F439674

General Info

Members Datasets Scaffolds Average Seq Length
420 242 840 442

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100287431|Ga0070683_1002874311
Length 471
Sequence MLDVLRKNRSSEAEKADEELAGLIGSAAHVLTGAQSDYDPLIDLVGDSHFVLIGEASYGTQEFYQQRAEITKRLVTEKGFTAVAVEADWPDAYRINRYVRGVGDGDSALDALSGFERFPTWMWRNTVVLDFIRWLRAHNDSLGRGSSNTSSGDAMQKVGFYGLDLYSLYTSIQTVLTYLDKVDPEAAKRARYRYSCLEHFGEDTQAYGYTASFGLTKPCEEDVIGQLQDLQSKATDYSQRDGKVAEDEYFFAEQNARLVKNAEEYYRTMFGGRVSSWNLRDRHMVDTLDSLVTHLNRRGARTKAVVWAHNSHLGDARATYMGEQGEWNIGQLVRERHGRDATLLGFTTYAGTVTAASDWGEPAERKRVRPGLAGSYEALFHNASLASHKPNFLLPLRGSSIADSLRDERLERAIGVIYRPESERLSHYFEASLADQFDAIMHFDETQALQPLERTPRWETGEVPETYPTSL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
144 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
220 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
221 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 2831426010 Nostoc sp. 106C Isolate Unclassified
241 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
242 2849660919 Nostoc sp. T09 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 1.43
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.48
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100287431 3300005329 Bacteria 1564
2 JGI25406J46586_10001388 3300003203 Bacteria 11429
3 rootH1_10011618 3300003316 Bacteria 4391
4 rootH2_10045810 3300003320 Bacteria 41005
5 rootL2_10022609 3300003322 Bacteria 5941
6 rootL2_10068702 3300003322 Bacteria 15259
7 rootH1_10018536 3300003323 Bacteria 10229
8 Ga0007416J51690_1000778 3300003577 Bacteria 5413
9 Ga0070658_10009310 3300005327 Bacteria 7899
10 Ga0070676_10051739 3300005328 Bacteria 2412
11 Ga0070682_100039556 3300005337 Bacteria 2898
12 Ga0068868_100007054 3300005338 Bacteria 7986
13 Ga0070660_100017149 3300005339 Bacteria 5273
14 Ga0070660_100040097 3300005339 Bacteria 3562
15 Ga0070689_100001063 3300005340 Bacteria 17230
16 Ga0070691_10033854 3300005341 Bacteria 2404
17 Ga0070714_100007270 3300005435 Bacteria 8607
18 Ga0070714_100019932 3300005435 Bacteria 5472
19 Ga0070714_100211430 3300005435 Bacteria 1778
20 Ga0070705_100095678 3300005440 Bacteria 1863
21 Ga0070700_100020785 3300005441 Bacteria 3809
22 Ga0070694_100046127 3300005444 Bacteria 2924
23 Ga0070708_100094627 3300005445 Bacteria 2726
24 Ga0070708_100149563 3300005445 Bacteria 2171
25 Ga0070678_100116057 3300005456 Bacteria 2103
26 Ga0070681_10007340 3300005458 Bacteria 10769
27 Ga0070681_10007341 3300005458 Bacteria 10768
28 Ga0070681_10013537 3300005458 Bacteria 8111
29 Ga0070681_10146525 3300005458 Bacteria 2290
30 Ga0068867_100067826 3300005459 Bacteria 2661
31 Ga0070706_100045800 3300005467 Bacteria 4038
32 Ga0070706_100078449 3300005467 Unclassified 3058
33 Ga0070707_100000156 3300005468 Bacteria 66058
34 Ga0070707_100012686 3300005468 Bacteria 7870
35 Ga0070707_100317308 3300005468 Bacteria 1514
36 Ga0070698_100320436 3300005471 Bacteria 1481
37 Ga0070699_100036469 3300005518 Unclassified 4254
38 Ga0070699_100126025 3300005518 Bacteria 2254
39 Ga0070679_100028943 3300005530 Bacteria 5464
40 Ga0070679_100051922 3300005530 Bacteria 4084
41 Ga0070679_100052500 3300005530 Bacteria 4059
42 Ga0070679_100159504 3300005530 Bacteria 2230
43 Ga0070697_100019620 3300005536 Bacteria 5341
44 Ga0068853_100115550 3300005539 Bacteria 2388
45 Ga0070672_100000717 3300005543 Bacteria 19644
46 Ga0070696_100090420 3300005546 Bacteria 2178
47 Ga0070704_100052863 3300005549 Bacteria 2868
48 Ga0068855_100003170 3300005563 Bacteria 20133
49 Ga0068855_100015240 3300005563 Bacteria 9255
50 Ga0068855_100032897 3300005563 Bacteria 6191
51 Ga0068855_100269684 3300005563 Bacteria 1893
52 Ga0068857_100187523 3300005577 Bacteria 1883
53 Ga0068854_100050275 3300005578 Bacteria 2982
54 Ga0068856_100113828 3300005614 Bacteria 2704
55 Ga0070702_100001732 3300005615 Bacteria 9067
56 Ga0068852_100007066 3300005616 Bacteria 8176
57 Ga0068852_100064520 3300005616 Unclassified 3193
58 Ga0068859_100053817 3300005617 Bacteria 4048
59 Ga0068864_100000081 3300005618 Bacteria 101891
60 Ga0068861_100084263 3300005719 Bacteria 2495
61 Ga0068861_100246488 3300005719 Bacteria 1522
62 Ga0068858_100001725 3300005842 Bacteria 22341
63 Ga0068858_100009947 3300005842 Bacteria 9035
64 Ga0068858_100017308 3300005842 Bacteria 6761
65 Ga0068860_100004719 3300005843 Bacteria 13904
66 Ga0068860_100140462 3300005843 Bacteria 2321
67 Ga0068860_100276233 3300005843 Bacteria 1641
68 Ga0068862_100037633 3300005844 Bacteria 4101
69 Ga0070717_10090957 3300006028 Bacteria 2576
70 Ga0070712_100038607 3300006175 Bacteria 3264
71 Ga0097621_100044181 3300006237 Bacteria 3595
72 Ga0068871_100023868 3300006358 Bacteria 4738
73 Ga0075428_100026351 3300006844 Bacteria 6435
74 Ga0075430_100060974 3300006846 Bacteria 3170
75 Ga0075430_100063070 3300006846 Bacteria 3113
76 Ga0075431_100074040 3300006847 Bacteria 3514
77 Ga0075431_100119501 3300006847 Unclassified 2719
78 Ga0075434_100121165 3300006871 Bacteria 2631
79 Ga0075429_100001305 3300006880 Bacteria 20315
80 Ga0075429_100037258 3300006880 Bacteria 4234
81 Ga0075429_100097590 3300006880 Bacteria 2563
82 Ga0097620_100053817 3300006931 Bacteria 4048
83 Ga0105240_10025561 3300009093 Bacteria 7756
84 Ga0105240_10028474 3300009093 Bacteria 7297
85 Ga0105240_10032295 3300009093 Bacteria 6780
86 Ga0105240_10032389 3300009093 Bacteria 6768
87 Ga0111539_10043159 3300009094 Bacteria 5407
88 Ga0111539_10043911 3300009094 Bacteria 5357
89 Ga0111539_10047748 3300009094 Bacteria 5116
90 Ga0111539_10123213 3300009094 Bacteria 3038
91 Ga0105245_10003183 3300009098 Bacteria 14676
92 Ga0105245_10006420 3300009098 Bacteria 10351
93 Ga0105245_10010890 3300009098 Bacteria 7909
94 Ga0114129_10020219 3300009147 Bacteria 9473
95 Ga0114129_10080354 3300009147 Bacteria 4532
96 Ga0114129_10135789 3300009147 Bacteria 3375
97 Ga0114129_10289058 3300009147 Bacteria 2188
98 Ga0114129_10466268 3300009147 Bacteria 1655
99 Ga0105243_10027364 3300009148 Bacteria 4369
100 Ga0105241_10010671 3300009174 Bacteria 6738
101 Ga0105241_10145112 3300009174 Bacteria 1936
102 Ga0105242_10004965 3300009176 Bacteria 10291
103 Ga0105248_10020053 3300009177 Bacteria 7404
104 Ga0105237_10060524 3300009545 Bacteria 3788
105 Ga0105237_10104628 3300009545 Bacteria 2822
106 Ga0105238_10047219 3300009551 Bacteria 4344
107 Ga0105238_10084873 3300009551 Bacteria 3156
108 Ga0105238_10131686 3300009551 Bacteria 2479
109 Ga0105239_10028472 3300010375 Bacteria 6145
110 Ga0105239_10335800 3300010375 Bacteria 1705
111 Ga0157371_10032481 3300013102 Bacteria 3755
112 Ga0157370_10032110 3300013104 Bacteria 5130
113 Ga0157369_10014054 3300013105 Bacteria 9043
114 Ga0157369_10136622 3300013105 Bacteria 2595
115 Ga0157369_10319951 3300013105 Bacteria 1613
116 Ga0157374_10000679 3300013296 Bacteria 29982
117 Ga0163162_10014034 3300013306 Bacteria 7829
118 Ga0157372_10017744 3300013307 Bacteria 7640
119 Ga0157372_10029385 3300013307 Bacteria 6001
120 Ga0157372_10041384 3300013307 Bacteria 5095
121 Ga0157375_10000002 3300013308 Bacteria 495826
122 Ga0163163_10015787 3300014325 Bacteria 6994
123 Ga0163163_10044029 3300014325 Bacteria 4377
124 Ga0157380_10050630 3300014326 Bacteria 3282
125 Ga0157376_10062274 3300014969 Bacteria 3139
126 Ga0197907_11392416 3300020069 Bacteria 1720
127 Ga0206349_1283322 3300020075 Bacteria 3787
128 Ga0206349_1674501 3300020075 Bacteria 1683
129 Ga0206350_10166461 3300020080 Bacteria 1780
130 Ga0213876_10000137 3300021384 Bacteria 79910
131 Ga0213876_10000385 3300021384 Bacteria 37341
132 Ga0213875_10000061 3300021388 Bacteria 133623
133 Ga0213875_10008018 3300021388 Bacteria 5425
134 Ga0224712_10015269 3300022467 Bacteria 2495
135 Ga0207645_10002564 3300025907 Bacteria 14183
136 Ga0207705_10074156 3300025909 Bacteria 2470
137 Ga0207684_10090806 3300025910 Bacteria 2603
138 Ga0207654_10000749 3300025911 Bacteria 17977
139 Ga0207654_10026973 3300025911 Bacteria 3117
140 Ga0207707_10002302 3300025912 Bacteria 17210
141 Ga0207707_10011065 3300025912 Bacteria 7847
142 Ga0207707_10084409 3300025912 Unclassified 2774
143 Ga0207695_10007802 3300025913 Bacteria 13545
144 Ga0207695_10011113 3300025913 Bacteria 10930
145 Ga0207671_10126806 3300025914 Bacteria 1956
146 Ga0207657_10001842 3300025919 Bacteria 22914
147 Ga0207657_10033948 3300025919 Bacteria 4594
148 Ga0207649_10051871 3300025920 Bacteria 2542
149 Ga0207652_10034802 3300025921 Bacteria 4247
150 Ga0207646_10000251 3300025922 Bacteria 72761
151 Ga0207646_10076850 3300025922 Bacteria 2984
152 Ga0207646_10090110 3300025922 Bacteria 2745
153 Ga0207694_10047209 3300025924 Bacteria 3331
154 Ga0207650_10078228 3300025925 Bacteria 2502
155 Ga0207650_10147007 3300025925 Bacteria 1857
156 Ga0207687_10001245 3300025927 Bacteria 17433
157 Ga0207687_10004269 3300025927 Bacteria 9557
158 Ga0207664_10181516 3300025929 Bacteria 1807
159 Ga0207706_10000583 3300025933 Bacteria 38862
160 Ga0207706_10057603 3300025933 Bacteria 3423
161 Ga0207670_10000212 3300025936 Bacteria 38054
162 Ga0207691_10000235 3300025940 Bacteria 54039
163 Ga0207691_10028720 3300025940 Bacteria 5205
164 Ga0207711_10004012 3300025941 Bacteria 12638
165 Ga0207711_10139423 3300025941 Bacteria 2181
166 Ga0207689_10276087 3300025942 Bacteria 1391
167 Ga0207679_10012380 3300025945 Bacteria 5563
168 Ga0207679_10062945 3300025945 Bacteria 2767
169 Ga0207667_10024376 3300025949 Bacteria 6643
170 Ga0207640_10118556 3300025981 Bacteria 1891
171 Ga0207677_10018977 3300026023 Bacteria 4142
172 Ga0207703_10000258 3300026035 Bacteria 59679
173 Ga0207639_10089128 3300026041 Bacteria 2464
174 Ga0207708_10002973 3300026075 Bacteria 12494
175 Ga0207702_10054134 3300026078 Bacteria 3399
176 Ga0207702_10119449 3300026078 Bacteria 2357
177 Ga0207648_10019664 3300026089 Bacteria 6095
178 Ga0207648_10077110 3300026089 Bacteria 2905
179 Ga0207676_10000020 3300026095 Bacteria 301541
180 Ga0207675_100011005 3300026118 Bacteria 8474
181 Ga0207698_10088165 3300026142 Bacteria 2530
182 Ga0207698_10093915 3300026142 Bacteria 2464
183 Ga0207428_10058080 3300027907 Bacteria 3071
184 Ga0268265_10096480 3300028380 Bacteria 2376
185 Ga0268264_10004805 3300028381 Bacteria 11460
186 Ga0268264_10244719 3300028381 Bacteria 1663
187 Ga0307513_10000010 3300031456 Bacteria 360812
188 Ga0307408_100023537 3300031548 Bacteria 4197
189 Ga0307408_100038265 3300031548 Bacteria 3383
190 Ga0265313_10008887 3300031595 Bacteria 6607
191 Ga0307405_10147912 3300031731 Bacteria 1648
192 Ga0307413_10004314 3300031824 Bacteria 6170
193 Ga0307413_10012030 3300031824 Bacteria 4288
194 Ga0307410_10000835 3300031852 Bacteria 13093
195 Ga0307410_10088487 3300031852 Bacteria 2193
196 Ga0307410_10089528 3300031852 Bacteria 2181
197 Ga0307410_10095192 3300031852 Bacteria 2123
198 Ga0307406_10031628 3300031901 Bacteria 3224
199 Ga0307406_10043321 3300031901 Bacteria 2814
200 Ga0307412_10029234 3300031911 Unclassified 3458
201 Ga0307409_100000085 3300031995 Bacteria 33599
202 Ga0307409_100110756 3300031995 Bacteria 2302
203 Ga0307409_100165076 3300031995 Bacteria 1942
204 Ga0307416_100001971 3300032002 Bacteria 11511
205 Ga0307416_100005196 3300032002 Bacteria 7958
206 Ga0307416_100021194 3300032002 Bacteria 4660
207 Ga0307416_100073712 3300032002 Bacteria 2848
208 Ga0307416_100107007 3300032002 Bacteria 2453
209 Ga0307416_100147352 3300032002 Bacteria 2152
210 Ga0307416_100281047 3300032002 Bacteria 1641
211 Ga0307416_100336270 3300032002 Bacteria 1520
212 Ga0307414_10017710 3300032004 Bacteria 4366
213 Ga0307414_10058165 3300032004 Bacteria 2722
214 Ga0307411_10016480 3300032005 Bacteria 4184
215 Ga0307411_10016876 3300032005 Bacteria 4142
216 Ga0307411_10217107 3300032005 Bacteria 1481
217 Ga0307415_100000604 3300032126 Bacteria 15695
218 Ga0307415_100005283 3300032126 Bacteria 6839
219 Ga0307415_100008344 3300032126 Bacteria 5732
220 Ga0307415_100017173 3300032126 Bacteria 4332
221 Ga0307415_100147970 3300032126 Bacteria 1804
222 Ga0373934_0004848 3300035086 Bacteria 4981
223 Ga0373956_0015225 3300035119 Unclassified 3218
224 Ga0373955_0001929 3300035172 Bacteria 8951
225 Ga0373955_0003138 3300035172 Bacteria 7231
226 Ga0373933_0000423 3300035724 Bacteria 26670
227 Ga0373937_0000125 3300036401 Bacteria 73819
228 Ga0373937_0018182 3300036401 Bacteria 6273
229 Ga0373925_0012906 3300037068 Bacteria 6050
230 Ga0395899_0000127 3300037312 Bacteria 119435
231 Ga0395899_0002226 3300037312 Bacteria 15895
232 Ga0395900_0008029 3300037418 Bacteria 10862
233 Ga0395900_0008408 3300037418 Bacteria 10619
234 Ga0395900_0023488 3300037418 Bacteria 6310
235 Ga0395900_0161625 3300037418 Bacteria 2284
236 Ga0395898_0033248 3300037466 Bacteria 5148
237 Ga0395898_0155808 3300037466 Bacteria 2185
238 Ga0395905_0000395 3300037471 Bacteria 61787
239 Ga0395905_0033456 3300037471 Unclassified 4829
240 Ga0395905_0092874 3300037471 Bacteria 2830
241 Ga0395905_0124974 3300037471 Bacteria 2419
242 Ga0395905_0293783 3300037471 Bacteria 1512
243 Ga0395905_0317983 3300037471 Bacteria 1446
244 Ga0436364_0490455 3300037853 Bacteria 45285
245 Ga0436364_1449597 3300037853 Bacteria 171227
246 Ga0395901_0001270 3300038443 Bacteria 26753
247 Ga0395901_0043924 3300038443 Bacteria 4635
248 Ga0395901_0045279 3300038443 Bacteria 4565
249 Ga0436365_0453322 3300039437 Bacteria 114543
250 Ga0436365_0928267 3300039437 Bacteria 13852
251 Ga0436365_1885657 3300039437 Bacteria 103056
252 Ga0450890_002579 3300042127 Bacteria 2476
253 Ga0450897_001191 3300042128 Bacteria 1711
254 Ga0439446_0011744 3300042156 Bacteria 2383
255 Ga0453683_0009739 3300044673 Bacteria 6405
256 Ga0466966_0038249 3300044684 Bacteria 3092
257 Ga0451576_0000109 3300045051 Bacteria 210549
258 Ga0451576_0002619 3300045051 Bacteria 26328
259 Ga0466967_0008906 3300045976 Bacteria 7405
260 Ga0495617_000052 3300046452 Bacteria 104195
261 Ga0495603_0001853 3300046455 Bacteria 12470
262 Ga0495590_0001174 3300046457 Bacteria 11467
263 Ga0495591_006691 3300046458 Bacteria 5035
264 Ga0495638_0002074 3300046460 Bacteria 17022
265 Ga0495651_0001221 3300046462 Bacteria 19849
266 Ga0495653_0019595 3300046463 Bacteria 5486
267 Ga0495580_0082404 3300046472 Bacteria 2242
268 Ga0495580_0163522 3300046472 Bacteria 1540
269 Ga0495582_0008994 3300046473 Bacteria 5512
270 Ga0495582_0038866 3300046473 Bacteria 2619
271 Ga0495584_0000021 3300046491 Bacteria 130377
272 Ga0495584_0000271 3300046491 Bacteria 36789
273 Ga0495584_0011951 3300046491 Bacteria 4439
274 Ga0495584_0017894 3300046491 Bacteria 3605
275 Ga0495585_0000005 3300046492 Bacteria 328103
276 Ga0495585_0000049 3300046492 Bacteria 119546
277 Ga0495585_0000465 3300046492 Bacteria 38766
278 Ga0495585_0000608 3300046492 Bacteria 33524
279 Ga0495585_0001368 3300046492 Bacteria 19305
280 Ga0495585_0006347 3300046492 Bacteria 7342
281 Ga0495585_0007535 3300046492 Bacteria 6657
282 Ga0495585_0010567 3300046492 Bacteria 5491
283 Ga0495585_0044380 3300046492 Bacteria 2483
284 Ga0495585_0095723 3300046492 Bacteria 1594
285 Ga0495594_0000622 3300046499 Bacteria 18245
286 Ga0495594_0027106 3300046499 Bacteria 3086
287 Ga0495594_0065722 3300046499 Bacteria 2011
288 Ga0495596_0000013 3300046500 Bacteria 125228
289 Ga0495583_0000189 3300046506 Bacteria 103518
290 Ga0495606_0002184 3300046507 Bacteria 23486
291 Ga0495616_0000646 3300046513 Bacteria 25901
292 Ga0495616_0012439 3300046513 Bacteria 4832
293 Ga0495616_0074174 3300046513 Bacteria 1640
294 Ga0495620_0001423 3300046515 Bacteria 14354
295 Ga0495630_0008312 3300046517 Bacteria 7451
296 Ga0495631_0011735 3300046518 Bacteria 4299
297 Ga0495643_0038358 3300046522 Bacteria 2624
298 Ga0495644_0042819 3300046523 Bacteria 1705
299 Ga0495648_0000033 3300046524 Bacteria 199184
300 Ga0495666_0003229 3300046526 Bacteria 8212
301 Ga0495666_0013468 3300046526 Bacteria 4079
302 Ga0495642_0002909 3300046528 Bacteria 6824
303 Ga0495642_0006722 3300046528 Bacteria 4408
304 Ga0495642_0012263 3300046528 Bacteria 3303
305 Ga0495652_0018624 3300046529 Bacteria 6187
306 Ga0495586_0056057 3300046535 Bacteria 2136
307 Ga0495587_0000691 3300046536 Bacteria 22630
308 Ga0495587_0069283 3300046536 Unclassified 2054
309 Ga0495609_0011762 3300046538 Bacteria 4161
310 Ga0495609_0018551 3300046538 Bacteria 3223
311 Ga0495621_0002362 3300046539 Bacteria 5075
312 Ga0495597_0000199 3300046542 Bacteria 55011
313 Ga0495597_0015635 3300046542 Bacteria 3591
314 Ga0495597_0062988 3300046542 Bacteria 1612
315 Ga0495622_0006305 3300046557 Bacteria 5508
316 Ga0495633_0000893 3300046558 Bacteria 25507
317 Ga0495633_0006093 3300046558 Bacteria 7223
318 Ga0495633_0006324 3300046558 Bacteria 7049
319 Ga0495633_0037026 3300046558 Bacteria 2336
320 Ga0495668_0001839 3300046616 Bacteria 19134
321 Ga0495634_0006587 3300046642 Bacteria 8809
322 Ga0495625_0035445 3300046660 Bacteria 3678
323 Ga0495661_0000430 3300046665 Bacteria 44306
324 Ga0495661_0006847 3300046665 Bacteria 7979
325 Ga0495661_0023314 3300046665 Bacteria 4018
326 Ga0495588_0006444 3300046674 Bacteria 5286
327 Ga0495623_0004800 3300046679 Bacteria 8878
328 Ga0495670_0000693 3300046691 Bacteria 16033
329 Ga0495670_0003319 3300046691 Bacteria 7933
330 Ga0495670_0003883 3300046691 Bacteria 7342
331 Ga0495670_0005862 3300046691 Bacteria 6022
332 Ga0495670_0028884 3300046691 Bacteria 2750
333 Ga0495670_0099834 3300046691 Bacteria 1494
334 Ga0495589_0000628 3300046794 Bacteria 23234
335 Ga0495660_0009570 3300046810 Bacteria 5650
336 Ga0495581_0028051 3300047315 Bacteria 3263
337 Ga0495581_0160862 3300047315 Bacteria 1312
338 Ga0495604_0008021 3300047317 Bacteria 8367
339 Ga0495604_0008511 3300047317 Bacteria 8101
340 Ga0495636_0000198 3300047318 Bacteria 23610
341 Ga0495676_0014446 3300047321 Bacteria 7064
342 Ga0495676_0026247 3300047321 Bacteria 5017
343 Ga0495676_0114977 3300047321 Bacteria 1968
344 Ga0495680_0135907 3300047322 Bacteria 1803
345 Ga0495683_0000072 3300047323 Bacteria 104027
346 Ga0495675_0000660 3300047444 Bacteria 21758
347 Ga0495675_0018142 3300047444 Bacteria 4463
348 Ga0495677_0002346 3300047445 Bacteria 7444
349 Ga0495677_0014391 3300047445 Bacteria 2880
350 Ga0495681_0006169 3300047470 Bacteria 7914
351 Ga0495681_0027674 3300047470 Bacteria 2928
352 Ga0495681_0029648 3300047470 Bacteria 2798
353 Ga0495593_0005307 3300047673 Bacteria 7615
354 Ga0495602_0000402 3300048088 Bacteria 40515
355 Ga0495602_0003261 3300048088 Bacteria 16756
356 Ga0495626_0000004 3300048091 Bacteria 356599
357 Ga0495626_0012156 3300048091 Bacteria 4526
358 Ga0495626_0032114 3300048091 Bacteria 2523
359 Ga0496115_0001043 3300048918 Bacteria 20116
360 Ga0496115_0017255 3300048918 Bacteria 5513
361 Ga0501292_005215 3300049515 Bacteria 1805
362 Ga0501031_0123015 3300049568 Bacteria 1694
363 Ga0501031_0224923 3300049568 Bacteria 1222
364 Ga0501034_0000245 3300049571 Bacteria 100221
365 Ga0501034_0000457 3300049571 Bacteria 67431
366 Ga0501037_0000669 3300049573 Bacteria 26272
367 Ga0501038_0000578 3300049574 Bacteria 32467
368 Ga0501038_0156227 3300049574 Bacteria 1857
369 Ga0501043_0000848 3300049579 Bacteria 27095
370 Ga0501043_0066226 3300049579 Bacteria 2837
371 Ga0501043_0191325 3300049579 Bacteria 1591
372 Ga0501046_0000130 3300049580 Bacteria 80649
373 Ga0501048_0002649 3300049582 Bacteria 13678
374 Ga0501067_0021666 3300049583 Bacteria 3556
375 Ga0501073_0097259 3300049589 Bacteria 2045
376 Ga0501075_0074305 3300049591 Bacteria 2571
377 Ga0501076_0110027 3300049592 Bacteria 2227
378 Ga0501202_008098 3300049652 Bacteria 1910
379 Ga0501233_012629 3300049668 Bacteria 1699
380 Ga0501235_019886 3300049669 Bacteria 1490
381 Ga0501239_002832 3300049672 Bacteria 1610
382 Ga0501247_001769 3300049677 Bacteria 2155
383 Ga0501249_002575 3300049679 Bacteria 3653
384 Ga0501257_006850 3300049686 Bacteria 2537
385 Ga0501257_010685 3300049686 Bacteria 2088
386 Ga0501225_0023511 3300049705 Bacteria 1698
387 Ga0501234_006474 3300049707 Bacteria 1832
388 Ga0501080_0023279 3300049742 Bacteria 5743
389 Ga0501083_0000030 3300049744 Bacteria 107273
390 Ga0501262_003400 3300049759 Bacteria 1823
391 Ga0501268_000251 3300049765 Bacteria 5419
392 Ga0501268_006629 3300049765 Bacteria 1707
393 Ga0501035_0108309 3300049822 Bacteria 2436
394 Ga0501035_0169741 3300049822 Bacteria 1885
395 Ga0501044_0013043 3300049823 Bacteria 8992
396 Ga0501044_0032410 3300049823 Bacteria 5494
397 Ga0501044_0044689 3300049823 Bacteria 4595
398 nmdc:mga05p37_1001_c1 3300050507 Bacteria 32203
399 nmdc:mga05p37_41299_c1 3300050507 Bacteria 5663
400 nmdc:mga05p37_94792_c1 3300050507 Bacteria 3677
401 nmdc:mga09592_208209_c1 3300050508 Bacteria 1694
402 nmdc:mga09592_27091_c1 3300050508 Bacteria 4754
403 nmdc:mga09592_6097_c1 3300050508 Bacteria 9821
404 nmdc:mga09592_90211_c1 3300050508 Bacteria 2618
405 nmdc:mga0qj67_1415_c1 3300050509 Bacteria 16784
406 nmdc:mga0qj67_74859_c1 3300050509 Bacteria 2705
407 nmdc:mga06r32_24527_c1 3300050510 Bacteria 5600
408 nmdc:mga08y16_50438_c1 3300050511 Bacteria 4355
409 nmdc:mga08y16_52235_c1 3300050511 Bacteria 4276
410 nmdc:mga08y16_75220_c1 3300050511 Bacteria 3521
411 nmdc:mga08y16_80675_c1 3300050511 Bacteria 3392
412 nmdc:mga0a205_52421_c1 3300050515 Bacteria 3937
413 Ga0500645_006689 3300053730 Bacteria 4088
414 Ga0501084_0072091 3300054114 Bacteria 2893
415 Ga0590071_000827 3300059421 Bacteria 8634
416 Ga0590071_003563 3300059421 Bacteria 3825
417 Ga0590071_009059 3300059421 Bacteria 2340
418 2831426172 2831426010 Bacteria 8662725
419 2848700897 2848694841 Bacteria 9205737
420 2849667926 2849660919 Bacteria 8251853
421 Ga0070683_100287431
422 JGI25406J46586_10001388
423 rootH1_10011618
424 rootH2_10045810
425 rootL2_10022609
426 rootL2_10068702
427 rootH1_10018536
428 Ga0007416J51690_1000778
429 Ga0070658_10009310
430 Ga0070676_10051739
431 Ga0070682_100039556
432 Ga0068868_100007054
433 Ga0070660_100017149
434 Ga0070660_100040097
435 Ga0070689_100001063
436 Ga0070691_10033854
437 Ga0070714_100007270
438 Ga0070714_100019932
439 Ga0070714_100211430
440 Ga0070705_100095678
441 Ga0070700_100020785
442 Ga0070694_100046127
443 Ga0070708_100094627
444 Ga0070708_100149563
445 Ga0070678_100116057
446 Ga0070681_10007340
447 Ga0070681_10007341
448 Ga0070681_10013537
449 Ga0070681_10146525
450 Ga0068867_100067826
451 Ga0070706_100045800
452 Ga0070706_100078449
453 Ga0070707_100000156
454 Ga0070707_100012686
455 Ga0070707_100317308
456 Ga0070698_100320436
457 Ga0070699_100036469
458 Ga0070699_100126025
459 Ga0070679_100028943
460 Ga0070679_100051922
461 Ga0070679_100052500
462 Ga0070679_100159504
463 Ga0070697_100019620
464 Ga0068853_100115550
465 Ga0070672_100000717
466 Ga0070696_100090420
467 Ga0070704_100052863
468 Ga0068855_100003170
469 Ga0068855_100015240
470 Ga0068855_100032897
471 Ga0068855_100269684
472 Ga0068857_100187523
473 Ga0068854_100050275
474 Ga0068856_100113828
475 Ga0070702_100001732
476 Ga0068852_100007066
477 Ga0068852_100064520
478 Ga0068859_100053817
479 Ga0068864_100000081
480 Ga0068861_100084263
481 Ga0068861_100246488
482 Ga0068858_100001725
483 Ga0068858_100009947
484 Ga0068858_100017308
485 Ga0068860_100004719
486 Ga0068860_100140462
487 Ga0068860_100276233
488 Ga0068862_100037633
489 Ga0070717_10090957
490 Ga0070712_100038607
491 Ga0097621_100044181
492 Ga0068871_100023868
493 Ga0075428_100026351
494 Ga0075430_100060974
495 Ga0075430_100063070
496 Ga0075431_100074040
497 Ga0075431_100119501
498 Ga0075434_100121165
499 Ga0075429_100001305
500 Ga0075429_100037258
501 Ga0075429_100097590
502 Ga0097620_100053817
503 Ga0105240_10025561
504 Ga0105240_10028474
505 Ga0105240_10032295
506 Ga0105240_10032389
507 Ga0111539_10043159
508 Ga0111539_10043911
509 Ga0111539_10047748
510 Ga0111539_10123213
511 Ga0105245_10003183
512 Ga0105245_10006420
513 Ga0105245_10010890
514 Ga0114129_10020219
515 Ga0114129_10080354
516 Ga0114129_10135789
517 Ga0114129_10289058
518 Ga0114129_10466268
519 Ga0105243_10027364
520 Ga0105241_10010671
521 Ga0105241_10145112
522 Ga0105242_10004965
523 Ga0105248_10020053
524 Ga0105237_10060524
525 Ga0105237_10104628
526 Ga0105238_10047219
527 Ga0105238_10084873
528 Ga0105238_10131686
529 Ga0105239_10028472
530 Ga0105239_10335800
531 Ga0157371_10032481
532 Ga0157370_10032110
533 Ga0157369_10014054
534 Ga0157369_10136622
535 Ga0157369_10319951
536 Ga0157374_10000679
537 Ga0163162_10014034
538 Ga0157372_10017744
539 Ga0157372_10029385
540 Ga0157372_10041384
541 Ga0157375_10000002
542 Ga0163163_10015787
543 Ga0163163_10044029
544 Ga0157380_10050630
545 Ga0157376_10062274
546 Ga0197907_11392416
547 Ga0206349_1283322
548 Ga0206349_1674501
549 Ga0206350_10166461
550 Ga0213876_10000137
551 Ga0213876_10000385
552 Ga0213875_10000061
553 Ga0213875_10008018
554 Ga0224712_10015269
555 Ga0207645_10002564
556 Ga0207705_10074156
557 Ga0207684_10090806
558 Ga0207654_10000749
559 Ga0207654_10026973
560 Ga0207707_10002302
561 Ga0207707_10011065
562 Ga0207707_10084409
563 Ga0207695_10007802
564 Ga0207695_10011113
565 Ga0207671_10126806
566 Ga0207657_10001842
567 Ga0207657_10033948
568 Ga0207649_10051871
569 Ga0207652_10034802
570 Ga0207646_10000251
571 Ga0207646_10076850
572 Ga0207646_10090110
573 Ga0207694_10047209
574 Ga0207650_10078228
575 Ga0207650_10147007
576 Ga0207687_10001245
577 Ga0207687_10004269
578 Ga0207664_10181516
579 Ga0207706_10000583
580 Ga0207706_10057603
581 Ga0207670_10000212
582 Ga0207691_10000235
583 Ga0207691_10028720
584 Ga0207711_10004012
585 Ga0207711_10139423
586 Ga0207689_10276087
587 Ga0207679_10012380
588 Ga0207679_10062945
589 Ga0207667_10024376
590 Ga0207640_10118556
591 Ga0207677_10018977
592 Ga0207703_10000258
593 Ga0207639_10089128
594 Ga0207708_10002973
595 Ga0207702_10054134
596 Ga0207702_10119449
597 Ga0207648_10019664
598 Ga0207648_10077110
599 Ga0207676_10000020
600 Ga0207675_100011005
601 Ga0207698_10088165
602 Ga0207698_10093915
603 Ga0207428_10058080
604 Ga0268265_10096480
605 Ga0268264_10004805
606 Ga0268264_10244719
607 Ga0307513_10000010
608 Ga0307408_100023537
609 Ga0307408_100038265
610 Ga0265313_10008887
611 Ga0307405_10147912
612 Ga0307413_10004314
613 Ga0307413_10012030
614 Ga0307410_10000835
615 Ga0307410_10088487
616 Ga0307410_10089528
617 Ga0307410_10095192
618 Ga0307406_10031628
619 Ga0307406_10043321
620 Ga0307412_10029234
621 Ga0307409_100000085
622 Ga0307409_100110756
623 Ga0307409_100165076
624 Ga0307416_100001971
625 Ga0307416_100005196
626 Ga0307416_100021194
627 Ga0307416_100073712
628 Ga0307416_100107007
629 Ga0307416_100147352
630 Ga0307416_100281047
631 Ga0307416_100336270
632 Ga0307414_10017710
633 Ga0307414_10058165
634 Ga0307411_10016480
635 Ga0307411_10016876
636 Ga0307411_10217107
637 Ga0307415_100000604
638 Ga0307415_100005283
639 Ga0307415_100008344
640 Ga0307415_100017173
641 Ga0307415_100147970
642 Ga0373934_0004848
643 Ga0373956_0015225
644 Ga0373955_0001929
645 Ga0373955_0003138
646 Ga0373933_0000423
647 Ga0373937_0000125
648 Ga0373937_0018182
649 Ga0373925_0012906
650 Ga0395899_0000127
651 Ga0395899_0002226
652 Ga0395900_0008029
653 Ga0395900_0008408
654 Ga0395900_0023488
655 Ga0395900_0161625
656 Ga0395898_0033248
657 Ga0395898_0155808
658 Ga0395905_0000395
659 Ga0395905_0033456
660 Ga0395905_0092874
661 Ga0395905_0124974
662 Ga0395905_0293783
663 Ga0395905_0317983
664 Ga0436364_0490455
665 Ga0436364_1449597
666 Ga0395901_0001270
667 Ga0395901_0043924
668 Ga0395901_0045279
669 Ga0436365_0453322
670 Ga0436365_0928267
671 Ga0436365_1885657
672 Ga0450890_002579
673 Ga0450897_001191
674 Ga0439446_0011744
675 Ga0453683_0009739
676 Ga0466966_0038249
677 Ga0451576_0000109
678 Ga0451576_0002619
679 Ga0466967_0008906
680 Ga0495617_000052
681 Ga0495603_0001853
682 Ga0495590_0001174
683 Ga0495591_006691
684 Ga0495638_0002074
685 Ga0495651_0001221
686 Ga0495653_0019595
687 Ga0495580_0082404
688 Ga0495580_0163522
689 Ga0495582_0008994
690 Ga0495582_0038866
691 Ga0495584_0000021
692 Ga0495584_0000271
693 Ga0495584_0011951
694 Ga0495584_0017894
695 Ga0495585_0000005
696 Ga0495585_0000049
697 Ga0495585_0000465
698 Ga0495585_0000608
699 Ga0495585_0001368
700 Ga0495585_0006347
701 Ga0495585_0007535
702 Ga0495585_0010567
703 Ga0495585_0044380
704 Ga0495585_0095723
705 Ga0495594_0000622
706 Ga0495594_0027106
707 Ga0495594_0065722
708 Ga0495596_0000013
709 Ga0495583_0000189
710 Ga0495606_0002184
711 Ga0495616_0000646
712 Ga0495616_0012439
713 Ga0495616_0074174
714 Ga0495620_0001423
715 Ga0495630_0008312
716 Ga0495631_0011735
717 Ga0495643_0038358
718 Ga0495644_0042819
719 Ga0495648_0000033
720 Ga0495666_0003229
721 Ga0495666_0013468
722 Ga0495642_0002909
723 Ga0495642_0006722
724 Ga0495642_0012263
725 Ga0495652_0018624
726 Ga0495586_0056057
727 Ga0495587_0000691
728 Ga0495587_0069283
729 Ga0495609_0011762
730 Ga0495609_0018551
731 Ga0495621_0002362
732 Ga0495597_0000199
733 Ga0495597_0015635
734 Ga0495597_0062988
735 Ga0495622_0006305
736 Ga0495633_0000893
737 Ga0495633_0006093
738 Ga0495633_0006324
739 Ga0495633_0037026
740 Ga0495668_0001839
741 Ga0495634_0006587
742 Ga0495625_0035445
743 Ga0495661_0000430
744 Ga0495661_0006847
745 Ga0495661_0023314
746 Ga0495588_0006444
747 Ga0495623_0004800
748 Ga0495670_0000693
749 Ga0495670_0003319
750 Ga0495670_0003883
751 Ga0495670_0005862
752 Ga0495670_0028884
753 Ga0495670_0099834
754 Ga0495589_0000628
755 Ga0495660_0009570
756 Ga0495581_0028051
757 Ga0495581_0160862
758 Ga0495604_0008021
759 Ga0495604_0008511
760 Ga0495636_0000198
761 Ga0495676_0014446
762 Ga0495676_0026247
763 Ga0495676_0114977
764 Ga0495680_0135907
765 Ga0495683_0000072
766 Ga0495675_0000660
767 Ga0495675_0018142
768 Ga0495677_0002346
769 Ga0495677_0014391
770 Ga0495681_0006169
771 Ga0495681_0027674
772 Ga0495681_0029648
773 Ga0495593_0005307
774 Ga0495602_0000402
775 Ga0495602_0003261
776 Ga0495626_0000004
777 Ga0495626_0012156
778 Ga0495626_0032114
779 Ga0496115_0001043
780 Ga0496115_0017255
781 Ga0501292_005215
782 Ga0501031_0123015
783 Ga0501031_0224923
784 Ga0501034_0000245
785 Ga0501034_0000457
786 Ga0501037_0000669
787 Ga0501038_0000578
788 Ga0501038_0156227
789 Ga0501043_0000848
790 Ga0501043_0066226
791 Ga0501043_0191325
792 Ga0501046_0000130
793 Ga0501048_0002649
794 Ga0501067_0021666
795 Ga0501073_0097259
796 Ga0501075_0074305
797 Ga0501076_0110027
798 Ga0501202_008098
799 Ga0501233_012629
800 Ga0501235_019886
801 Ga0501239_002832
802 Ga0501247_001769
803 Ga0501249_002575
804 Ga0501257_006850
805 Ga0501257_010685
806 Ga0501225_0023511
807 Ga0501234_006474
808 Ga0501080_0023279
809 Ga0501083_0000030
810 Ga0501262_003400
811 Ga0501268_000251
812 Ga0501268_006629
813 Ga0501035_0108309
814 Ga0501035_0169741
815 Ga0501044_0013043
816 Ga0501044_0032410
817 Ga0501044_0044689
818 nmdc:mga05p37_1001_c1
819 nmdc:mga05p37_41299_c1
820 nmdc:mga05p37_94792_c1
821 nmdc:mga09592_208209_c1
822 nmdc:mga09592_27091_c1
823 nmdc:mga09592_6097_c1
824 nmdc:mga09592_90211_c1
825 nmdc:mga0qj67_1415_c1
826 nmdc:mga0qj67_74859_c1
827 nmdc:mga06r32_24527_c1
828 nmdc:mga08y16_50438_c1
829 nmdc:mga08y16_52235_c1
830 nmdc:mga08y16_75220_c1
831 nmdc:mga08y16_80675_c1
832 nmdc:mga0a205_52421_c1
833 Ga0500645_006689
834 Ga0501084_0072091
835 Ga0590071_000827
836 Ga0590071_003563
837 Ga0590071_009059
838 2831426172
839 2848700897
840 2849667926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05139

Erythro_esteras

Erythromycin esterase

75

446

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgm-assembly1.cif.gz_A crystal structure of succinoglycan biosynthesis protein at the resolution 1.7 a. northeast structural genomics consortium target bcr136. 0.872 1 420
2qgm-assembly1.cif.gz_A crystal structure of succinoglycan biosynthesis protein at the resolution 1.7 a. northeast structural genomics consortium target bcr136. 0.8575 1 420
2rad-assembly2.cif.gz_B crystal structure of the succinoglycan biosynthesis protein. northeast structural genomics consortium target bcr135 0.845 1 420
2rad-assembly2.cif.gz_B crystal structure of the succinoglycan biosynthesis protein. northeast structural genomics consortium target bcr135 0.8392 1 420
6xcq-assembly1.cif.gz_A erythromycin esterase erec, mutant h289n in its closed conformation 0.7159 14 416
ID Description Score Start End Superfamily
2radA01 Alpha Beta;3-Layer(aba) Sandwich;EreA/ChaN-like;EreA-like (biosynthetic domain) 0.7728 257 423 3.40.1660.10
2qgmA01 Alpha Beta;3-Layer(aba) Sandwich;EreA/ChaN-like;EreA-like (biosynthetic domain) 0.7584 258 418 3.40.1660.10
af_O43760_20_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6255 141 243 1.20.140.150
af_O55101_20_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6083 138 243 1.20.140.150
af_O54980_20_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6073 138 243 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A4Q5Z908-F1-model_v4 deleted 0.9851 3 327
AF-A0A431L0Y4-F1-model_v4 Erythromycin esterase family protein 0.9828 1 427 GO:0046677
AF-A0A6M3HUX6-F1-model_v4 Erythromycin esterase family protein 0.9804 2 424 GO:0046677
AF-A0A7W1LDD5-F1-model_v4 Erythromycin esterase family protein 0.978 3 241 GO:0046677
AF-A0A2V5UG26-F1-model_v4 Erythromycin esterase 0.9776 5 395 GO:0046677

Map