F439711

General Info

Members Datasets Scaffolds Average Seq Length
420 177 840 192

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100229076|Ga0068863_1002290762
Length 204
Sequence MKARSPACSIEPVCNLYQLEKSVDAVRRLFADLQIPLTFPEGIPNFQRRDVRISEQAPIIRWSRAGDGAELVERRWSWPAPGSTKPVFNLRSDGREFGKDRCLVLADSFYEFTAPDDPKQKKKDRWRFRPDGDFTIAGIVRADPQAGEAFTLLTVPPGADIAPYHNRQIALLRPPQWRGWLNGSVKSTELLTPCAEGSLHVEAA

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
177 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.24
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.48
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100229076 3300005841 Bacteria 1792
2 JGI24741J21665_1004246 3300001915 Bacteria 3215
3 JGI24740J21852_10008225 3300001979 Bacteria 4175
4 JGI24740J21852_10008480 3300001979 Bacteria 4095
5 JGI24740J21852_10030501 3300001979 Bacteria 1752
6 JGI24739J22299_10000237 3300001989 Bacteria 18648
7 JGI24739J22299_10013560 3300001989 Bacteria 2973
8 JGI24737J22298_10000061 3300001990 Bacteria 32526
9 JGI24743J22301_10005337 3300001991 Bacteria 2141
10 JGI24735J21928_10047659 3300002067 Bacteria 1242
11 JGI24738J21930_10001482 3300002075 Bacteria 6517
12 JGI24738J21930_10001721 3300002075 Bacteria 5983
13 JGI24742J22300_10008335 3300002244 Bacteria 1709
14 Ga0065707_10380065 3300005295 Bacteria 878
15 Ga0070658_10021013 3300005327 Bacteria 5229
16 Ga0070658_10095232 3300005327 Bacteria 2457
17 Ga0070658_10132185 3300005327 Bacteria 2080
18 Ga0070658_10179114 3300005327 Bacteria 1783
19 Ga0070676_10002544 3300005328 Bacteria 9375
20 Ga0070676_10259769 3300005328 Bacteria 1162
21 Ga0070676_10510361 3300005328 Bacteria 855
22 Ga0070683_100229011 3300005329 Bacteria 1767
23 Ga0070683_100433253 3300005329 Unclassified 1254
24 Ga0070690_100026968 3300005330 Bacteria 3549
25 Ga0070670_100035829 3300005331 Bacteria 4272
26 Ga0070670_100067083 3300005331 Bacteria 3079
27 Ga0070670_100242352 3300005331 Bacteria 1570
28 Ga0068869_100000493 3300005334 Bacteria 21956
29 Ga0068869_100438514 3300005334 Bacteria 1081
30 Ga0070680_100126173 3300005336 Bacteria 2138
31 Ga0070682_100123988 3300005337 Bacteria 1738
32 Ga0070682_100448296 3300005337 Bacteria 988
33 Ga0068868_100022988 3300005338 Bacteria 4714
34 Ga0068868_100638828 3300005338 Bacteria 947
35 Ga0070660_100003937 3300005339 Bacteria 10262
36 Ga0070660_100057073 3300005339 Bacteria 3023
37 Ga0070660_100411257 3300005339 Bacteria 1119
38 Ga0070687_100081607 3300005343 Bacteria 1766
39 Ga0070687_100124621 3300005343 Bacteria 1479
40 Ga0070661_100045371 3300005344 Bacteria 3213
41 Ga0070661_100097642 3300005344 Bacteria 2181
42 Ga0070661_100101304 3300005344 Bacteria 2142
43 Ga0070692_10014832 3300005345 Bacteria 3670
44 Ga0070692_10088412 3300005345 Bacteria 1681
45 Ga0070692_10194207 3300005345 Bacteria 1185
46 Ga0070668_100001945 3300005347 Bacteria 15069
47 Ga0070668_100006904 3300005347 Bacteria 8414
48 Ga0070669_100000532 3300005353 Bacteria 28333
49 Ga0070669_100062881 3300005353 Bacteria 2730
50 Ga0070669_100120043 3300005353 Bacteria 2004
51 Ga0070669_100320208 3300005353 Bacteria 1252
52 Ga0070675_100296822 3300005354 Bacteria 1423
53 Ga0070671_100051811 3300005355 Bacteria 3413
54 Ga0070671_100336012 3300005355 Bacteria 1288
55 Ga0070674_100041671 3300005356 Bacteria 3114
56 Ga0070673_100000058 3300005364 Bacteria 45772
57 Ga0070673_100019025 3300005364 Bacteria 4925
58 Ga0070673_100193414 3300005364 Bacteria 1748
59 Ga0070659_100006101 3300005366 Bacteria 8698
60 Ga0070659_100020021 3300005366 Bacteria 5080
61 Ga0070659_100144541 3300005366 Bacteria 1937
62 Ga0070659_100523117 3300005366 Unclassified 1013
63 Ga0070667_100004233 3300005367 Bacteria 12118
64 Ga0070667_100018187 3300005367 Bacteria 5827
65 Ga0070667_100095053 3300005367 Bacteria 2569
66 Ga0070667_100421304 3300005367 Bacteria 1217
67 Ga0070667_101009536 3300005367 Bacteria 776
68 Ga0070667_101009537 3300005367 Bacteria 776
69 Ga0070714_100084450 3300005435 Bacteria 2770
70 Ga0070714_100243716 3300005435 Bacteria 1660
71 Ga0070663_100059398 3300005455 Bacteria 2748
72 Ga0070663_100226339 3300005455 Bacteria 1471
73 Ga0070663_100258496 3300005455 Bacteria 1381
74 Ga0070663_100398374 3300005455 Bacteria 1125
75 Ga0070678_100101197 3300005456 Bacteria 2233
76 Ga0070662_100000280 3300005457 Bacteria 30084
77 Ga0070662_100199591 3300005457 Bacteria 1586
78 Ga0070662_100224547 3300005457 Bacteria 1500
79 Ga0070662_100471068 3300005457 Bacteria 1045
80 Ga0070681_10393736 3300005458 Bacteria 1296
81 Ga0068867_100001818 3300005459 Bacteria 14861
82 Ga0068867_100006658 3300005459 Bacteria 8168
83 Ga0068867_100016724 3300005459 Bacteria 5212
84 Ga0068867_100335530 3300005459 Bacteria 1257
85 Ga0070685_10490913 3300005466 Bacteria 867
86 Ga0070679_100141173 3300005530 Bacteria 2388
87 Ga0070679_100937335 3300005530 Bacteria 809
88 Ga0068853_100000783 3300005539 Bacteria 22097
89 Ga0068853_100595615 3300005539 Bacteria 1050
90 Ga0068853_100727441 3300005539 Bacteria 948
91 Ga0070672_100000716 3300005543 Bacteria 19668
92 Ga0070672_100043667 3300005543 Bacteria 3458
93 Ga0070696_100080847 3300005546 Bacteria 2302
94 Ga0070693_100063960 3300005547 Bacteria 2146
95 Ga0070693_100157034 3300005547 Bacteria 1446
96 Ga0070693_100542791 3300005547 Bacteria 831
97 Ga0070665_100001540 3300005548 Bacteria 26631
98 Ga0070665_100015795 3300005548 Bacteria 7584
99 Ga0070665_100038186 3300005548 Bacteria 4827
100 Ga0070665_100183937 3300005548 Bacteria 2090
101 Ga0070665_100364365 3300005548 Bacteria 1452
102 Ga0070665_100444786 3300005548 Bacteria 1305
103 Ga0068855_100001416 3300005563 Bacteria 29777
104 Ga0068855_100175086 3300005563 Bacteria 2428
105 Ga0068855_100273283 3300005563 Bacteria 1879
106 Ga0068855_100291690 3300005563 Bacteria 1808
107 Ga0068855_100309960 3300005563 Bacteria 1746
108 Ga0070664_100034022 3300005564 Bacteria 4273
109 Ga0070664_100065053 3300005564 Bacteria 3110
110 Ga0070664_100136476 3300005564 Bacteria 2157
111 Ga0068857_100004724 3300005577 Bacteria 11541
112 Ga0068857_100139020 3300005577 Bacteria 2195
113 Ga0068857_100213214 3300005577 Bacteria 1762
114 Ga0068857_100416806 3300005577 Bacteria 1251
115 Ga0068854_100001025 3300005578 Bacteria 16746
116 Ga0068854_100069449 3300005578 Bacteria 2572
117 Ga0068856_100082711 3300005614 Bacteria 3187
118 Ga0068856_100196430 3300005614 Bacteria 2031
119 Ga0068856_100232581 3300005614 Bacteria 1858
120 Ga0070702_100483816 3300005615 Bacteria 905
121 Ga0068852_100023172 3300005616 Bacteria 4992
122 Ga0068852_100250551 3300005616 Bacteria 1696
123 Ga0068852_100489029 3300005616 Bacteria 1224
124 Ga0068859_100007966 3300005617 Bacteria 10750
125 Ga0068859_100022827 3300005617 Bacteria 6273
126 Ga0068859_100191683 3300005617 Bacteria 2128
127 Ga0068864_100000235 3300005618 Bacteria 49611
128 Ga0068866_10013411 3300005718 Bacteria 3597
129 Ga0068861_100046814 3300005719 Bacteria 3263
130 Ga0068861_100710089 3300005719 Bacteria 935
131 Ga0068851_10115133 3300005834 Bacteria 1440
132 Ga0068863_100002289 3300005841 Bacteria 19027
133 Ga0068863_100024383 3300005841 Bacteria 5769
134 Ga0068863_100268948 3300005841 Bacteria 1649
135 Ga0068858_100000514 3300005842 Bacteria 40588
136 Ga0068858_100406423 3300005842 Bacteria 1309
137 Ga0068858_101065582 3300005842 Bacteria 793
138 Ga0068860_100009487 3300005843 Bacteria 9666
139 Ga0068860_100010118 3300005843 Bacteria 9347
140 Ga0068860_100343669 3300005843 Bacteria 1467
141 Ga0068862_100002905 3300005844 Bacteria 14978
142 Ga0068862_100054189 3300005844 Bacteria 3434
143 Ga0068862_100055593 3300005844 Bacteria 3390
144 Ga0068862_101105920 3300005844 Bacteria 788
145 Ga0097621_100082234 3300006237 Bacteria 2681
146 Ga0097621_100129378 3300006237 Bacteria 2148
147 Ga0068871_100032564 3300006358 Bacteria 4120
148 Ga0068871_100176208 3300006358 Bacteria 1836
149 Ga0068871_100577109 3300006358 Bacteria 1021
150 Ga0068865_100012549 3300006881 Bacteria 5337
151 Ga0068865_100023366 3300006881 Bacteria 4047
152 Ga0068865_100228440 3300006881 Bacteria 1459
153 Ga0097620_100007966 3300006931 Bacteria 10750
154 Ga0097620_100022826 3300006931 Bacteria 6273
155 Ga0097620_100191673 3300006931 Bacteria 2128
156 Ga0105245_10000170 3300009098 Bacteria 61721
157 Ga0105241_10038331 3300009174 Bacteria 3613
158 Ga0105248_10003825 3300009177 Bacteria 16686
159 Ga0105248_10004489 3300009177 Bacteria 15445
160 Ga0105248_10035427 3300009177 Bacteria 5582
161 Ga0105238_10336764 3300009551 Bacteria 1496
162 Ga0105246_10168531 3300011119 Bacteria 1675
163 Ga0157373_10071682 3300013100 Bacteria 2446
164 Ga0157371_10000443 3300013102 Bacteria 50736
165 Ga0157371_10263520 3300013102 Bacteria 1243
166 Ga0157371_10278819 3300013102 Bacteria 1207
167 Ga0157371_10332115 3300013102 Bacteria 1105
168 Ga0157370_10705985 3300013104 Unclassified 920
169 Ga0157370_10890046 3300013104 Unclassified 808
170 Ga0157369_10078240 3300013105 Bacteria 3544
171 Ga0157369_10253414 3300013105 Bacteria 1837
172 Ga0157378_10000312 3300013297 Bacteria 47527
173 Ga0157372_10226361 3300013307 Bacteria 2168
174 Ga0157372_10245109 3300013307 Bacteria 2080
175 Ga0157372_10636879 3300013307 Bacteria 1242
176 Ga0157375_10099238 3300013308 Bacteria 2991
177 Ga0157375_10527809 3300013308 Bacteria 1343
178 Ga0157377_10019710 3300014745 Bacteria 3527
179 Ga0157379_11093517 3300014968 Bacteria 763
180 Ga0206353_11858605 3300020082 Bacteria 2350
181 Ga0213873_10000013 3300021358 Bacteria 206227
182 Ga0213876_10000072 3300021384 Bacteria 123469
183 Ga0207697_10000063 3300025315 Bacteria 45019
184 Ga0207697_10016349 3300025315 Bacteria 3056
185 Ga0207656_10012931 3300025321 Bacteria 3180
186 Ga0207656_10133908 3300025321 Bacteria 1163
187 Ga0207642_10513226 3300025899 Unclassified 735
188 Ga0207710_10310983 3300025900 Bacteria 797
189 Ga0207688_10000106 3300025901 Bacteria 33178
190 Ga0207688_10035738 3300025901 Bacteria 2753
191 Ga0207680_10340422 3300025903 Unclassified 1052
192 Ga0207647_10000246 3300025904 Bacteria 44259
193 Ga0207647_10122162 3300025904 Bacteria 1535
194 Ga0207645_10002473 3300025907 Bacteria 14517
195 Ga0207645_10226554 3300025907 Bacteria 1233
196 Ga0207645_10273853 3300025907 Bacteria 1120
197 Ga0207645_10277158 3300025907 Bacteria 1113
198 Ga0207645_10297950 3300025907 Bacteria 1073
199 Ga0207705_10017096 3300025909 Bacteria 5196
200 Ga0207705_10048674 3300025909 Bacteria 3050
201 Ga0207705_10122296 3300025909 Bacteria 1932
202 Ga0207705_10263565 3300025909 Bacteria 1316
203 Ga0207705_10520473 3300025909 Bacteria 924
204 Ga0207654_10016739 3300025911 Bacteria 3821
205 Ga0207707_10209103 3300025912 Bacteria 1700
206 Ga0207660_10132688 3300025917 Bacteria 1897
207 Ga0207660_10368533 3300025917 Bacteria 1153
208 Ga0207662_10383444 3300025918 Bacteria 950
209 Ga0207657_10002106 3300025919 Bacteria 21522
210 Ga0207657_10044382 3300025919 Bacteria 3908
211 Ga0207657_10137484 3300025919 Bacteria 1998
212 Ga0207657_10169338 3300025919 Bacteria 1770
213 Ga0207657_10884304 3300025919 Unclassified 689
214 Ga0207649_10022775 3300025920 Bacteria 3620
215 Ga0207649_10027861 3300025920 Bacteria 3321
216 Ga0207649_10111481 3300025920 Bacteria 1829
217 Ga0207652_10131357 3300025921 Bacteria 2234
218 Ga0207652_10431374 3300025921 Bacteria 1188
219 Ga0207681_10004162 3300025923 Bacteria 8956
220 Ga0207681_10014488 3300025923 Bacteria 4900
221 Ga0207681_10308568 3300025923 Bacteria 1254
222 Ga0207650_10010736 3300025925 Bacteria 6286
223 Ga0207650_10247144 3300025925 Bacteria 1443
224 Ga0207659_10527047 3300025926 Bacteria 1002
225 Ga0207659_10590843 3300025926 Bacteria 946
226 Ga0207664_10204005 3300025929 Bacteria 1708
227 Ga0207664_10273812 3300025929 Bacteria 1479
228 Ga0207664_10342404 3300025929 Bacteria 1322
229 Ga0207690_10005149 3300025932 Bacteria 7716
230 Ga0207690_10098039 3300025932 Bacteria 2087
231 Ga0207690_10362975 3300025932 Unclassified 1148
232 Ga0207706_10000224 3300025933 Bacteria 62043
233 Ga0207706_10004764 3300025933 Bacteria 12703
234 Ga0207706_10020861 3300025933 Bacteria 5884
235 Ga0207706_10139856 3300025933 Bacteria 2130
236 Ga0207706_10324961 3300025933 Bacteria 1339
237 Ga0207706_10327004 3300025933 Bacteria 1334
238 Ga0207704_10014705 3300025938 Bacteria 3962
239 Ga0207691_10000750 3300025940 Bacteria 32085
240 Ga0207691_10009655 3300025940 Bacteria 9257
241 Ga0207691_10564319 3300025940 Bacteria 965
242 Ga0207711_10005280 3300025941 Bacteria 10951
243 Ga0207711_10033317 3300025941 Bacteria 4358
244 Ga0207711_10199140 3300025941 Bacteria 1827
245 Ga0207689_10000051 3300025942 Bacteria 88480
246 Ga0207689_10058797 3300025942 Bacteria 3162
247 Ga0207661_10175095 3300025944 Bacteria 1870
248 Ga0207661_10452588 3300025944 Bacteria 1169
249 Ga0207679_10045046 3300025945 Bacteria 3188
250 Ga0207679_10047531 3300025945 Bacteria 3118
251 Ga0207679_10052491 3300025945 Bacteria 2990
252 Ga0207679_10600947 3300025945 Bacteria 991
253 Ga0207679_10729756 3300025945 Bacteria 900
254 Ga0207667_10006507 3300025949 Bacteria 14135
255 Ga0207667_10232551 3300025949 Bacteria 1887
256 Ga0207667_10302820 3300025949 Bacteria 1633
257 Ga0207667_10309770 3300025949 Bacteria 1613
258 Ga0207651_10000232 3300025960 Bacteria 24043
259 Ga0207651_10021035 3300025960 Bacteria 3954
260 Ga0207668_10000086 3300025972 Bacteria 69871
261 Ga0207668_10237496 3300025972 Bacteria 1473
262 Ga0207640_10003179 3300025981 Bacteria 8837
263 Ga0207640_10300059 3300025981 Bacteria 1270
264 Ga0207658_10002031 3300025986 Bacteria 15107
265 Ga0207658_10027514 3300025986 Bacteria 3995
266 Ga0207658_10035627 3300025986 Bacteria 3565
267 Ga0207658_10169470 3300025986 Bacteria 1797
268 Ga0207658_10285578 3300025986 Bacteria 1416
269 Ga0207658_10655638 3300025986 Bacteria 946
270 Ga0207677_10018743 3300026023 Bacteria 4160
271 Ga0207677_10721570 3300026023 Bacteria 886
272 Ga0207703_10003246 3300026035 Bacteria 13663
273 Ga0207703_10704825 3300026035 Bacteria 960
274 Ga0207639_10002776 3300026041 Bacteria 11763
275 Ga0207639_10072121 3300026041 Bacteria 2703
276 Ga0207639_10119123 3300026041 Bacteria 2166
277 Ga0207678_10000315 3300026067 Bacteria 43614
278 Ga0207678_10042256 3300026067 Bacteria 3950
279 Ga0207678_10112680 3300026067 Bacteria 2320
280 Ga0207678_10243776 3300026067 Bacteria 1539
281 Ga0207678_10672352 3300026067 Bacteria 910
282 Ga0207702_10037694 3300026078 Bacteria 4048
283 Ga0207641_10034148 3300026088 Bacteria 4229
284 Ga0207641_10144837 3300026088 Bacteria 2147
285 Ga0207641_10163122 3300026088 Bacteria 2028
286 Ga0207648_10000221 3300026089 Bacteria 61280
287 Ga0207648_10001535 3300026089 Bacteria 25421
288 Ga0207648_10006756 3300026089 Bacteria 11374
289 Ga0207648_10132977 3300026089 Bacteria 2190
290 Ga0207676_10003558 3300026095 Bacteria 11011
291 Ga0207676_10007783 3300026095 Bacteria 7620
292 Ga0207674_10002274 3300026116 Bacteria 24350
293 Ga0207674_10045787 3300026116 Bacteria 4497
294 Ga0207674_10178771 3300026116 Bacteria 2074
295 Ga0207674_10304307 3300026116 Bacteria 1543
296 Ga0207675_100247429 3300026118 Bacteria 1725
297 Ga0207675_100342102 3300026118 Unclassified 1464
298 Ga0207683_10023121 3300026121 Bacteria 5341
299 Ga0207683_10456131 3300026121 Unclassified 1179
300 Ga0207698_10000508 3300026142 Bacteria 22632
301 Ga0207698_10078534 3300026142 Bacteria 2651
302 Ga0207698_10250295 3300026142 Bacteria 1621
303 Ga0207698_10373045 3300026142 Bacteria 1355
304 Ga0209999_1016232 3300027543 Bacteria 1354
305 Ga0209974_10002045 3300027876 Bacteria 7363
306 Ga0268266_10000200 3300028379 Bacteria 104456
307 Ga0268266_10003291 3300028379 Bacteria 16236
308 Ga0268266_10047147 3300028379 Bacteria 3690
309 Ga0268266_10063297 3300028379 Bacteria 3193
310 Ga0268266_10904420 3300028379 Unclassified 853
311 Ga0268265_10002225 3300028380 Bacteria 14916
312 Ga0268265_10038427 3300028380 Bacteria 3521
313 Ga0268265_10047185 3300028380 Bacteria 3226
314 Ga0268265_10397071 3300028380 Bacteria 1273
315 Ga0268264_10001244 3300028381 Bacteria 24285
316 Ga0268264_10021377 3300028381 Bacteria 5283
317 Ga0268264_10247238 3300028381 Bacteria 1655
318 Ga0268264_10437263 3300028381 Bacteria 1265
319 Ga0268264_10943882 3300028381 Bacteria 867
320 Ga0316177_1076925 3300030731 Bacteria 1488
321 Ga0307513_10048307 3300031456 Bacteria 4620
322 Ga0307408_100425158 3300031548 Bacteria 1146
323 Ga0307405_10015287 3300031731 Bacteria 4153
324 Ga0307405_10022719 3300031731 Bacteria 3551
325 Ga0307405_10374886 3300031731 Bacteria 1106
326 Ga0307405_10430298 3300031731 Bacteria 1041
327 Ga0307413_10018492 3300031824 Bacteria 3658
328 Ga0307413_10035036 3300031824 Bacteria 2875
329 Ga0307413_10337419 3300031824 Bacteria 1158
330 Ga0307413_10379723 3300031824 Bacteria 1100
331 Ga0307410_10034086 3300031852 Bacteria 3293
332 Ga0307410_10157213 3300031852 Bacteria 1699
333 Ga0307410_10198217 3300031852 Bacteria 1531
334 Ga0307406_10003621 3300031901 Bacteria 8414
335 Ga0307406_10033686 3300031901 Bacteria 3137
336 Ga0307407_10009763 3300031903 Bacteria 4488
337 Ga0307407_10010035 3300031903 Bacteria 4444
338 Ga0307407_10105027 3300031903 Bacteria 1761
339 Ga0307412_10138204 3300031911 Bacteria 1780
340 Ga0307412_10235252 3300031911 Bacteria 1413
341 Ga0307412_10275245 3300031911 Bacteria 1319
342 Ga0307412_10479547 3300031911 Bacteria 1031
343 Ga0307409_100077958 3300031995 Bacteria 2663
344 Ga0307409_100307684 3300031995 Bacteria 1477
345 Ga0307409_100681014 3300031995 Bacteria 1025
346 Ga0307409_100841241 3300031995 Bacteria 928
347 Ga0307416_100192186 3300032002 Bacteria 1926
348 Ga0307414_10032980 3300032004 Bacteria 3417
349 Ga0307414_10173241 3300032004 Bacteria 1727
350 Ga0307414_10525802 3300032004 Unclassified 1050
351 Ga0307411_10026523 3300032005 Bacteria 3490
352 Ga0307411_10040211 3300032005 Bacteria 2964
353 Ga0307411_10080495 3300032005 Bacteria 2240
354 Ga0307411_10351894 3300032005 Bacteria 1201
355 Ga0307415_100016225 3300032126 Bacteria 4433
356 Ga0307415_100043493 3300032126 Bacteria 2997
357 Ga0373923_0013048 3300035111 Bacteria 3088
358 Ga0373956_0021909 3300035119 Bacteria 2729
359 Ga0373957_0030138 3300035120 Bacteria 1986
360 Ga0373946_0215694 3300035171 Bacteria 925
361 Ga0373955_0016492 3300035172 Bacteria 3637
362 Ga0373935_0318344 3300035692 Bacteria 1103
363 Ga0373937_0008351 3300036401 Bacteria 8992
364 Ga0395899_0052555 3300037312 Bacteria 3019
365 Ga0395899_0093998 3300037312 Bacteria 2170
366 Ga0395899_0171955 3300037312 Bacteria 1525
367 Ga0395899_0228173 3300037312 Bacteria 1287
368 Ga0395899_0324471 3300037312 Bacteria 1036
369 Ga0395900_0004480 3300037418 Bacteria 14789
370 Ga0395900_0004925 3300037418 Bacteria 14059
371 Ga0395900_0046299 3300037418 Bacteria 4478
372 Ga0395900_0059468 3300037418 Bacteria 3934
373 Ga0395900_0118390 3300037418 Bacteria 2718
374 Ga0395900_0282938 3300037418 Bacteria 1650
375 Ga0395900_0321753 3300037418 Bacteria 1527
376 Ga0395900_0333043 3300037418 Bacteria 1495
377 Ga0395900_0341795 3300037418 Bacteria 1472
378 Ga0395900_0477543 3300037418 Bacteria 1199
379 Ga0395898_0034633 3300037466 Bacteria 5029
380 Ga0395898_0076408 3300037466 Bacteria 3234
381 Ga0395905_0002249 3300037471 Bacteria 21706
382 Ga0395905_0010696 3300037471 Bacteria 8898
383 Ga0395905_0029908 3300037471 Bacteria 5134
384 Ga0395905_0054971 3300037471 Bacteria 3725
385 Ga0395905_0071071 3300037471 Bacteria 3263
386 Ga0395905_0108727 3300037471 Bacteria 2603
387 Ga0395905_0121378 3300037471 Bacteria 2456
388 Ga0395905_0134955 3300037471 Bacteria 2321
389 Ga0395905_0136641 3300037471 Bacteria 2306
390 Ga0395905_0770778 3300037471 Bacteria 865
391 Ga0395901_0019979 3300038443 Bacteria 6854
392 Ga0395901_0044123 3300038443 Bacteria 4624
393 Ga0395901_0249068 3300038443 Bacteria 1851
394 Ga0395901_0476970 3300038443 Bacteria 1273
395 Ga0395901_0686945 3300038443 Bacteria 1023
396 Ga0436365_0044388 3300039437 Bacteria 123489
397 Ga0436363_0485121 3300039450 Bacteria 728
398 Ga0436362_1051662 3300039453 Bacteria 138391
399 Ga0451849_1111861 3300041505 Bacteria 794
400 Ga0439455_0021395 3300042012 Bacteria 1542
401 Ga0450888_046476 3300042126 Unclassified 614
402 Ga0466966_0093291 3300044684 Bacteria 1867
403 Ga0466963_0003419 3300044694 Bacteria 9086
404 Ga0466963_0059909 3300044694 Bacteria 2542
405 Ga0466963_0061511 3300044694 Bacteria 2510
406 Ga0466970_0041055 3300044765 Bacteria 2458
407 Ga0466957_0019667 3300044842 Bacteria 3972
408 Ga0466967_0003607 3300045976 Bacteria 10161
409 Ga0466967_0298359 3300045976 Bacteria 1550
410 Ga0466967_0360109 3300045976 Bacteria 1409
411 Ga0495668_0035532 3300046616 Bacteria 2793
412 Ga0495623_0011065 3300046679 Bacteria 5837
413 Ga0495602_0044696 3300048088 Bacteria 4015
414 Ga0496107_0139632 3300048910 Bacteria 1791
415 Ga0496109_0381194 3300048912 Bacteria 1332
416 Ga0501080_0881831 3300049742 Bacteria 781
417 Ga0501044_0423992 3300049823 Bacteria 1240
418 Ga0495612_0043051 3300053078 Bacteria 1844
419 Ga0500658_0000032 3300053134 Bacteria 90863
420 2643951934 2643221588 Bacteria 3692460
421 Ga0068863_100229076
422 JGI24741J21665_1004246
423 JGI24740J21852_10008225
424 JGI24740J21852_10008480
425 JGI24740J21852_10030501
426 JGI24739J22299_10000237
427 JGI24739J22299_10013560
428 JGI24737J22298_10000061
429 JGI24743J22301_10005337
430 JGI24735J21928_10047659
431 JGI24738J21930_10001482
432 JGI24738J21930_10001721
433 JGI24742J22300_10008335
434 Ga0065707_10380065
435 Ga0070658_10021013
436 Ga0070658_10095232
437 Ga0070658_10132185
438 Ga0070658_10179114
439 Ga0070676_10002544
440 Ga0070676_10259769
441 Ga0070676_10510361
442 Ga0070683_100229011
443 Ga0070683_100433253
444 Ga0070690_100026968
445 Ga0070670_100035829
446 Ga0070670_100067083
447 Ga0070670_100242352
448 Ga0068869_100000493
449 Ga0068869_100438514
450 Ga0070680_100126173
451 Ga0070682_100123988
452 Ga0070682_100448296
453 Ga0068868_100022988
454 Ga0068868_100638828
455 Ga0070660_100003937
456 Ga0070660_100057073
457 Ga0070660_100411257
458 Ga0070687_100081607
459 Ga0070687_100124621
460 Ga0070661_100045371
461 Ga0070661_100097642
462 Ga0070661_100101304
463 Ga0070692_10014832
464 Ga0070692_10088412
465 Ga0070692_10194207
466 Ga0070668_100001945
467 Ga0070668_100006904
468 Ga0070669_100000532
469 Ga0070669_100062881
470 Ga0070669_100120043
471 Ga0070669_100320208
472 Ga0070675_100296822
473 Ga0070671_100051811
474 Ga0070671_100336012
475 Ga0070674_100041671
476 Ga0070673_100000058
477 Ga0070673_100019025
478 Ga0070673_100193414
479 Ga0070659_100006101
480 Ga0070659_100020021
481 Ga0070659_100144541
482 Ga0070659_100523117
483 Ga0070667_100004233
484 Ga0070667_100018187
485 Ga0070667_100095053
486 Ga0070667_100421304
487 Ga0070667_101009536
488 Ga0070667_101009537
489 Ga0070714_100084450
490 Ga0070714_100243716
491 Ga0070663_100059398
492 Ga0070663_100226339
493 Ga0070663_100258496
494 Ga0070663_100398374
495 Ga0070678_100101197
496 Ga0070662_100000280
497 Ga0070662_100199591
498 Ga0070662_100224547
499 Ga0070662_100471068
500 Ga0070681_10393736
501 Ga0068867_100001818
502 Ga0068867_100006658
503 Ga0068867_100016724
504 Ga0068867_100335530
505 Ga0070685_10490913
506 Ga0070679_100141173
507 Ga0070679_100937335
508 Ga0068853_100000783
509 Ga0068853_100595615
510 Ga0068853_100727441
511 Ga0070672_100000716
512 Ga0070672_100043667
513 Ga0070696_100080847
514 Ga0070693_100063960
515 Ga0070693_100157034
516 Ga0070693_100542791
517 Ga0070665_100001540
518 Ga0070665_100015795
519 Ga0070665_100038186
520 Ga0070665_100183937
521 Ga0070665_100364365
522 Ga0070665_100444786
523 Ga0068855_100001416
524 Ga0068855_100175086
525 Ga0068855_100273283
526 Ga0068855_100291690
527 Ga0068855_100309960
528 Ga0070664_100034022
529 Ga0070664_100065053
530 Ga0070664_100136476
531 Ga0068857_100004724
532 Ga0068857_100139020
533 Ga0068857_100213214
534 Ga0068857_100416806
535 Ga0068854_100001025
536 Ga0068854_100069449
537 Ga0068856_100082711
538 Ga0068856_100196430
539 Ga0068856_100232581
540 Ga0070702_100483816
541 Ga0068852_100023172
542 Ga0068852_100250551
543 Ga0068852_100489029
544 Ga0068859_100007966
545 Ga0068859_100022827
546 Ga0068859_100191683
547 Ga0068864_100000235
548 Ga0068866_10013411
549 Ga0068861_100046814
550 Ga0068861_100710089
551 Ga0068851_10115133
552 Ga0068863_100002289
553 Ga0068863_100024383
554 Ga0068863_100268948
555 Ga0068858_100000514
556 Ga0068858_100406423
557 Ga0068858_101065582
558 Ga0068860_100009487
559 Ga0068860_100010118
560 Ga0068860_100343669
561 Ga0068862_100002905
562 Ga0068862_100054189
563 Ga0068862_100055593
564 Ga0068862_101105920
565 Ga0097621_100082234
566 Ga0097621_100129378
567 Ga0068871_100032564
568 Ga0068871_100176208
569 Ga0068871_100577109
570 Ga0068865_100012549
571 Ga0068865_100023366
572 Ga0068865_100228440
573 Ga0097620_100007966
574 Ga0097620_100022826
575 Ga0097620_100191673
576 Ga0105245_10000170
577 Ga0105241_10038331
578 Ga0105248_10003825
579 Ga0105248_10004489
580 Ga0105248_10035427
581 Ga0105238_10336764
582 Ga0105246_10168531
583 Ga0157373_10071682
584 Ga0157371_10000443
585 Ga0157371_10263520
586 Ga0157371_10278819
587 Ga0157371_10332115
588 Ga0157370_10705985
589 Ga0157370_10890046
590 Ga0157369_10078240
591 Ga0157369_10253414
592 Ga0157378_10000312
593 Ga0157372_10226361
594 Ga0157372_10245109
595 Ga0157372_10636879
596 Ga0157375_10099238
597 Ga0157375_10527809
598 Ga0157377_10019710
599 Ga0157379_11093517
600 Ga0206353_11858605
601 Ga0213873_10000013
602 Ga0213876_10000072
603 Ga0207697_10000063
604 Ga0207697_10016349
605 Ga0207656_10012931
606 Ga0207656_10133908
607 Ga0207642_10513226
608 Ga0207710_10310983
609 Ga0207688_10000106
610 Ga0207688_10035738
611 Ga0207680_10340422
612 Ga0207647_10000246
613 Ga0207647_10122162
614 Ga0207645_10002473
615 Ga0207645_10226554
616 Ga0207645_10273853
617 Ga0207645_10277158
618 Ga0207645_10297950
619 Ga0207705_10017096
620 Ga0207705_10048674
621 Ga0207705_10122296
622 Ga0207705_10263565
623 Ga0207705_10520473
624 Ga0207654_10016739
625 Ga0207707_10209103
626 Ga0207660_10132688
627 Ga0207660_10368533
628 Ga0207662_10383444
629 Ga0207657_10002106
630 Ga0207657_10044382
631 Ga0207657_10137484
632 Ga0207657_10169338
633 Ga0207657_10884304
634 Ga0207649_10022775
635 Ga0207649_10027861
636 Ga0207649_10111481
637 Ga0207652_10131357
638 Ga0207652_10431374
639 Ga0207681_10004162
640 Ga0207681_10014488
641 Ga0207681_10308568
642 Ga0207650_10010736
643 Ga0207650_10247144
644 Ga0207659_10527047
645 Ga0207659_10590843
646 Ga0207664_10204005
647 Ga0207664_10273812
648 Ga0207664_10342404
649 Ga0207690_10005149
650 Ga0207690_10098039
651 Ga0207690_10362975
652 Ga0207706_10000224
653 Ga0207706_10004764
654 Ga0207706_10020861
655 Ga0207706_10139856
656 Ga0207706_10324961
657 Ga0207706_10327004
658 Ga0207704_10014705
659 Ga0207691_10000750
660 Ga0207691_10009655
661 Ga0207691_10564319
662 Ga0207711_10005280
663 Ga0207711_10033317
664 Ga0207711_10199140
665 Ga0207689_10000051
666 Ga0207689_10058797
667 Ga0207661_10175095
668 Ga0207661_10452588
669 Ga0207679_10045046
670 Ga0207679_10047531
671 Ga0207679_10052491
672 Ga0207679_10600947
673 Ga0207679_10729756
674 Ga0207667_10006507
675 Ga0207667_10232551
676 Ga0207667_10302820
677 Ga0207667_10309770
678 Ga0207651_10000232
679 Ga0207651_10021035
680 Ga0207668_10000086
681 Ga0207668_10237496
682 Ga0207640_10003179
683 Ga0207640_10300059
684 Ga0207658_10002031
685 Ga0207658_10027514
686 Ga0207658_10035627
687 Ga0207658_10169470
688 Ga0207658_10285578
689 Ga0207658_10655638
690 Ga0207677_10018743
691 Ga0207677_10721570
692 Ga0207703_10003246
693 Ga0207703_10704825
694 Ga0207639_10002776
695 Ga0207639_10072121
696 Ga0207639_10119123
697 Ga0207678_10000315
698 Ga0207678_10042256
699 Ga0207678_10112680
700 Ga0207678_10243776
701 Ga0207678_10672352
702 Ga0207702_10037694
703 Ga0207641_10034148
704 Ga0207641_10144837
705 Ga0207641_10163122
706 Ga0207648_10000221
707 Ga0207648_10001535
708 Ga0207648_10006756
709 Ga0207648_10132977
710 Ga0207676_10003558
711 Ga0207676_10007783
712 Ga0207674_10002274
713 Ga0207674_10045787
714 Ga0207674_10178771
715 Ga0207674_10304307
716 Ga0207675_100247429
717 Ga0207675_100342102
718 Ga0207683_10023121
719 Ga0207683_10456131
720 Ga0207698_10000508
721 Ga0207698_10078534
722 Ga0207698_10250295
723 Ga0207698_10373045
724 Ga0209999_1016232
725 Ga0209974_10002045
726 Ga0268266_10000200
727 Ga0268266_10003291
728 Ga0268266_10047147
729 Ga0268266_10063297
730 Ga0268266_10904420
731 Ga0268265_10002225
732 Ga0268265_10038427
733 Ga0268265_10047185
734 Ga0268265_10397071
735 Ga0268264_10001244
736 Ga0268264_10021377
737 Ga0268264_10247238
738 Ga0268264_10437263
739 Ga0268264_10943882
740 Ga0316177_1076925
741 Ga0307513_10048307
742 Ga0307408_100425158
743 Ga0307405_10015287
744 Ga0307405_10022719
745 Ga0307405_10374886
746 Ga0307405_10430298
747 Ga0307413_10018492
748 Ga0307413_10035036
749 Ga0307413_10337419
750 Ga0307413_10379723
751 Ga0307410_10034086
752 Ga0307410_10157213
753 Ga0307410_10198217
754 Ga0307406_10003621
755 Ga0307406_10033686
756 Ga0307407_10009763
757 Ga0307407_10010035
758 Ga0307407_10105027
759 Ga0307412_10138204
760 Ga0307412_10235252
761 Ga0307412_10275245
762 Ga0307412_10479547
763 Ga0307409_100077958
764 Ga0307409_100307684
765 Ga0307409_100681014
766 Ga0307409_100841241
767 Ga0307416_100192186
768 Ga0307414_10032980
769 Ga0307414_10173241
770 Ga0307414_10525802
771 Ga0307411_10026523
772 Ga0307411_10040211
773 Ga0307411_10080495
774 Ga0307411_10351894
775 Ga0307415_100016225
776 Ga0307415_100043493
777 Ga0373923_0013048
778 Ga0373956_0021909
779 Ga0373957_0030138
780 Ga0373946_0215694
781 Ga0373955_0016492
782 Ga0373935_0318344
783 Ga0373937_0008351
784 Ga0395899_0052555
785 Ga0395899_0093998
786 Ga0395899_0171955
787 Ga0395899_0228173
788 Ga0395899_0324471
789 Ga0395900_0004480
790 Ga0395900_0004925
791 Ga0395900_0046299
792 Ga0395900_0059468
793 Ga0395900_0118390
794 Ga0395900_0282938
795 Ga0395900_0321753
796 Ga0395900_0333043
797 Ga0395900_0341795
798 Ga0395900_0477543
799 Ga0395898_0034633
800 Ga0395898_0076408
801 Ga0395905_0002249
802 Ga0395905_0010696
803 Ga0395905_0029908
804 Ga0395905_0054971
805 Ga0395905_0071071
806 Ga0395905_0108727
807 Ga0395905_0121378
808 Ga0395905_0134955
809 Ga0395905_0136641
810 Ga0395905_0770778
811 Ga0395901_0019979
812 Ga0395901_0044123
813 Ga0395901_0249068
814 Ga0395901_0476970
815 Ga0395901_0686945
816 Ga0436365_0044388
817 Ga0436363_0485121
818 Ga0436362_1051662
819 Ga0451849_1111861
820 Ga0439455_0021395
821 Ga0450888_046476
822 Ga0466966_0093291
823 Ga0466963_0003419
824 Ga0466963_0059909
825 Ga0466963_0061511
826 Ga0466970_0041055
827 Ga0466957_0019667
828 Ga0466967_0003607
829 Ga0466967_0298359
830 Ga0466967_0360109
831 Ga0495668_0035532
832 Ga0495623_0011065
833 Ga0495602_0044696
834 Ga0496107_0139632
835 Ga0496109_0381194
836 Ga0501080_0881831
837 Ga0501044_0423992
838 Ga0495612_0043051
839 Ga0500658_0000032
840 2643951934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02586

SRAP

SOS response associated peptidase (SRAP)

13

203

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oov-assembly1.cif.gz_B-2 crystal structure of hmces srap domain in complex with palindromic 3' overhang dna 0.7897 2 192
6oeb-assembly1.cif.gz_A crystal structure of hmces srap domain in complex with 3' overhang dna 0.7876 2 192
6oov-assembly1.cif.gz_A crystal structure of hmces srap domain in complex with palindromic 3' overhang dna 0.7871 2 192
6oov-assembly1.cif.gz_B-2 crystal structure of hmces srap domain in complex with palindromic 3' overhang dna 0.7822 2 192
6oea-assembly1.cif.gz_A crystal structure of hmces srap domain in complex with longer 3' overhang dna 0.782 2 192
ID Description Score Start End Superfamily
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8176 1 190 3.90.1680.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8061 1 190 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7984 1 192 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7946 1 192 3.90.1680.10
6nlcA00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7697 2 192 3.90.1680.10
ID Description Score Start End GO Terms
AF-A0A442TGU7-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.964 1 190 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A0M3GCT8-F1-model_v4 deleted 0.9615 1 192
AF-A0A6N8TJZ9-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9583 1 192 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A0M3GCT8-F1-model_v4 deleted 0.9567 1 192
AF-A0A059WY33-F1-model_v4 Putative ACR, COG2135 0.9557 1 114

Map