 3300050492 nmdc:mga0yw44_61412_c1 nmdc:mga0yw44_61412_c1_1052_1642 194
413 3300050493 nmdc:mga0k408_28317_c1 nmdc:mga0k408_28317_c1_365_955 194
414 3300050494 nmdc:mga06z11_5730_c1 nmdc:mga06z11_5730_c1_1985_2575 194
415 3300050495 nmdc:mga04h51_31_c1 nmdc:mga04h51_31_c1_29015_29605 194
416 3300050496 nmdc:mga07m45_23_c1 nmdc:mga07m45_23_c1_84244_84834 194
417 3300050516 nmdc:mga0sz30_38669_c1 nmdc:mga0sz30_38669_c1_790_1380 194
418 3300053177 Ga0500636_0300341 Ga0500636_0300341_83_679 194
419 3300053730 Ga0500645_036322 Ga0500645_036322_98_688 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01106

NifU

NifU-like domain

165

231

0.99

PF08712

Nfu_N

Scaffold protein Nfu/NifU N terminal

44

130

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m5o-assembly1.cif.gz_A solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c 0.9657 119 194
2ltm-assembly1.cif.gz_A solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b 0.9174 1 97
2z51-assembly1.cif.gz_A-2 crystal structure of arabidopsis cnfu involved in iron-sulfur cluster biosynthesis 0.8924 124 194
2ltl-assembly1.cif.gz_A solution nmr structure of nifu-like protein from saccharomyces cerevisiae, northeast structural genomics consortium (nesg) target yr313a 0.8593 1 97
2ffm-assembly1.cif.gz_A x-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18. 0.8573 4 85
ID Description Score Start End Superfamily
af_Q4DZR1_314_387_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9782 121 192 3.30.300.130
af_P32860_146_234_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9727 117 194 3.30.300.130
af_Q59N44_19_128_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.968 2 96 3.30.1370.70
af_Q54MZ7_83_193_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9638 3 97 3.30.1370.70
af_C0H578_105_189_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9621 116 194 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A3D2F7G1-F1-model_v4 NifU family protein 0.9993 123 194 GO:0005506
GO:0016226
GO:0051536
AF-Q8MSE0-F1-model_v4 GM32035p 0.9992 125 194 GO:0005506
GO:0016226
GO:0051536
AF-A0A529N2S4-F1-model_v4 NifU family protein 0.996 114 194 GO:0005506
GO:0016226
GO:0051536
AF-A0A3S2Q8G2-F1-model_v4 deleted 0.9935 114 194
AF-A0A0C2WQN0-F1-model_v4 NIF system FeS cluster assembly NifU C-terminal domain-containing protein 0.9929 126 194 GO:0005506
GO:0005739
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
88.05 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map