F439748

General Info

Members Datasets Scaffolds Average Seq Length
420 241 840 253

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10101959|Ga0105246_101019592
Length 292
Sequence MRHLIALFTTWYCNTKKALWLTFPFNLGLSPLLSPSEPDSMIDIVILCVFAFSAGLIDAAVGGGGLIQIPALFNVLPTAQPAALLGTNKVAAACGTAFAARSFVRKVVINWSLVIPAASAAFVMSFFGAATVSFVPQSVIRPAVLVLIVLMAIYTFWKKDFGALHKPMHIGTKEKLLAIVIGGAIGFYDGLFGPGTGSFLIFLFIRCFAFDFLHASASAKLVNIATNVAALMFFIPTGNVLYLIAIPMAAFNILGALTGTWLAVHKGAPFVRALFLVLLLILIGKLSYDLFV

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
59 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
77 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
81 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
82 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
83 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
84 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
85 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
86 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
87 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
88 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
89 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
92 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
95 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
170 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
171 2511231004 Pseudomonas sp. GM102 Isolate Nodule
172 2511231007 Pseudomonas sp. GM18 Isolate Nodule
173 2511231016 Pseudomonas sp. GM50 Isolate Nodule
174 2511231022 Pseudomonas sp. GM79 Isolate Nodule
175 2511231024 Pseudomonas sp. GM84 Isolate Nodule
176 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
177 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
178 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
179 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
180 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
181 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
182 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
183 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
184 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
185 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
186 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
187 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
188 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
189 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
190 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
191 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
192 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
193 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
194 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
195 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
196 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
197 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
198 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
199 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
200 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
201 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
202 2765235841 Pseudomonas putida AA7 Isolate Unclassified
203 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
204 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
205 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
206 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
207 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
208 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
209 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
210 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
211 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
212 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
213 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
214 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
215 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
216 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
217 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
218 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
219 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
220 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
221 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
222 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
223 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
224 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
225 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
226 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
227 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
228 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
229 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
230 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
231 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
232 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
233 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
234 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
235 8052494512 Pseudomonas putida LD6 Isolate Unclassified
236 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
237 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
238 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
239 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
240 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
241 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.1
Metatranscriptomes 0
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 3.81
Nodule 1.67
Rhizoplane 5.24
Rhizosphere 72.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10101959 3300011119 Bacteria 2092
2 SwRhRL2b_contig_1738858 2162886007 Bacteria 5335
3 SwRhRL2b_contig_3325370 2162886007 Bacteria 2520
4 SwRhRL2b_contig_938429 2162886007 Bacteria 2953
5 JGI25162J39368_1000045 3300002737 Bacteria 170731
6 JGI25163J39215_1000286 3300002771 Bacteria 17369
7 JGI25164J39214_1000147 3300002772 Bacteria 67564
8 JGI25165J46597_1000086 3300003214 Bacteria 170731
9 rootL2_10000116 3300003322 Bacteria 29881
10 Ga0055536_1002193 3300003781 Bacteria 11123
11 Ga0055536_1020649 3300003781 Bacteria 2026
12 Ga0058692_1000007 3300003856 Bacteria 366313
13 Ga0058692_1000061 3300003856 Bacteria 98304
14 Ga0058692_1015011 3300003856 Bacteria 1756
15 Ga0065703_1000503 3300005272 Bacteria 59697
16 Ga0065714_10002075 3300005288 Bacteria 2143
17 Ga0065714_10003804 3300005288 Bacteria 6218
18 Ga0065714_10013264 3300005288 Bacteria 3687
19 Ga0065704_10004354 3300005289 Bacteria 3832
20 Ga0065704_10022617 3300005289 Bacteria 1006
21 Ga0065704_10070431 3300005289 Bacteria 25069
22 Ga0065704_10070585 3300005289 Bacteria 19742
23 Ga0065704_10075826 3300005289 Bacteria 5398
24 Ga0065704_10123544 3300005289 Bacteria 1731
25 Ga0065712_10072326 3300005290 Bacteria 4803
26 Ga0070660_100104571 3300005339 Bacteria 2246
27 Ga0070669_100002127 3300005353 Bacteria 14327
28 Ga0070673_100074480 3300005364 Bacteria 2736
29 Ga0070659_100102304 3300005366 Bacteria 2306
30 Ga0070708_100339059 3300005445 Bacteria 1417
31 Ga0070665_100023617 3300005548 Bacteria 6191
32 Ga0070664_100341893 3300005564 Bacteria 1359
33 Ga0075364_10006630 3300006051 Bacteria 6820
34 Ga0075364_10063633 3300006051 Bacteria 2422
35 Ga0099823_1000006 3300006944 Bacteria 135028
36 Ga0105251_10005420 3300009011 Bacteria 8341
37 Ga0105251_10064698 3300009011 Bacteria 1713
38 Ga0105251_10081602 3300009011 Bacteria 1494
39 Ga0105251_10162950 3300009011 Bacteria 1005
40 Ga0105244_10001830 3300009036 Bacteria 16634
41 Ga0105244_10002834 3300009036 Bacteria 12867
42 Ga0105244_10003046 3300009036 Bacteria 12298
43 Ga0105244_10004469 3300009036 Bacteria 9607
44 Ga0105244_10018008 3300009036 Bacteria 3976
45 Ga0105244_10037841 3300009036 Bacteria 2519
46 Ga0105244_10042874 3300009036 Bacteria 2337
47 Ga0105244_10138914 3300009036 Bacteria 1170
48 Ga0105250_10000034 3300009092 Bacteria 157547
49 Ga0105250_10006006 3300009092 Bacteria 5356
50 Ga0105250_10024879 3300009092 Bacteria 2413
51 Ga0105250_10040142 3300009092 Bacteria 1877
52 Ga0105240_10003913 3300009093 Bacteria 23003
53 Ga0105247_10033531 3300009101 Bacteria 3123
54 Ga0105247_10203066 3300009101 Bacteria 1333
55 Ga0105243_10000835 3300009148 Bacteria 29277
56 Ga0105243_10002910 3300009148 Bacteria 14172
57 Ga0105243_10138709 3300009148 Bacteria 2072
58 Ga0105243_10142205 3300009148 Bacteria 2048
59 Ga0105243_10142388 3300009148 Bacteria 2047
60 Ga0105249_10000066 3300009553 Bacteria 149801
61 Ga0105246_10074021 3300011119 Bacteria 2406
62 Ga0157371_10000045 3300013102 Bacteria 189065
63 Ga0157371_10011307 3300013102 Bacteria 6889
64 Ga0163162_10366829 3300013306 Bacteria 1573
65 Ga0182008_10000114 3300014497 Bacteria 61409
66 Ga0182008_10000355 3300014497 Bacteria 35722
67 Ga0182008_10040095 3300014497 Bacteria 2339
68 Ga0182006_1000067 3300015261 Bacteria 147932
69 Ga0182006_1000083 3300015261 Bacteria 118727
70 Ga0182006_1026661 3300015261 Bacteria 2364
71 Ga0182007_10000086 3300015262 Bacteria 69920
72 Ga0182007_10000123 3300015262 Bacteria 53953
73 Ga0182005_1000002 3300015265 Bacteria 908499
74 Ga0182005_1001499 3300015265 Bacteria 9312
75 Ga0163161_10001818 3300017792 Bacteria 15573
76 Ga0163161_10031470 3300017792 Bacteria 3780
77 Ga0163161_10133585 3300017792 Bacteria 1874
78 Ga0163161_10150070 3300017792 Bacteria 1771
79 Ga0163161_10221791 3300017792 Bacteria 1464
80 Ga0213872_10000192 3300021361 Bacteria 54234
81 Ga0213872_10000425 3300021361 Bacteria 34570
82 Ga0213872_10008655 3300021361 Bacteria 4913
83 Ga0209760_100019 3300025207 Bacteria 170806
84 Ga0209563_100747 3300025230 Bacteria 10005
85 Ga0207427_100011 3300025231 Bacteria 640076
86 Ga0209437_100044 3300025233 Bacteria 430619
87 Ga0209759_1020617 3300025256 Bacteria 1524
88 Ga0209233_1000057 3300025261 Bacteria 430619
89 Ga0209676_1000292 3300025292 Bacteria 101778
90 Ga0207696_1000018 3300025711 Bacteria 478605
91 Ga0207696_1000107 3300025711 Bacteria 157537
92 Ga0207696_1008887 3300025711 Bacteria 3790
93 Ga0207696_1019592 3300025711 Bacteria 2198
94 Ga0207696_1022162 3300025711 Bacteria 2023
95 Ga0207655_1000014 3300025728 Bacteria 607124
96 Ga0207655_1000081 3300025728 Bacteria 214272
97 Ga0207655_1000094 3300025728 Bacteria 196748
98 Ga0207655_1000180 3300025728 Bacteria 112767
99 Ga0207655_1000481 3300025728 Bacteria 51474
100 Ga0207655_1000613 3300025728 Bacteria 43127
101 Ga0207655_1005084 3300025728 Bacteria 9093
102 Ga0207655_1011118 3300025728 Bacteria 5390
103 Ga0207655_1013557 3300025728 Bacteria 4670
104 Ga0207655_1015549 3300025728 Bacteria 4221
105 Ga0207655_1043712 3300025728 Bacteria 1890
106 Ga0207713_1001535 3300025735 Bacteria 18179
107 Ga0207713_1002863 3300025735 Bacteria 12118
108 Ga0207713_1002900 3300025735 Bacteria 12008
109 Ga0207713_1013034 3300025735 Bacteria 4409
110 Ga0207713_1030764 3300025735 Bacteria 2386
111 Ga0207713_1051544 3300025735 Bacteria 1636
112 Ga0207713_1103430 3300025735 Bacteria 979
113 Ga0207710_10000018 3300025900 Bacteria 346727
114 Ga0207710_10173721 3300025900 Bacteria 1054
115 Ga0207695_10010322 3300025913 Bacteria 11434
116 Ga0207657_10112484 3300025919 Bacteria 2247
117 Ga0207649_10074652 3300025920 Bacteria 2177
118 Ga0207681_10001656 3300025923 Bacteria 14344
119 Ga0207690_10082743 3300025932 Bacteria 2245
120 Ga0207709_10000016 3300025935 Bacteria 478406
121 Ga0207709_10001842 3300025935 Bacteria 14124
122 Ga0207709_10056979 3300025935 Bacteria 2421
123 Ga0207709_10082852 3300025935 Bacteria 2072
124 Ga0207679_10001517 3300025945 Bacteria 14526
125 Ga0207651_10052391 3300025960 Bacteria 2782
126 Ga0207712_10000365 3300025961 Bacteria 40041
127 Ga0209389_1000030 3300027296 Bacteria 139329
128 Ga0209371_1000024 3300027312 Bacteria 477286
129 Ga0209371_1000168 3300027312 Bacteria 98356
130 Ga0209371_1001284 3300027312 Bacteria 17670
131 Ga0207428_10202425 3300027907 Bacteria 1494
132 Ga0268266_10007314 3300028379 Bacteria 9979
133 Ga0265336_10055785 3300028666 Bacteria 1187
134 Ga0265324_10000005 3300029957 Bacteria 347038
135 Ga0265324_10000120 3300029957 Bacteria 61840
136 Ga0268256_1000026 3300030500 Bacteria 477260
137 Ga0268256_1000140 3300030500 Bacteria 98356
138 Ga0268256_1001098 3300030500 Bacteria 17670
139 Ga0265332_10002918 3300031238 Bacteria 8418
140 Ga0265325_10008862 3300031241 Bacteria 5910
141 Ga0265325_10019448 3300031241 Bacteria 3754
142 Ga0265316_10055879 3300031344 Bacteria 3086
143 Ga0307408_100010209 3300031548 Bacteria 6197
144 Ga0307508_10008679 3300031616 Bacteria 9382
145 Ga0265314_10000371 3300031711 Bacteria 61424
146 Ga0265314_10102649 3300031711 Bacteria 1834
147 Ga0307405_10000087 3300031731 Bacteria 39283
148 Ga0307412_10058589 3300031911 Bacteria 2577
149 Ga0307414_10345387 3300032004 Bacteria 1275
150 Ga0436360_0599364 3300039438 Bacteria 7020
151 Ga0436361_0008537 3300039447 Bacteria 11190
152 Ga0436361_0148838 3300039447 Bacteria 11698
153 Ga0436361_0165048 3300039447 Bacteria 2313
154 Ga0436361_0466567 3300039447 Bacteria 20890
155 Ga0436361_0478700 3300039447 Bacteria 3800
156 Ga0436361_0776927 3300039447 Bacteria 26461
157 Ga0436361_0871895 3300039447 Bacteria 3737
158 Ga0436361_0911100 3300039447 Bacteria 2849
159 Ga0436361_0937046 3300039447 Bacteria 4002
160 Ga0436361_1077701 3300039447 Bacteria 4006
161 Ga0439438_006059 3300041405 Bacteria 4338
162 Ga0439438_015581 3300041405 Bacteria 2231
163 Ga0439447_002760 3300041407 Bacteria 6348
164 Ga0439466_0003404 3300041411 Bacteria 6171
165 Ga0439466_0035945 3300041411 Bacteria 1674
166 Ga0439432_002247 3300042006 Bacteria 7285
167 Ga0439432_003047 3300042006 Bacteria 6239
168 Ga0439432_034211 3300042006 Bacteria 1632
169 Ga0439451_000967 3300042009 Bacteria 5548
170 Ga0439451_002470 3300042009 Bacteria 3747
171 Ga0439451_003580 3300042009 Bacteria 3145
172 Ga0439451_004351 3300042009 Bacteria 2876
173 Ga0439451_011617 3300042009 Bacteria 1776
174 Ga0439452_014510 3300042010 Bacteria 2186
175 Ga0439456_000013 3300042013 Bacteria 72544
176 Ga0439456_001614 3300042013 Bacteria 4551
177 Ga0439456_007066 3300042013 Bacteria 2299
178 Ga0439456_011621 3300042013 Bacteria 1822
179 Ga0450890_000102 3300042127 Bacteria 14165
180 Ga0450894_000678 3300042131 Bacteria 5689
181 Ga0450898_000021 3300042134 Bacteria 12898
182 Ga0450900_000420 3300042136 Bacteria 3295
183 Ga0450902_008878 3300042137 Bacteria 1576
184 Ga0450905_008594 3300042142 Bacteria 1399
185 Ga0450905_015900 3300042142 Bacteria 1082
186 Ga0450906_000420 3300042145 Bacteria 8756
187 Ga0450906_003609 3300042145 Bacteria 3308
188 Ga0450907_000661 3300042146 Bacteria 9049
189 Ga0450907_000791 3300042146 Bacteria 7876
190 Ga0439446_0006376 3300042156 Bacteria 3073
191 Ga0450909_000211 3300042185 Bacteria 6788
192 Ga0439434_0040945 3300042435 Bacteria 1423
193 Ga0439464_0004284 3300042439 Bacteria 3645
194 Ga0450901_001132 3300042533 Bacteria 3092
195 Ga0451577_0312608 3300042876 Bacteria 1424
196 Ga0439440_0000207 3300042993 Bacteria 9172
197 Ga0439440_0003972 3300042993 Bacteria 2885
198 Ga0466969_0007183 3300044656 Bacteria 5924
199 Ga0466969_0162668 3300044656 Bacteria 1025
200 Ga0466965_0068166 3300044683 Bacteria 1786
201 Ga0466966_0008473 3300044684 Bacteria 6807
202 Ga0466966_0085724 3300044684 Bacteria 1958
203 Ga0466961_0000034 3300044693 Bacteria 84993
204 Ga0453684_0023821 3300044712 Bacteria 8986
205 Ga0453684_0315658 3300044712 Bacteria 1772
206 Ga0466959_0116595 3300045049 Bacteria 1901
207 Ga0451576_0326362 3300045051 Bacteria 1606
208 Ga0451576_0381105 3300045051 Bacteria 1478
209 Ga0495617_000106 3300046452 Bacteria 61107
210 Ga0495627_000098 3300046453 Bacteria 107446
211 Ga0495627_041164 3300046453 Bacteria 1419
212 Ga0495590_0002968 3300046457 Bacteria 6966
213 Ga0495638_0220201 3300046460 Bacteria 1061
214 Ga0495650_0000911 3300046471 Bacteria 34840
215 Ga0495650_0027569 3300046471 Bacteria 2622
216 Ga0495605_0000114 3300046474 Bacteria 103834
217 Ga0495605_0003516 3300046474 Bacteria 9311
218 Ga0495605_0017352 3300046474 Bacteria 3879
219 Ga0495639_0000001 3300046475 Bacteria 204442
220 Ga0495584_0000568 3300046491 Bacteria 24896
221 Ga0495584_0001357 3300046491 Bacteria 14807
222 Ga0495585_0176343 3300046492 Bacteria 1101
223 Ga0495594_0000316 3300046499 Bacteria 23873
224 Ga0495607_0000540 3300046501 Bacteria 37020
225 Ga0495607_0002462 3300046501 Bacteria 15044
226 Ga0495607_0004537 3300046501 Bacteria 10195
227 Ga0495607_0025288 3300046501 Bacteria 3694
228 Ga0495583_0015737 3300046506 Bacteria 4098
229 Ga0495583_0015740 3300046506 Bacteria 4098
230 Ga0495606_0029645 3300046507 Bacteria 3836
231 Ga0495616_0006099 3300046513 Bacteria 7343
232 Ga0495620_0000037 3300046515 Bacteria 114491
233 Ga0495632_0000322 3300046519 Bacteria 46210
234 Ga0495632_0000376 3300046519 Bacteria 42540
235 Ga0495632_0019019 3300046519 Bacteria 3751
236 Ga0495632_0058202 3300046519 Bacteria 1885
237 Ga0495632_0068838 3300046519 Bacteria 1704
238 Ga0495637_0000499 3300046520 Bacteria 28432
239 Ga0495643_0000508 3300046522 Bacteria 48532
240 Ga0495643_0002114 3300046522 Bacteria 16408
241 Ga0495643_0018850 3300046522 Bacteria 3998
242 Ga0495643_0143317 3300046522 Bacteria 1189
243 Ga0495648_0004207 3300046524 Bacteria 12362
244 Ga0495648_0037242 3300046524 Bacteria 3128
245 Ga0495648_0149539 3300046524 Bacteria 1220
246 Ga0495663_0036198 3300046525 Bacteria 1485
247 Ga0495642_0000130 3300046528 Bacteria 43443
248 Ga0495654_0000088 3300046530 Bacteria 104763
249 Ga0495654_0001422 3300046530 Bacteria 16529
250 Ga0495654_0004399 3300046530 Bacteria 8374
251 Ga0495654_0015477 3300046530 Bacteria 4049
252 Ga0495654_0020233 3300046530 Bacteria 3470
253 Ga0495609_0009473 3300046538 Bacteria 4711
254 Ga0495597_0013595 3300046542 Bacteria 3893
255 Ga0495622_0000347 3300046557 Bacteria 33186
256 Ga0495622_0064346 3300046557 Bacteria 1696
257 Ga0495633_0000348 3300046558 Bacteria 51243
258 Ga0495611_0038780 3300046648 Bacteria 2120
259 Ga0495611_0047722 3300046648 Bacteria 1922
260 Ga0495625_0015261 3300046660 Bacteria 6092
261 Ga0495625_0072342 3300046660 Bacteria 2418
262 Ga0495659_0000002 3300046664 Bacteria 176698
263 Ga0495659_0001572 3300046664 Bacteria 7677
264 Ga0495659_0051139 3300046664 Bacteria 1504
265 Ga0495661_0005739 3300046665 Bacteria 8788
266 Ga0495670_0000112 3300046691 Bacteria 36057
267 Ga0495670_0007568 3300046691 Bacteria 5338
268 Ga0495671_0000160 3300046692 Bacteria 59259
269 Ga0495649_0000013 3300046694 Bacteria 316013
270 Ga0495649_0040404 3300046694 Bacteria 2554
271 Ga0495589_0000123 3300046794 Bacteria 72582
272 Ga0495589_0008445 3300046794 Bacteria 5378
273 Ga0495660_0023253 3300046810 Bacteria 3535
274 Ga0495581_0249386 3300047315 Bacteria 1038
275 Ga0495636_0000509 3300047318 Bacteria 14300
276 Ga0495672_0000773 3300047320 Bacteria 34808
277 Ga0495672_0001686 3300047320 Bacteria 21392
278 Ga0495672_0017970 3300047320 Bacteria 4710
279 Ga0495683_0002700 3300047323 Bacteria 10588
280 Ga0495683_0010376 3300047323 Bacteria 4923
281 Ga0495687_001399 3300047443 Bacteria 22271
282 Ga0495687_004710 3300047443 Bacteria 9045
283 Ga0495685_004423 3300047447 Bacteria 4541
284 Ga0495673_0001694 3300047469 Bacteria 16897
285 Ga0495593_0010536 3300047673 Bacteria 5335
286 Ga0495626_0000031 3300048091 Bacteria 197930
287 Ga0495626_0000631 3300048091 Bacteria 34169
288 Ga0495626_0007799 3300048091 Bacteria 5929
289 Ga0496106_0054502 3300048909 Bacteria 3021
290 Ga0496107_0342615 3300048910 Bacteria 1112
291 Ga0496110_0010019 3300048913 Bacteria 7691
292 Ga0496111_0115168 3300048914 Bacteria 1982
293 Ga0496112_0163312 3300048915 Bacteria 2193
294 Ga0496114_0002999 3300048917 Bacteria 12940
295 Ga0496114_0010046 3300048917 Bacteria 7526
296 Ga0496116_0002307 3300048919 Bacteria 20229
297 Ga0496116_0069253 3300048919 Bacteria 2244
298 Ga0496117_0000001 3300048920 Bacteria 2526244
299 Ga0496117_0005256 3300048920 Bacteria 13737
300 Ga0496117_0008714 3300048920 Bacteria 9585
301 Ga0496117_0027543 3300048920 Bacteria 4425
302 Ga0496117_0030122 3300048920 Bacteria 4170
303 Ga0496118_0000002 3300048921 Bacteria 1690764
304 Ga0496118_0002113 3300048921 Bacteria 27843
305 Ga0496118_0005087 3300048921 Bacteria 15130
306 Ga0496118_0009868 3300048921 Bacteria 9548
307 Ga0496118_0018468 3300048921 Bacteria 6292
308 Ga0496118_0043810 3300048921 Bacteria 3512
309 Ga0496119_0030703 3300048922 Bacteria 3618
310 Ga0496120_0020769 3300048923 Bacteria 4164
311 Ga0496121_0002366 3300048924 Bacteria 29022
312 Ga0496121_0004709 3300048924 Bacteria 18050
313 Ga0496122_0001785 3300048925 Bacteria 32973
314 Ga0496122_0002729 3300048925 Bacteria 24434
315 Ga0496122_0002892 3300048925 Bacteria 23489
316 Ga0496122_0038877 3300048925 Bacteria 3802
317 Ga0496122_0120172 3300048925 Bacteria 1696
318 Ga0496122_0189507 3300048925 Bacteria 1216
319 Ga0496123_0000136 3300048926 Bacteria 152399
320 Ga0496123_0000676 3300048926 Bacteria 56312
321 Ga0496123_0001347 3300048926 Bacteria 34616
322 Ga0496123_0007417 3300048926 Bacteria 10340
323 Ga0496123_0011341 3300048926 Bacteria 7740
324 Ga0496123_0028086 3300048926 Bacteria 4173
325 Ga0496123_0137536 3300048926 Bacteria 1341
326 Ga0496124_0001317 3300048927 Bacteria 37470
327 Ga0496124_0004098 3300048927 Bacteria 17235
328 Ga0496124_0028201 3300048927 Bacteria 5025
329 Ga0496124_0051919 3300048927 Bacteria 3486
330 Ga0496124_0078431 3300048927 Bacteria 2722
331 Ga0496124_0224607 3300048927 Bacteria 1409
332 Ga0496125_0000536 3300048928 Bacteria 65389
333 Ga0496125_0017412 3300048928 Bacteria 6851
334 Ga0496125_0102744 3300048928 Bacteria 2099
335 Ga0496125_0207370 3300048928 Bacteria 1276
336 Ga0496126_0007964 3300048929 Bacteria 11512
337 Ga0496126_0014011 3300048929 Bacteria 8125
338 Ga0496126_0021965 3300048929 Bacteria 6223
339 Ga0496126_0060408 3300048929 Bacteria 3409
340 Ga0495678_000420 3300049459 Bacteria 42717
341 Ga0495678_002036 3300049459 Bacteria 14478
342 Ga0495678_017898 3300049459 Bacteria 3198
343 Ga0495682_0003332 3300049460 Bacteria 7171
344 Ga0495682_0052746 3300049460 Bacteria 1477
345 Ga0495682_0095323 3300049460 Bacteria 1068
346 Ga0501034_0000969 3300049571 Bacteria 41330
347 Ga0501034_0199640 3300049571 Bacteria 1959
348 Ga0500608_062635 3300053122 Bacteria 1776
349 Ga0500659_0001037 3300053135 Bacteria 17855
350 2511257501 2511231004 Bacteria 6669789
351 2511270374 2511231007 Bacteria 6306603
352 2511325544 2511231016 Bacteria 6704427
353 2511364714 2511231022 Bacteria 6719296
354 2511372858 2511231024 Bacteria 5835885
355 2526212014 2526164512 Bacteria 4025691
356 2547373858 2547132103 Bacteria 5115736
357 2555247340 2554235231 Bacteria 5215788
358 2599769742 2599185248 Bacteria 6696816
359 2599878324 2599185288 Bacteria 6666191
360 2599889064 2599185289 Bacteria 6778765
361 2599901575 2599185291 Bacteria 6775623
362 2599947525 2599185303 Bacteria 6512725
363 2599959233 2599185305 Bacteria 6748700
364 2599964501 2599185306 Bacteria 6637356
365 2599975626 2599185308 Bacteria 6621546
366 2600007221 2599185313 Bacteria 6658188
367 2600009737 2599185314 Bacteria 6621749
368 2600020544 2599185315 Bacteria 6771107
369 2600055057 2599185321 Bacteria 6764560
370 2600071706 2599185324 Bacteria 6590677
371 2601668111 2600255292 Bacteria 6300551
372 2624491255 2623620446 Bacteria 6500345
373 2640735897 2639762793 Bacteria 3943681
374 2644285599 2643221650 Bacteria 7029547
375 2644364340 2643221665 Bacteria 4699229
376 2671093515 2667528170 Bacteria 6786960
377 2678229169 2675903507 Bacteria 3737791
378 2738808594 2738541294 Bacteria 6925949
379 2738895954 2738541309 Bacteria 6926455
380 2745159831 2744054655 Bacteria 3552603
381 2765583119 2765235841 Bacteria 6137024
382 2774390302 2773857761 Bacteria 3837365
383 2774437843 2773857770 Bacteria 3911866
384 2807407821 2806310737 Bacteria 5751088
385 2807456124 2806310745 Bacteria 5742165
386 2808977262 2808606385 Bacteria 6711065
387 2808992417 2808606388 Bacteria 6706662
388 2825656848 2825651385 Bacteria 6715909
389 2843693440 2843690924 Bacteria 5169057
390 2844670356 2844665904 Bacteria 6817974
391 2846033891 2846033681 Bacteria 4377894
392 2846038879 2846037992 Bacteria 4526407
393 2852613380 2852612431 Bacteria 6885235
394 2852668884 2852667396 Bacteria 6885555
395 2857549844 2857547612 Bacteria 6179999
396 2885082938 2885080285 Bacteria 6355622
397 2912964438 2912963787 Bacteria 5646108
398 2916700316 2916699645 Bacteria 3568996
399 2919184658 2919182534 Bacteria 3907101
400 2919507620 2919506607 Bacteria 3392955
401 2919701231 2919697872 Bacteria 6553725
402 2928516732 2928515477 Bacteria 4448421
403 2932411816 2932410948 Bacteria 6312192
404 2932418617 2932416698 Bacteria 6315112
405 2939651946 2939651529 Bacteria 5895393
406 2945928787 2945928738 Bacteria 6053221
407 2984571808 2984568884 Bacteria 3884413
408 2998346583 2998344455 Bacteria 4222996
409 3007423744 3007419365 Bacteria 7026924
410 3007808025 3007803356 Bacteria 5931491
411 3007876596 3007872151 Bacteria 5268868
412 8019778149 8019775933 Bacteria 6858656
413 8033234190 8033232454 Bacteria 3202805
414 8052498063 8052494512 Bacteria 5765634
415 8054930172 8054929484 Bacteria 5599761
416 8056118384 8056115690 Bacteria 5527654
417 8056123977 8056120720 Bacteria 5758328
418 8056139717 8056137416 Bacteria 6147080
419 8056160208 8056155041 Bacteria 6486948
420 8056165127 8056161164 Bacteria 6106669
421 Ga0105246_10101959
422 SwRhRL2b_contig_1738858
423 SwRhRL2b_contig_3325370
424 SwRhRL2b_contig_938429
425 JGI25162J39368_1000045
426 JGI25163J39215_1000286
427 JGI25164J39214_1000147
428 JGI25165J46597_1000086
429 rootL2_10000116
430 Ga0055536_1002193
431 Ga0055536_1020649
432 Ga0058692_1000007
433 Ga0058692_1000061
434 Ga0058692_1015011
435 Ga0065703_1000503
436 Ga0065714_10002075
437 Ga0065714_10003804
438 Ga0065714_10013264
439 Ga0065704_10004354
440 Ga0065704_10022617
441 Ga0065704_10070431
442 Ga0065704_10070585
443 Ga0065704_10075826
444 Ga0065704_10123544
445 Ga0065712_10072326
446 Ga0070660_100104571
447 Ga0070669_100002127
448 Ga0070673_100074480
449 Ga0070659_100102304
450 Ga0070708_100339059
451 Ga0070665_100023617
452 Ga0070664_100341893
453 Ga0075364_10006630
454 Ga0075364_10063633
455 Ga0099823_1000006
456 Ga0105251_10005420
457 Ga0105251_10064698
458 Ga0105251_10081602
459 Ga0105251_10162950
460 Ga0105244_10001830
461 Ga0105244_10002834
462 Ga0105244_10003046
463 Ga0105244_10004469
464 Ga0105244_10018008
465 Ga0105244_10037841
466 Ga0105244_10042874
467 Ga0105244_10138914
468 Ga0105250_10000034
469 Ga0105250_10006006
470 Ga0105250_10024879
471 Ga0105250_10040142
472 Ga0105240_10003913
473 Ga0105247_10033531
474 Ga0105247_10203066
475 Ga0105243_10000835
476 Ga0105243_10002910
477 Ga0105243_10138709
478 Ga0105243_10142205
479 Ga0105243_10142388
480 Ga0105249_10000066
481 Ga0105246_10074021
482 Ga0157371_10000045
483 Ga0157371_10011307
484 Ga0163162_10366829
485 Ga0182008_10000114
486 Ga0182008_10000355
487 Ga0182008_10040095
488 Ga0182006_1000067
489 Ga0182006_1000083
490 Ga0182006_1026661
491 Ga0182007_10000086
492 Ga0182007_10000123
493 Ga0182005_1000002
494 Ga0182005_1001499
495 Ga0163161_10001818
496 Ga0163161_10031470
497 Ga0163161_10133585
498 Ga0163161_10150070
499 Ga0163161_10221791
500 Ga0213872_10000192
501 Ga0213872_10000425
502 Ga0213872_10008655
503 Ga0209760_100019
504 Ga0209563_100747
505 Ga0207427_100011
506 Ga0209437_100044
507 Ga0209759_1020617
508 Ga0209233_1000057
509 Ga0209676_1000292
510 Ga0207696_1000018
511 Ga0207696_1000107
512 Ga0207696_1008887
513 Ga0207696_1019592
514 Ga0207696_1022162
515 Ga0207655_1000014
516 Ga0207655_1000081
517 Ga0207655_1000094
518 Ga0207655_1000180
519 Ga0207655_1000481
520 Ga0207655_1000613
521 Ga0207655_1005084
522 Ga0207655_1011118
523 Ga0207655_1013557
524 Ga0207655_1015549
525 Ga0207655_1043712
526 Ga0207713_1001535
527 Ga0207713_1002863
528 Ga0207713_1002900
529 Ga0207713_1013034
530 Ga0207713_1030764
531 Ga0207713_1051544
532 Ga0207713_1103430
533 Ga0207710_10000018
534 Ga0207710_10173721
535 Ga0207695_10010322
536 Ga0207657_10112484
537 Ga0207649_10074652
538 Ga0207681_10001656
539 Ga0207690_10082743
540 Ga0207709_10000016
541 Ga0207709_10001842
542 Ga0207709_10056979
543 Ga0207709_10082852
544 Ga0207679_10001517
545 Ga0207651_10052391
546 Ga0207712_10000365
547 Ga0209389_1000030
548 Ga0209371_1000024
549 Ga0209371_1000168
550 Ga0209371_1001284
551 Ga0207428_10202425
552 Ga0268266_10007314
553 Ga0265336_10055785
554 Ga0265324_10000005
555 Ga0265324_10000120
556 Ga0268256_1000026
557 Ga0268256_1000140
558 Ga0268256_1001098
559 Ga0265332_10002918
560 Ga0265325_10008862
561 Ga0265325_10019448
562 Ga0265316_10055879
563 Ga0307408_100010209
564 Ga0307508_10008679
565 Ga0265314_10000371
566 Ga0265314_10102649
567 Ga0307405_10000087
568 Ga0307412_10058589
569 Ga0307414_10345387
570 Ga0436360_0599364
571 Ga0436361_0008537
572 Ga0436361_0148838
573 Ga0436361_0165048
574 Ga0436361_0466567
575 Ga0436361_0478700
576 Ga0436361_0776927
577 Ga0436361_0871895
578 Ga0436361_0911100
579 Ga0436361_0937046
580 Ga0436361_1077701
581 Ga0439438_006059
582 Ga0439438_015581
583 Ga0439447_002760
584 Ga0439466_0003404
585 Ga0439466_0035945
586 Ga0439432_002247
587 Ga0439432_003047
588 Ga0439432_034211
589 Ga0439451_000967
590 Ga0439451_002470
591 Ga0439451_003580
592 Ga0439451_004351
593 Ga0439451_011617
594 Ga0439452_014510
595 Ga0439456_000013
596 Ga0439456_001614
597 Ga0439456_007066
598 Ga0439456_011621
599 Ga0450890_000102
600 Ga0450894_000678
601 Ga0450898_000021
602 Ga0450900_000420
603 Ga0450902_008878
604 Ga0450905_008594
605 Ga0450905_015900
606 Ga0450906_000420
607 Ga0450906_003609
608 Ga0450907_000661
609 Ga0450907_000791
610 Ga0439446_0006376
611 Ga0450909_000211
612 Ga0439434_0040945
613 Ga0439464_0004284
614 Ga0450901_001132
615 Ga0451577_0312608
616 Ga0439440_0000207
617 Ga0439440_0003972
618 Ga0466969_0007183
619 Ga0466969_0162668
620 Ga0466965_0068166
621 Ga0466966_0008473
622 Ga0466966_0085724
623 Ga0466961_0000034
624 Ga0453684_0023821
625 Ga0453684_0315658
626 Ga0466959_0116595
627 Ga0451576_0326362
628 Ga0451576_0381105
629 Ga0495617_000106
630 Ga0495627_000098
631 Ga0495627_041164
632 Ga0495590_0002968
633 Ga0495638_0220201
634 Ga0495650_0000911
635 Ga0495650_0027569
636 Ga0495605_0000114
637 Ga0495605_0003516
638 Ga0495605_0017352
639 Ga0495639_0000001
640 Ga0495584_0000568
641 Ga0495584_0001357
642 Ga0495585_0176343
643 Ga0495594_0000316
644 Ga0495607_0000540
645 Ga0495607_0002462
646 Ga0495607_0004537
647 Ga0495607_0025288
648 Ga0495583_0015737
649 Ga0495583_0015740
650 Ga0495606_0029645
651 Ga0495616_0006099
652 Ga0495620_0000037
653 Ga0495632_0000322
654 Ga0495632_0000376
655 Ga0495632_0019019
656 Ga0495632_0058202
657 Ga0495632_0068838
658 Ga0495637_0000499
659 Ga0495643_0000508
660 Ga0495643_0002114
661 Ga0495643_0018850
662 Ga0495643_0143317
663 Ga0495648_0004207
664 Ga0495648_0037242
665 Ga0495648_0149539
666 Ga0495663_0036198
667 Ga0495642_0000130
668 Ga0495654_0000088
669 Ga0495654_0001422
670 Ga0495654_0004399
671 Ga0495654_0015477
672 Ga0495654_0020233
673 Ga0495609_0009473
674 Ga0495597_0013595
675 Ga0495622_0000347
676 Ga0495622_0064346
677 Ga0495633_0000348
678 Ga0495611_0038780
679 Ga0495611_0047722
680 Ga0495625_0015261
681 Ga0495625_0072342
682 Ga0495659_0000002
683 Ga0495659_0001572
684 Ga0495659_0051139
685 Ga0495661_0005739
686 Ga0495670_0000112
687 Ga0495670_0007568
688 Ga0495671_0000160
689 Ga0495649_0000013
690 Ga0495649_0040404
691 Ga0495589_0000123
692 Ga0495589_0008445
693 Ga0495660_0023253
694 Ga0495581_0249386
695 Ga0495636_0000509
696 Ga0495672_0000773
697 Ga0495672_0001686
698 Ga0495672_0017970
699 Ga0495683_0002700
700 Ga0495683_0010376
701 Ga0495687_001399
702 Ga0495687_004710
703 Ga0495685_004423
704 Ga0495673_0001694
705 Ga0495593_0010536
706 Ga0495626_0000031
707 Ga0495626_0000631
708 Ga0495626_0007799
709 Ga0496106_0054502
710 Ga0496107_0342615
711 Ga0496110_0010019
712 Ga0496111_0115168
713 Ga0496112_0163312
714 Ga0496114_0002999
715 Ga0496114_0010046
716 Ga0496116_0002307
717 Ga0496116_0069253
718 Ga0496117_0000001
719 Ga0496117_0005256
720 Ga0496117_0008714
721 Ga0496117_0027543
722 Ga0496117_0030122
723 Ga0496118_0000002
724 Ga0496118_0002113
725 Ga0496118_0005087
726 Ga0496118_0009868
727 Ga0496118_0018468
728 Ga0496118_0043810
729 Ga0496119_0030703
730 Ga0496120_0020769
731 Ga0496121_0002366
732 Ga0496121_0004709
733 Ga0496122_0001785
734 Ga0496122_0002729
735 Ga0496122_0002892
736 Ga0496122_0038877
737 Ga0496122_0120172
738 Ga0496122_0189507
739 Ga0496123_0000136
740 Ga0496123_0000676
741 Ga0496123_0001347
742 Ga0496123_0007417
743 Ga0496123_0011341
744 Ga0496123_0028086
745 Ga0496123_0137536
746 Ga0496124_0001317
747 Ga0496124_0004098
748 Ga0496124_0028201
749 Ga0496124_0051919
750 Ga0496124_0078431
751 Ga0496124_0224607
752 Ga0496125_0000536
753 Ga0496125_0017412
754 Ga0496125_0102744
755 Ga0496125_0207370
756 Ga0496126_0007964
757 Ga0496126_0014011
758 Ga0496126_0021965
759 Ga0496126_0060408
760 Ga0495678_000420
761 Ga0495678_002036
762 Ga0495678_017898
763 Ga0495682_0003332
764 Ga0495682_0052746
765 Ga0495682_0095323
766 Ga0501034_0000969
767 Ga0501034_0199640
768 Ga0500608_062635
769 Ga0500659_0001037
770 2511257501
771 2511270374
772 2511325544
773 2511364714
774 2511372858
775 2526212014
776 2547373858
777 2555247340
778 2599769742
779 2599878324
780 2599889064
781 2599901575
782 2599947525
783 2599959233
784 2599964501
785 2599975626
786 2600007221
787 2600009737
788 2600020544
789 2600055057
790 2600071706
791 2601668111
792 2624491255
793 2640735897
794 2644285599
795 2644364340
796 2671093515
797 2678229169
798 2738808594
799 2738895954
800 2745159831
801 2765583119
802 2774390302
803 2774437843
804 2807407821
805 2807456124
806 2808977262
807 2808992417
808 2825656848
809 2843693440
810 2844670356
811 2846033891
812 2846038879
813 2852613380
814 2852668884
815 2857549844
816 2885082938
817 2912964438
818 2916700316
819 2919184658
820 2919507620
821 2919701231
822 2928516732
823 2932411816
824 2932418617
825 2939651946
826 2945928787
827 2984571808
828 2998346583
829 3007423744
830 3007808025
831 3007876596
832 8019778149
833 8033234190
834 8052498063
835 8054930172
836 8056118384
837 8056123977
838 8056139717
839 8056160208
840 8056165127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

47

286

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.6729 1 246
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6293 1 251
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6215 1 251
1knc-assembly1.cif.gz_A structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. 0.3503 47 197
4jre-assembly1.cif.gz_A crystal structure of nitrate/nitrite exchanger nark with nitrite bound 0.3275 7 249
ID Description Score Start End Superfamily
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4675 1 253 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4668 39 253 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4548 39 253 1.20.1250.20
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4531 1 253 1.20.1250.20
af_Q5U419_3_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4462 38 243 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A318UVR3-F1-model_v4 Probable membrane transporter protein 0.9902 2 254 GO:0005886
AF-A0A0C1WQT6-F1-model_v4 deleted 0.9895 3 253
AF-A0A838ZYJ0-F1-model_v4 deleted 0.9834 2 250
AF-A0A1I4ZJV8-F1-model_v4 Probable membrane transporter protein 0.9826 2 251 GO:0005886
AF-A0A318UVR3-F1-model_v4 Probable membrane transporter protein 0.9825 2 254 GO:0005886

Map