F439714

General Info

Members Datasets Scaffolds Average Seq Length
420 255 840 169

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100350427|Ga0068860_1003504272
Length 188
Sequence MSMAPAIRILGIDPGLRTTGFGVIEAEGARLHYIASGTIRTDTVAIGQLPARLKIIFDGVREVTARYQPTCASLEIVFVNVNPQSTLLLGQARGAALTALVSNDLEVSEYTALQMKKAVVGHGQARKEQVQAMVARLLGLSAEPGKDAADALGLAICHAHAGASFAALAKHGTLTRRSHAQYRKGRSY

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
175 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
176 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
177 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
178 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
179 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
223 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
224 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
225 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
246 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
247 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
248 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
249 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
250 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
251 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
252 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
253 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
254 2831864461 Roseateles noduli HZ7 Isolate Nodule
255 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 0.71
Rhizoplane 3.33
Rhizosphere 76.67
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100350427 3300005843 Bacteria 1453
2 JGI24740J21852_10017822 3300001979 Bacteria 2532
3 rootH1_10012732 3300003316 Bacteria 16383
4 rootH1_10029007 3300003316 Bacteria 5359
5 rootH1_10073131 3300003316 Bacteria 1456
6 rootH2_10008565 3300003320 Bacteria 3247
7 rootL2_10001240 3300003322 Bacteria 49675
8 rootL2_10036768 3300003322 Bacteria 5013
9 rootH1_10004543 3300003323 Bacteria 13850
10 rootH1_10020876 3300003323 Bacteria 4751
11 rootH1_10114536 3300003323 Bacteria 3091
12 Ga0055539_1000222 3300003752 Bacteria 40292
13 Ga0055533_1000016 3300003756 Bacteria 396179
14 Ga0055525_1001565 3300003759 Unclassified 3764
15 Ga0055526_1016751 3300003771 Bacteria 2846
16 Ga0055524_1001208 3300003775 Bacteria 15319
17 Ga0055524_1020305 3300003775 Bacteria 2242
18 Ga0055540_1018583 3300003792 Bacteria 1901
19 Ga0055531_10016340 3300003794 Bacteria 3206
20 Ga0055531_10020845 3300003794 Bacteria 2571
21 Ga0055543_1005869 3300004625 Bacteria 3066
22 Ga0065165_1000101 3300005262 Bacteria 141486
23 Ga0065165_1003212 3300005262 Bacteria 11913
24 Ga0070683_100081025 3300005329 Bacteria 3039
25 Ga0070670_100073176 3300005331 Bacteria 2944
26 Ga0070670_100090652 3300005331 Bacteria 2627
27 Ga0070670_100307830 3300005331 Bacteria 1386
28 Ga0070677_10069212 3300005333 Bacteria 1480
29 Ga0068869_100002073 3300005334 Bacteria 12041
30 Ga0070666_10619111 3300005335 Bacteria 791
31 Ga0068868_100028923 3300005338 Bacteria 4242
32 Ga0068868_100226270 3300005338 Bacteria 1568
33 Ga0068868_100422966 3300005338 Bacteria 1154
34 Ga0068868_101064377 3300005338 Bacteria 743
35 Ga0070660_100008567 3300005339 Bacteria 7161
36 Ga0070660_100129104 3300005339 Bacteria 2021
37 Ga0070661_100759093 3300005344 Bacteria 793
38 Ga0070669_100014598 3300005353 Bacteria 5591
39 Ga0070675_100013374 3300005354 Bacteria 6450
40 Ga0070675_100017521 3300005354 Bacteria 5692
41 Ga0070675_100155314 3300005354 Bacteria 1964
42 Ga0070675_100605402 3300005354 Bacteria 994
43 Ga0070671_100037288 3300005355 Bacteria 4031
44 Ga0070671_100489407 3300005355 Bacteria 1057
45 Ga0070671_101107225 3300005355 Bacteria 696
46 Ga0070674_100484646 3300005356 Bacteria 1027
47 Ga0070673_100244544 3300005364 Bacteria 1561
48 Ga0070659_100001014 3300005366 Bacteria 20566
49 Ga0070659_100036674 3300005366 Bacteria 3822
50 Ga0070659_100058246 3300005366 Bacteria 3048
51 Ga0070659_100660837 3300005366 Bacteria 902
52 Ga0070667_100005406 3300005367 Bacteria 10668
53 Ga0070667_100115482 3300005367 Bacteria 2331
54 Ga0070667_100649903 3300005367 Bacteria 974
55 Ga0070663_100069807 3300005455 Bacteria 2554
56 Ga0070663_100098591 3300005455 Bacteria 2177
57 Ga0070663_100470952 3300005455 Bacteria 1038
58 Ga0070678_100027486 3300005456 Bacteria 3863
59 Ga0070678_100085720 3300005456 Bacteria 2401
60 Ga0070678_100290236 3300005456 Bacteria 1386
61 Ga0070678_100309939 3300005456 Bacteria 1344
62 Ga0070678_100329939 3300005456 Bacteria 1305
63 Ga0070678_100608189 3300005456 Bacteria 977
64 Ga0070662_100001463 3300005457 Bacteria 14552
65 Ga0070662_100029212 3300005457 Bacteria 3847
66 Ga0070662_100770948 3300005457 Bacteria 816
67 Ga0068867_100000081 3300005459 Bacteria 59361
68 Ga0068867_100130650 3300005459 Bacteria 1951
69 Ga0068867_100259250 3300005459 Bacteria 1417
70 Ga0068867_100412845 3300005459 Bacteria 1141
71 Ga0070684_100009956 3300005535 Bacteria 7516
72 Ga0070684_100229615 3300005535 Bacteria 1694
73 Ga0068853_100014841 3300005539 Bacteria 6396
74 Ga0068853_100327725 3300005539 Bacteria 1420
75 Ga0068853_100810877 3300005539 Bacteria 897
76 Ga0070672_100000561 3300005543 Bacteria 21760
77 Ga0070672_100007343 3300005543 Bacteria 7473
78 Ga0070672_100128062 3300005543 Bacteria 2084
79 Ga0070672_100141505 3300005543 Bacteria 1985
80 Ga0070672_100142019 3300005543 Bacteria 1981
81 Ga0070696_100416091 3300005546 Bacteria 1054
82 Ga0070693_100010390 3300005547 Bacteria 4665
83 Ga0070693_100062743 3300005547 Bacteria 2163
84 Ga0070665_101091688 3300005548 Bacteria 809
85 Ga0068855_100015124 3300005563 Bacteria 9293
86 Ga0070664_100006317 3300005564 Bacteria 9561
87 Ga0070664_100017065 3300005564 Bacteria 5959
88 Ga0068857_100043587 3300005577 Bacteria 3979
89 Ga0068857_100150873 3300005577 Bacteria 2105
90 Ga0068854_100019891 3300005578 Bacteria 4532
91 Ga0068856_100025953 3300005614 Bacteria 5714
92 Ga0068856_100267419 3300005614 Bacteria 1725
93 Ga0070702_100029130 3300005615 Bacteria 2999
94 Ga0068852_100005075 3300005616 Bacteria 9367
95 Ga0068852_100010828 3300005616 Bacteria 6832
96 Ga0068852_100012059 3300005616 Bacteria 6542
97 Ga0068852_100039409 3300005616 Bacteria 3977
98 Ga0068852_100139075 3300005616 Bacteria 2245
99 Ga0068852_100354563 3300005616 Bacteria 1433
100 Ga0068852_100978250 3300005616 Bacteria 865
101 Ga0068859_100041195 3300005617 Bacteria 4640
102 Ga0068864_100010110 3300005618 Bacteria 7791
103 Ga0068864_100029161 3300005618 Bacteria 4669
104 Ga0068861_100037649 3300005719 Bacteria 3596
105 Ga0068861_100942130 3300005719 Bacteria 820
106 Ga0068851_10008878 3300005834 Bacteria 4661
107 Ga0068851_10058459 3300005834 Bacteria 1971
108 Ga0068851_10365253 3300005834 Bacteria 842
109 Ga0068863_100066821 3300005841 Bacteria 3401
110 Ga0068863_100161499 3300005841 Bacteria 2147
111 Ga0068858_100006772 3300005842 Bacteria 11149
112 Ga0068858_100010785 3300005842 Bacteria 8638
113 Ga0068860_100016235 3300005843 Bacteria 7260
114 Ga0068862_100051041 3300005844 Bacteria 3537
115 Ga0075362_10075133 3300006177 Bacteria 1550
116 Ga0075366_10017250 3300006195 Bacteria 4154
117 Ga0075366_10048334 3300006195 Bacteria 2522
118 Ga0075366_10095312 3300006195 Bacteria 1784
119 Ga0075366_10131920 3300006195 Bacteria 1508
120 Ga0075366_10589950 3300006195 Bacteria 689
121 Ga0097621_100233066 3300006237 Bacteria 1608
122 Ga0075370_10025312 3300006353 Bacteria 3281
123 Ga0075370_10274214 3300006353 Bacteria 1001
124 Ga0068871_100038377 3300006358 Bacteria 3825
125 Ga0068871_100168082 3300006358 Bacteria 1878
126 Ga0068871_100568266 3300006358 Bacteria 1028
127 Ga0075430_100005009 3300006846 Bacteria 11150
128 Ga0075434_100136268 3300006871 Bacteria 2474
129 Ga0075429_100004433 3300006880 Bacteria 12064
130 Ga0068865_100122092 3300006881 Bacteria 1939
131 Ga0097620_100041196 3300006931 Bacteria 4640
132 Ga0099823_1003331 3300006944 Bacteria 15150
133 Ga0105240_10012261 3300009093 Bacteria 11845
134 Ga0105240_10515623 3300009093 Bacteria 1327
135 Ga0105245_10063572 3300009098 Bacteria 3333
136 Ga0114129_10033378 3300009147 Bacteria 7273
137 Ga0114129_10587260 3300009147 Bacteria 1445
138 Ga0105243_10019016 3300009148 Bacteria 5207
139 Ga0105243_10063371 3300009148 Bacteria 2962
140 Ga0105243_10983724 3300009148 Bacteria 845
141 Ga0105248_10200084 3300009177 Bacteria 2251
142 Ga0105237_10000407 3300009545 Bacteria 61234
143 Ga0105237_10074321 3300009545 Bacteria 3391
144 Ga0105238_10015817 3300009551 Bacteria 7638
145 Ga0105239_10000335 3300010375 Bacteria 68810
146 Ga0105246_10292976 3300011119 Bacteria 1310
147 Ga0157319_1000008 3300012497 Bacteria 315600
148 Ga0157370_10352910 3300013104 Bacteria 1355
149 Ga0157369_10020908 3300013105 Bacteria 7317
150 Ga0157374_10026288 3300013296 Bacteria 5236
151 Ga0157374_10037450 3300013296 Bacteria 4452
152 Ga0157378_10054411 3300013297 Bacteria 3563
153 Ga0157378_10320850 3300013297 Bacteria 1505
154 Ga0163162_10022700 3300013306 Bacteria 6187
155 Ga0157372_10071953 3300013307 Bacteria 3896
156 Ga0157372_10088826 3300013307 Bacteria 3510
157 Ga0157375_10026356 3300013308 Bacteria 5416
158 Ga0157375_10358498 3300013308 Bacteria 1624
159 Ga0163163_10571833 3300014325 Bacteria 1193
160 Ga0163163_11158660 3300014325 Bacteria 836
161 Ga0157380_10011366 3300014326 Bacteria 6433
162 Ga0157377_10000032 3300014745 Bacteria 121003
163 Ga0157379_10003468 3300014968 Bacteria 13351
164 Ga0157379_10011312 3300014968 Bacteria 7779
165 Ga0157379_10167268 3300014968 Bacteria 1985
166 Ga0157376_10017149 3300014969 Bacteria 5516
167 Ga0157376_10187443 3300014969 Bacteria 1895
168 Ga0163161_10007666 3300017792 Bacteria 7464
169 Ga0163161_10266429 3300017792 Bacteria 1339
170 Ga0209674_100041 3300025226 Bacteria 396231
171 Ga0209563_100043 3300025230 Bacteria 397271
172 Ga0209677_100096 3300025253 Bacteria 99089
173 Ga0209673_1006020 3300025273 Bacteria 5963
174 Ga0209673_1008957 3300025273 Bacteria 4397
175 Ga0209564_1000008 3300025295 Bacteria 953227
176 Ga0209050_1001143 3300025298 Bacteria 31915
177 Ga0209050_1001274 3300025298 Bacteria 28926
178 Ga0209256_1000413 3300025299 Bacteria 67123
179 Ga0209256_1003828 3300025299 Bacteria 10074
180 Ga0209051_1002377 3300025303 Bacteria 13590
181 Ga0209257_1002153 3300025304 Bacteria 20486
182 Ga0209257_1008878 3300025304 Bacteria 5548
183 Ga0207656_10010797 3300025321 Bacteria 3433
184 Ga0207656_10123071 3300025321 Bacteria 1209
185 Ga0207688_10034568 3300025901 Bacteria 2800
186 Ga0207680_10152307 3300025903 Bacteria 1543
187 Ga0207645_10126527 3300025907 Bacteria 1661
188 Ga0207645_10433611 3300025907 Bacteria 886
189 Ga0207705_10034357 3300025909 Bacteria 3625
190 Ga0207684_10084816 3300025910 Bacteria 2698
191 Ga0207671_10006217 3300025914 Bacteria 10713
192 Ga0207671_11028198 3300025914 Bacteria 649
193 Ga0207662_10124830 3300025918 Bacteria 1618
194 Ga0207657_10039936 3300025919 Bacteria 4163
195 Ga0207657_10254870 3300025919 Bacteria 1398
196 Ga0207649_10000951 3300025920 Bacteria 18067
197 Ga0207649_10010331 3300025920 Bacteria 5126
198 Ga0207649_10484767 3300025920 Bacteria 938
199 Ga0207649_10555511 3300025920 Bacteria 879
200 Ga0207681_10009855 3300025923 Bacteria 5844
201 Ga0207694_10023194 3300025924 Bacteria 4711
202 Ga0207694_10465634 3300025924 Bacteria 1056
203 Ga0207650_10009477 3300025925 Bacteria 6653
204 Ga0207650_10010846 3300025925 Bacteria 6262
205 Ga0207650_10169301 3300025925 Bacteria 1735
206 Ga0207650_10309401 3300025925 Bacteria 1292
207 Ga0207659_10003636 3300025926 Bacteria 9288
208 Ga0207659_10007851 3300025926 Bacteria 6595
209 Ga0207659_10243301 3300025926 Bacteria 1457
210 Ga0207687_10045195 3300025927 Bacteria 3043
211 Ga0207687_10736267 3300025927 Bacteria 838
212 Ga0207644_10727000 3300025931 Bacteria 828
213 Ga0207690_10000658 3300025932 Bacteria 22107
214 Ga0207690_10165038 3300025932 Bacteria 1654
215 Ga0207690_10281178 3300025932 Bacteria 1296
216 Ga0207706_10011820 3300025933 Bacteria 7950
217 Ga0207706_10069247 3300025933 Bacteria 3103
218 Ga0207706_10781748 3300025933 Bacteria 812
219 Ga0207709_10017165 3300025935 Bacteria 4036
220 Ga0207709_10030049 3300025935 Bacteria 3158
221 Ga0207691_10004379 3300025940 Bacteria 13691
222 Ga0207691_10008676 3300025940 Bacteria 9754
223 Ga0207691_10053656 3300025940 Bacteria 3680
224 Ga0207691_10241570 3300025940 Bacteria 1561
225 Ga0207691_10312694 3300025940 Bacteria 1348
226 Ga0207711_10048696 3300025941 Bacteria 3626
227 Ga0207711_10049262 3300025941 Bacteria 3607
228 Ga0207689_10031035 3300025942 Bacteria 4452
229 Ga0207661_10067819 3300025944 Bacteria 2902
230 Ga0207661_10133907 3300025944 Bacteria 2126
231 Ga0207679_10003109 3300025945 Bacteria 10278
232 Ga0207679_10044097 3300025945 Bacteria 3216
233 Ga0207679_10869898 3300025945 Bacteria 824
234 Ga0207667_10030541 3300025949 Bacteria 5829
235 Ga0207667_10378761 3300025949 Bacteria 1442
236 Ga0207640_10107798 3300025981 Bacteria 1968
237 Ga0207658_10045134 3300025986 Bacteria 3211
238 Ga0207658_10430467 3300025986 Bacteria 1165
239 Ga0207677_10074554 3300026023 Bacteria 2408
240 Ga0207677_10823586 3300026023 Bacteria 832
241 Ga0207703_10003521 3300026035 Bacteria 13096
242 Ga0207639_10005163 3300026041 Bacteria 8806
243 Ga0207639_10028226 3300026041 Bacteria 4095
244 Ga0207639_10083308 3300026041 Bacteria 2538
245 Ga0207639_10779034 3300026041 Bacteria 890
246 Ga0207678_10133052 3300026067 Bacteria 2122
247 Ga0207678_10154971 3300026067 Bacteria 1956
248 Ga0207678_10378868 3300026067 Bacteria 1223
249 Ga0207702_10017844 3300026078 Bacteria 5875
250 Ga0207641_10470520 3300026088 Bacteria 1217
251 Ga0207648_10001296 3300026089 Bacteria 27908
252 Ga0207648_10522033 3300026089 Bacteria 1088
253 Ga0207648_10683313 3300026089 Bacteria 950
254 Ga0207648_10877629 3300026089 Bacteria 837
255 Ga0207676_10005732 3300026095 Bacteria 8787
256 Ga0207676_10040483 3300026095 Bacteria 3571
257 Ga0207674_10011435 3300026116 Bacteria 9973
258 Ga0207674_10079074 3300026116 Bacteria 3293
259 Ga0207675_100063049 3300026118 Bacteria 3463
260 Ga0207675_100245072 3300026118 Bacteria 1733
261 Ga0207683_10036299 3300026121 Bacteria 4291
262 Ga0207683_10122074 3300026121 Bacteria 2340
263 Ga0207683_10269972 3300026121 Bacteria 1554
264 Ga0207683_10869652 3300026121 Bacteria 837
265 Ga0207698_10009766 3300026142 Bacteria 6129
266 Ga0207698_10017480 3300026142 Bacteria 4867
267 Ga0207698_10024114 3300026142 Bacteria 4264
268 Ga0207698_10106923 3300026142 Bacteria 2334
269 Ga0207698_10204334 3300026142 Bacteria 1772
270 Ga0209389_1002327 3300027296 Bacteria 14449
271 Ga0209981_1009144 3300027378 Bacteria 1353
272 Ga0209996_1001333 3300027395 Bacteria 2951
273 Ga0209995_1001463 3300027471 Bacteria 3647
274 Ga0209968_1000844 3300027526 Bacteria 4746
275 Ga0209966_1000309 3300027695 Bacteria 15889
276 Ga0209974_10014753 3300027876 Bacteria 2596
277 Ga0268265_10179089 3300028380 Bacteria 1820
278 Ga0268264_10004863 3300028381 Bacteria 11381
279 Ga0268264_10577706 3300028381 Bacteria 1105
280 Ga0268264_10775694 3300028381 Bacteria 956
281 Ga0307515_10000609 3300028794 Bacteria 83557
282 Ga0307515_10013045 3300028794 Bacteria 15569
283 Ga0307515_10035839 3300028794 Bacteria 8053
284 Ga0307515_10344904 3300028794 Bacteria 1139
285 Ga0268256_1037868 3300030500 Bacteria 1101
286 Ga0307512_10251299 3300030522 Bacteria 880
287 Ga0307513_10008116 3300031456 Bacteria 13478
288 Ga0307513_10093821 3300031456 Bacteria 3049
289 Ga0307513_10669509 3300031456 Bacteria 744
290 Ga0307509_10052528 3300031507 Bacteria 4350
291 Ga0307509_10241377 3300031507 Bacteria 1599
292 Ga0307408_100242317 3300031548 Bacteria 1482
293 Ga0307408_100275529 3300031548 Bacteria 1399
294 Ga0307508_10004265 3300031616 Bacteria 14031
295 Ga0307514_10023638 3300031649 Bacteria 4985
296 Ga0307405_10958469 3300031731 Bacteria 727
297 Ga0307413_10164467 3300031824 Bacteria 1563
298 Ga0307410_10018877 3300031852 Bacteria 4179
299 Ga0307406_10052508 3300031901 Bacteria 2593
300 Ga0307406_10294729 3300031901 Bacteria 1243
301 Ga0307412_10244626 3300031911 Bacteria 1390
302 Ga0307409_100375720 3300031995 Bacteria 1349
303 Ga0307416_100075710 3300032002 Bacteria 2818
304 Ga0307416_100502629 3300032002 Bacteria 1277
305 Ga0307411_10914847 3300032005 Bacteria 780
306 Ga0307507_10020165 3300033179 Bacteria 7478
307 Ga0373952_0006469 3300035092 Bacteria 2164
308 Ga0373932_0023814 3300035112 Bacteria 1642
309 Ga0373945_0371677 3300035116 Bacteria 623
310 Ga0373946_0523804 3300035171 Bacteria 610
311 Ga0373935_0768996 3300035692 Bacteria 710
312 Ga0373927_0066852 3300035695 Bacteria 2326
313 Ga0373947_0055986 3300035725 Bacteria 2383
314 Ga0373947_0230645 3300035725 Bacteria 1219
315 Ga0373937_0021907 3300036401 Bacteria 5738
316 Ga0373937_0140670 3300036401 Bacteria 2258
317 Ga0373937_0688594 3300036401 Bacteria 968
318 Ga0373925_0083763 3300037068 Bacteria 2429
319 Ga0395905_0041281 3300037471 Bacteria 4329
320 Ga0395905_0068368 3300037471 Bacteria 3327
321 Ga0436361_0869713 3300039447 Bacteria 3016
322 Ga0436361_1211597 3300039447 Bacteria 2762
323 Ga0451795_1564080 3300041456 Bacteria 1089
324 Ga0451800_1145861 3300041459 Bacteria 813
325 Ga0451802_1553398 3300041460 Bacteria 1526
326 Ga0451833_1000255 3300041491 Bacteria 1465
327 Ga0451833_1462293 3300041491 Bacteria 725
328 Ga0451847_0270602 3300041503 Bacteria 571
329 Ga0451843_0840498 3300041509 Bacteria 1311
330 Ga0451853_1659374 3300041512 Bacteria 1543
331 Ga0439450_019911 3300042008 Bacteria 1427
332 Ga0450898_007844 3300042134 Bacteria 1671
333 Ga0439459_0002793 3300042438 Bacteria 2722
334 Ga0439464_0025574 3300042439 Bacteria 1635
335 Ga0466963_0211530 3300044694 Bacteria 1357
336 Ga0453684_0016471 3300044712 Bacteria 11553
337 Ga0466968_0017780 3300044735 Bacteria 2846
338 Ga0451576_0051630 3300045051 Bacteria 4311
339 Ga0451576_0140364 3300045051 Bacteria 2520
340 Ga0451576_0528239 3300045051 Bacteria 1240
341 Ga0495650_0002349 3300046471 Bacteria 15614
342 Ga0495580_0064395 3300046472 Bacteria 2570
343 Ga0495580_0428726 3300046472 Bacteria 889
344 Ga0495630_0333439 3300046517 Bacteria 1160
345 Ga0495637_0122034 3300046520 Bacteria 1002
346 Ga0495644_0350444 3300046523 Bacteria 581
347 Ga0495587_0385282 3300046536 Bacteria 780
348 Ga0495621_0076381 3300046539 Bacteria 1242
349 Ga0495621_0115794 3300046539 Bacteria 1032
350 Ga0495667_0446157 3300046559 Bacteria 813
351 Ga0495667_0588839 3300046559 Bacteria 693
352 Ga0495668_0315559 3300046616 Bacteria 857
353 Ga0495625_0003970 3300046660 Bacteria 14185
354 Ga0495647_0015931 3300046681 Bacteria 2640
355 Ga0495647_0059987 3300046681 Bacteria 1499
356 Ga0495658_0129049 3300046683 Bacteria 1537
357 Ga0495613_0109353 3300046689 Bacteria 1993
358 Ga0495670_0009125 3300046691 Bacteria 4877
359 Ga0495600_0523866 3300046809 Bacteria 726
360 Ga0495677_0146175 3300047445 Bacteria 909
361 Ga0495686_0152421 3300047472 Bacteria 1356
362 Ga0496100_0483650 3300048903 Bacteria 952
363 Ga0496102_0020340 3300048905 Bacteria 5866
364 Ga0496102_0038755 3300048905 Bacteria 4303
365 Ga0496102_0147184 3300048905 Bacteria 2211
366 Ga0496105_0106834 3300048908 Bacteria 2311
367 Ga0496106_0027831 3300048909 Bacteria 4209
368 Ga0496108_0007144 3300048911 Bacteria 9052
369 Ga0496108_0037516 3300048911 Bacteria 4037
370 Ga0496111_0417013 3300048914 Bacteria 992
371 Ga0496113_0322877 3300048916 Bacteria 1237
372 Ga0496115_0026390 3300048918 Bacteria 4534
373 Ga0496121_0014590 3300048924 Bacteria 8320
374 Ga0496124_0039444 3300048927 Bacteria 4094
375 Ga0496125_0005030 3300048928 Bacteria 14929
376 Ga0501043_0000057 3300049579 Bacteria 103997
377 Ga0501046_0000075 3300049580 Bacteria 104000
378 Ga0501047_0000081 3300049581 Bacteria 122697
379 Ga0501048_0002921 3300049582 Bacteria 13057
380 Ga0501075_0592373 3300049591 Bacteria 846
381 Ga0501198_000012 3300049649 Bacteria 113529
382 Ga0501206_010370 3300049653 Bacteria 1247
383 Ga0501206_021838 3300049653 Bacteria 916
384 Ga0501222_000010 3300049662 Bacteria 113536
385 Ga0501222_015226 3300049662 Bacteria 1017
386 Ga0501233_122660 3300049668 Bacteria 704
387 Ga0501035_0277374 3300049822 Bacteria 1418
388 Ga0501044_0869039 3300049823 Bacteria 778
389 Ga0501045_0002738 3300049824 Bacteria 12043
390 nmdc:mga03683_443763_c1 3300050489 Bacteria 624
391 nmdc:mga0k408_194143_c1 3300050493 Bacteria 1212
392 nmdc:mga0k408_212969_c1 3300050493 Bacteria 1154
393 nmdc:mga0k408_36670_c1 3300050493 Bacteria 2814
394 nmdc:mga0k408_58976_c1 3300050493 Bacteria 2229
395 nmdc:mga0k408_59390_c1 3300050493 Bacteria 2222
396 nmdc:mga06z11_564636_c1 3300050494 Bacteria 691
397 nmdc:mga07m45_90301_c1 3300050496 Bacteria 1755
398 nmdc:mga05p37_268564_c1 3300050507 Bacteria 2039
399 nmdc:mga09592_3580_c1 3300050508 Bacteria 12538
400 nmdc:mga0qj67_83522_c1 3300050509 Bacteria 2560
401 nmdc:mga0n895_278173_c1 3300050512 Bacteria 1697
402 nmdc:mga0rr50_43851_c1 3300050513 Bacteria 3276
403 Ga0495601_0303183 3300053077 Bacteria 1040
404 Ga0495595_0139271 3300053084 Bacteria 1190
405 Ga0500578_0003036 3300053086 Bacteria 12981
406 Ga0500651_0358913 3300053093 Bacteria 826
407 Ga0500593_002996 3300053117 Bacteria 6295
408 Ga0500658_0161929 3300053134 Bacteria 1013
409 Ga0500604_0107591 3300053151 Bacteria 924
410 Ga0500622_0010080 3300053156 Bacteria 5205
411 Ga0500587_011481 3300053739 Bacteria 1118
412 2587724967 2585428057 Bacteria 6737412
413 2587731669 2585428058 Bacteria 6853932
414 2587754170 2585428062 Bacteria 6842168
415 2588292470 2588253510 Bacteria 6901809
416 2643968152 2643221592 Bacteria 6608788
417 2644142492 2643221625 Bacteria 6512927
418 2644277009 2643221648 Bacteria 6521465
419 2831869124 2831864461 Bacteria 6502356
420 2886854727 2886848708 Bacteria 5632523
421 Ga0068860_100350427
422 JGI24740J21852_10017822
423 rootH1_10012732
424 rootH1_10029007
425 rootH1_10073131
426 rootH2_10008565
427 rootL2_10001240
428 rootL2_10036768
429 rootH1_10004543
430 rootH1_10020876
431 rootH1_10114536
432 Ga0055539_1000222
433 Ga0055533_1000016
434 Ga0055525_1001565
435 Ga0055526_1016751
436 Ga0055524_1001208
437 Ga0055524_1020305
438 Ga0055540_1018583
439 Ga0055531_10016340
440 Ga0055531_10020845
441 Ga0055543_1005869
442 Ga0065165_1000101
443 Ga0065165_1003212
444 Ga0070683_100081025
445 Ga0070670_100073176
446 Ga0070670_100090652
447 Ga0070670_100307830
448 Ga0070677_10069212
449 Ga0068869_100002073
450 Ga0070666_10619111
451 Ga0068868_100028923
452 Ga0068868_100226270
453 Ga0068868_100422966
454 Ga0068868_101064377
455 Ga0070660_100008567
456 Ga0070660_100129104
457 Ga0070661_100759093
458 Ga0070669_100014598
459 Ga0070675_100013374
460 Ga0070675_100017521
461 Ga0070675_100155314
462 Ga0070675_100605402
463 Ga0070671_100037288
464 Ga0070671_100489407
465 Ga0070671_101107225
466 Ga0070674_100484646
467 Ga0070673_100244544
468 Ga0070659_100001014
469 Ga0070659_100036674
470 Ga0070659_100058246
471 Ga0070659_100660837
472 Ga0070667_100005406
473 Ga0070667_100115482
474 Ga0070667_100649903
475 Ga0070663_100069807
476 Ga0070663_100098591
477 Ga0070663_100470952
478 Ga0070678_100027486
479 Ga0070678_100085720
480 Ga0070678_100290236
481 Ga0070678_100309939
482 Ga0070678_100329939
483 Ga0070678_100608189
484 Ga0070662_100001463
485 Ga0070662_100029212
486 Ga0070662_100770948
487 Ga0068867_100000081
488 Ga0068867_100130650
489 Ga0068867_100259250
490 Ga0068867_100412845
491 Ga0070684_100009956
492 Ga0070684_100229615
493 Ga0068853_100014841
494 Ga0068853_100327725
495 Ga0068853_100810877
496 Ga0070672_100000561
497 Ga0070672_100007343
498 Ga0070672_100128062
499 Ga0070672_100141505
500 Ga0070672_100142019
501 Ga0070696_100416091
502 Ga0070693_100010390
503 Ga0070693_100062743
504 Ga0070665_101091688
505 Ga0068855_100015124
506 Ga0070664_100006317
507 Ga0070664_100017065
508 Ga0068857_100043587
509 Ga0068857_100150873
510 Ga0068854_100019891
511 Ga0068856_100025953
512 Ga0068856_100267419
513 Ga0070702_100029130
514 Ga0068852_100005075
515 Ga0068852_100010828
516 Ga0068852_100012059
517 Ga0068852_100039409
518 Ga0068852_100139075
519 Ga0068852_100354563
520 Ga0068852_100978250
521 Ga0068859_100041195
522 Ga0068864_100010110
523 Ga0068864_100029161
524 Ga0068861_100037649
525 Ga0068861_100942130
526 Ga0068851_10008878
527 Ga0068851_10058459
528 Ga0068851_10365253
529 Ga0068863_100066821
530 Ga0068863_100161499
531 Ga0068858_100006772
532 Ga0068858_100010785
533 Ga0068860_100016235
534 Ga0068862_100051041
535 Ga0075362_10075133
536 Ga0075366_10017250
537 Ga0075366_10048334
538 Ga0075366_10095312
539 Ga0075366_10131920
540 Ga0075366_10589950
541 Ga0097621_100233066
542 Ga0075370_10025312
543 Ga0075370_10274214
544 Ga0068871_100038377
545 Ga0068871_100168082
546 Ga0068871_100568266
547 Ga0075430_100005009
548 Ga0075434_100136268
549 Ga0075429_100004433
550 Ga0068865_100122092
551 Ga0097620_100041196
552 Ga0099823_1003331
553 Ga0105240_10012261
554 Ga0105240_10515623
555 Ga0105245_10063572
556 Ga0114129_10033378
557 Ga0114129_10587260
558 Ga0105243_10019016
559 Ga0105243_10063371
560 Ga0105243_10983724
561 Ga0105248_10200084
562 Ga0105237_10000407
563 Ga0105237_10074321
564 Ga0105238_10015817
565 Ga0105239_10000335
566 Ga0105246_10292976
567 Ga0157319_1000008
568 Ga0157370_10352910
569 Ga0157369_10020908
570 Ga0157374_10026288
571 Ga0157374_10037450
572 Ga0157378_10054411
573 Ga0157378_10320850
574 Ga0163162_10022700
575 Ga0157372_10071953
576 Ga0157372_10088826
577 Ga0157375_10026356
578 Ga0157375_10358498
579 Ga0163163_10571833
580 Ga0163163_11158660
581 Ga0157380_10011366
582 Ga0157377_10000032
583 Ga0157379_10003468
584 Ga0157379_10011312
585 Ga0157379_10167268
586 Ga0157376_10017149
587 Ga0157376_10187443
588 Ga0163161_10007666
589 Ga0163161_10266429
590 Ga0209674_100041
591 Ga0209563_100043
592 Ga0209677_100096
593 Ga0209673_1006020
594 Ga0209673_1008957
595 Ga0209564_1000008
596 Ga0209050_1001143
597 Ga0209050_1001274
598 Ga0209256_1000413
599 Ga0209256_1003828
600 Ga0209051_1002377
601 Ga0209257_1002153
602 Ga0209257_1008878
603 Ga0207656_10010797
604 Ga0207656_10123071
605 Ga0207688_10034568
606 Ga0207680_10152307
607 Ga0207645_10126527
608 Ga0207645_10433611
609 Ga0207705_10034357
610 Ga0207684_10084816
611 Ga0207671_10006217
612 Ga0207671_11028198
613 Ga0207662_10124830
614 Ga0207657_10039936
615 Ga0207657_10254870
616 Ga0207649_10000951
617 Ga0207649_10010331
618 Ga0207649_10484767
619 Ga0207649_10555511
620 Ga0207681_10009855
621 Ga0207694_10023194
622 Ga0207694_10465634
623 Ga0207650_10009477
624 Ga0207650_10010846
625 Ga0207650_10169301
626 Ga0207650_10309401
627 Ga0207659_10003636
628 Ga0207659_10007851
629 Ga0207659_10243301
630 Ga0207687_10045195
631 Ga0207687_10736267
632 Ga0207644_10727000
633 Ga0207690_10000658
634 Ga0207690_10165038
635 Ga0207690_10281178
636 Ga0207706_10011820
637 Ga0207706_10069247
638 Ga0207706_10781748
639 Ga0207709_10017165
640 Ga0207709_10030049
641 Ga0207691_10004379
642 Ga0207691_10008676
643 Ga0207691_10053656
644 Ga0207691_10241570
645 Ga0207691_10312694
646 Ga0207711_10048696
647 Ga0207711_10049262
648 Ga0207689_10031035
649 Ga0207661_10067819
650 Ga0207661_10133907
651 Ga0207679_10003109
652 Ga0207679_10044097
653 Ga0207679_10869898
654 Ga0207667_10030541
655 Ga0207667_10378761
656 Ga0207640_10107798
657 Ga0207658_10045134
658 Ga0207658_10430467
659 Ga0207677_10074554
660 Ga0207677_10823586
661 Ga0207703_10003521
662 Ga0207639_10005163
663 Ga0207639_10028226
664 Ga0207639_10083308
665 Ga0207639_10779034
666 Ga0207678_10133052
667 Ga0207678_10154971
668 Ga0207678_10378868
669 Ga0207702_10017844
670 Ga0207641_10470520
671 Ga0207648_10001296
672 Ga0207648_10522033
673 Ga0207648_10683313
674 Ga0207648_10877629
675 Ga0207676_10005732
676 Ga0207676_10040483
677 Ga0207674_10011435
678 Ga0207674_10079074
679 Ga0207675_100063049
680 Ga0207675_100245072
681 Ga0207683_10036299
682 Ga0207683_10122074
683 Ga0207683_10269972
684 Ga0207683_10869652
685 Ga0207698_10009766
686 Ga0207698_10017480
687 Ga0207698_10024114
688 Ga0207698_10106923
689 Ga0207698_10204334
690 Ga0209389_1002327
691 Ga0209981_1009144
692 Ga0209996_1001333
693 Ga0209995_1001463
694 Ga0209968_1000844
695 Ga0209966_1000309
696 Ga0209974_10014753
697 Ga0268265_10179089
698 Ga0268264_10004863
699 Ga0268264_10577706
700 Ga0268264_10775694
701 Ga0307515_10000609
702 Ga0307515_10013045
703 Ga0307515_10035839
704 Ga0307515_10344904
705 Ga0268256_1037868
706 Ga0307512_10251299
707 Ga0307513_10008116
708 Ga0307513_10093821
709 Ga0307513_10669509
710 Ga0307509_10052528
711 Ga0307509_10241377
712 Ga0307408_100242317
713 Ga0307408_100275529
714 Ga0307508_10004265
715 Ga0307514_10023638
716 Ga0307405_10958469
717 Ga0307413_10164467
718 Ga0307410_10018877
719 Ga0307406_10052508
720 Ga0307406_10294729
721 Ga0307412_10244626
722 Ga0307409_100375720
723 Ga0307416_100075710
724 Ga0307416_100502629
725 Ga0307411_10914847
726 Ga0307507_10020165
727 Ga0373952_0006469
728 Ga0373932_0023814
729 Ga0373945_0371677
730 Ga0373946_0523804
731 Ga0373935_0768996
732 Ga0373927_0066852
733 Ga0373947_0055986
734 Ga0373947_0230645
735 Ga0373937_0021907
736 Ga0373937_0140670
737 Ga0373937_0688594
738 Ga0373925_0083763
739 Ga0395905_0041281
740 Ga0395905_0068368
741 Ga0436361_0869713
742 Ga0436361_1211597
743 Ga0451795_1564080
744 Ga0451800_1145861
745 Ga0451802_1553398
746 Ga0451833_1000255
747 Ga0451833_1462293
748 Ga0451847_0270602
749 Ga0451843_0840498
750 Ga0451853_1659374
751 Ga0439450_019911
752 Ga0450898_007844
753 Ga0439459_0002793
754 Ga0439464_0025574
755 Ga0466963_0211530
756 Ga0453684_0016471
757 Ga0466968_0017780
758 Ga0451576_0051630
759 Ga0451576_0140364
760 Ga0451576_0528239
761 Ga0495650_0002349
762 Ga0495580_0064395
763 Ga0495580_0428726
764 Ga0495630_0333439
765 Ga0495637_0122034
766 Ga0495644_0350444
767 Ga0495587_0385282
768 Ga0495621_0076381
769 Ga0495621_0115794
770 Ga0495667_0446157
771 Ga0495667_0588839
772 Ga0495668_0315559
773 Ga0495625_0003970
774 Ga0495647_0015931
775 Ga0495647_0059987
776 Ga0495658_0129049
777 Ga0495613_0109353
778 Ga0495670_0009125
779 Ga0495600_0523866
780 Ga0495677_0146175
781 Ga0495686_0152421
782 Ga0496100_0483650
783 Ga0496102_0020340
784 Ga0496102_0038755
785 Ga0496102_0147184
786 Ga0496105_0106834
787 Ga0496106_0027831
788 Ga0496108_0007144
789 Ga0496108_0037516
790 Ga0496111_0417013
791 Ga0496113_0322877
792 Ga0496115_0026390
793 Ga0496121_0014590
794 Ga0496124_0039444
795 Ga0496125_0005030
796 Ga0501043_0000057
797 Ga0501046_0000075
798 Ga0501047_0000081
799 Ga0501048_0002921
800 Ga0501075_0592373
801 Ga0501198_000012
802 Ga0501206_010370
803 Ga0501206_021838
804 Ga0501222_000010
805 Ga0501222_015226
806 Ga0501233_122660
807 Ga0501035_0277374
808 Ga0501044_0869039
809 Ga0501045_0002738
810 nmdc:mga03683_443763_c1
811 nmdc:mga0k408_194143_c1
812 nmdc:mga0k408_212969_c1
813 nmdc:mga0k408_36670_c1
814 nmdc:mga0k408_58976_c1
815 nmdc:mga0k408_59390_c1
816 nmdc:mga06z11_564636_c1
817 nmdc:mga07m45_90301_c1
818 nmdc:mga05p37_268564_c1
819 nmdc:mga09592_3580_c1
820 nmdc:mga0qj67_83522_c1
821 nmdc:mga0n895_278173_c1
822 nmdc:mga0rr50_43851_c1
823 Ga0495601_0303183
824 Ga0495595_0139271
825 Ga0500578_0003036
826 Ga0500651_0358913
827 Ga0500593_002996
828 Ga0500658_0161929
829 Ga0500604_0107591
830 Ga0500622_0010080
831 Ga0500587_011481
832 2587724967
833 2587731669
834 2587754170
835 2588292470
836 2643968152
837 2644142492
838 2644277009
839 2831869124
840 2886854727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

9

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vlc-assembly1.cif.gz_B crystal structure of udp-glcnac 2-epimerase from neisseria meningitidis bound to udp-glcnac 0.7767 39 101
4q3v-assembly3.cif.gz_C crystal structure of schistosoma mansoni arginase in complex with inhibitor bec 0.7102 40 97
8cwo-assembly1.cif.gz_K cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.6813 2 105
6q1i-assembly1.cif.gz_A gh5-4 broad specificity endoglucanase from clostrdium longisporum 0.674 40 106
7pal-assembly1.cif.gz_J 70s ribosome with a- and p-site trnas in mycoplasma pneumoniae cells 0.6736 3 103
ID Description Score Start End Superfamily
af_Q7KWM7_19_160_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.694 9 41 2.60.40.150
af_O86374_10_144_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.6794 47 116 3.40.120.10
af_Q5AK66_25_194_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6739 11 41 2.60.40.150
af_Q91W97_514_654_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6709 2 74 3.30.420.40
1xmxA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein VC1899 like domain (Restriction endonuclease-like) 0.6688 47 101 3.40.50.10770
ID Description Score Start End GO Terms
AF-A0A7V9BFS8-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.7312 2 113 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A357R3Y6-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.7282 2 108 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A1W9SNB7-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.7054 2 125 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A357R3Y6-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.7048 2 108 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A7V9BFS8-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.704 2 113 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872

Map