F439762
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 420 | 255 | 418 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300028379|Ga0268266_11551106|Ga0268266_115511061 |
| Length | 135 |
| Sequence | MTSFVLRPVGRVESPLTDPSDAPRQPDEGAPEAWLVFDAFAPALEGLAPGTDMLLFTWLDRGDRETLAVHPRGDLSRPLTGVFATRAPDRPNPIGLHTVHVLAVEGNRVRVRHLEAVDGTPILDVKPLLGPTPER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 2 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 140 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 141 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 147 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 252 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 255 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.24 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.19 |
| Nodule | 0 |
| Rhizoplane | 8.1 |
| Rhizosphere | 88.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10001257 | 3300003316 | Bacteria | 2063 |
| 2 | rootL2_10035585 | 3300003322 | Bacteria | 4460 |
| 3 | rootH1_10380731 | 3300003323 | Bacteria | 1938 |
| 4 | Ga0058862_11966842 | 3300004803 | Bacteria | 1194 |
| 5 | Ga0070683_100109993 | 3300005329 | Bacteria | 2599 |
| 6 | Ga0070683_100225307 | 3300005329 | Bacteria | 1782 |
| 7 | Ga0070670_100095555 | 3300005331 | Unclassified | 2556 |
| 8 | Ga0070677_10172794 | 3300005333 | Bacteria | 1023 |
| 9 | Ga0068869_100398650 | 3300005334 | Bacteria | 1131 |
| 10 | Ga0070666_10351567 | 3300005335 | Bacteria | 1055 |
| 11 | Ga0070680_100009914 | 3300005336 | Bacteria | 7335 |
| 12 | Ga0070682_100129709 | 3300005337 | Bacteria | 1705 |
| 13 | Ga0068868_100187949 | 3300005338 | Bacteria | 1717 |
| 14 | Ga0068868_100692395 | 3300005338 | Bacteria | 911 |
| 15 | Ga0068868_101034290 | 3300005338 | Bacteria | 753 |
| 16 | Ga0070660_100990432 | 3300005339 | Bacteria | 710 |
| 17 | Ga0070689_100015623 | 3300005340 | Bacteria | 5540 |
| 18 | Ga0070691_10015127 | 3300005341 | Bacteria | 3545 |
| 19 | Ga0070687_100022735 | 3300005343 | Unclassified | 2968 |
| 20 | Ga0070661_100152800 | 3300005344 | Bacteria | 1746 |
| 21 | Ga0070661_100450017 | 3300005344 | Unclassified | 1024 |
| 22 | Ga0070668_100643144 | 3300005347 | Bacteria | 931 |
| 23 | Ga0070671_100037794 | 3300005355 | Bacteria | 4005 |
| 24 | Ga0070671_100301415 | 3300005355 | Unclassified | 1364 |
| 25 | Ga0070671_100388555 | 3300005355 | Bacteria | 1193 |
| 26 | Ga0070671_101790446 | 3300005355 | Bacteria | 546 |
| 27 | Ga0070674_100033394 | 3300005356 | Bacteria | 3425 |
| 28 | Ga0070659_100009099 | 3300005366 | Bacteria | 7285 |
| 29 | Ga0070667_100078769 | 3300005367 | Bacteria | 2816 |
| 30 | Ga0070709_10761800 | 3300005434 | Bacteria | 757 |
| 31 | Ga0070714_100219837 | 3300005435 | Bacteria | 1745 |
| 32 | Ga0070714_100711633 | 3300005435 | Bacteria | 969 |
| 33 | Ga0070713_100424828 | 3300005436 | Bacteria | 1245 |
| 34 | Ga0070713_100724674 | 3300005436 | Bacteria | 950 |
| 35 | Ga0070713_100741349 | 3300005436 | Bacteria | 939 |
| 36 | Ga0070713_100754018 | 3300005436 | Bacteria | 931 |
| 37 | Ga0070710_10045055 | 3300005437 | Bacteria | 2450 |
| 38 | Ga0070710_10547403 | 3300005437 | Bacteria | 799 |
| 39 | Ga0070711_100005421 | 3300005439 | Bacteria | 7624 |
| 40 | Ga0070711_100044736 | 3300005439 | Bacteria | 3006 |
| 41 | Ga0070711_100205494 | 3300005439 | Bacteria | 1522 |
| 42 | Ga0070711_100411852 | 3300005439 | Bacteria | 1099 |
| 43 | Ga0070700_100034292 | 3300005441 | Bacteria | 3065 |
| 44 | Ga0070708_101676624 | 3300005445 | Unclassified | 591 |
| 45 | Ga0070663_100237188 | 3300005455 | Bacteria | 1438 |
| 46 | Ga0070678_100183667 | 3300005456 | Unclassified | 1714 |
| 47 | Ga0070678_101062017 | 3300005456 | Bacteria | 746 |
| 48 | Ga0070662_100041686 | 3300005457 | Bacteria | 3276 |
| 49 | Ga0070681_10005299 | 3300005458 | Bacteria | 12453 |
| 50 | Ga0070681_10016679 | 3300005458 | Bacteria | 7333 |
| 51 | Ga0070681_10024157 | 3300005458 | Bacteria | 6119 |
| 52 | Ga0070681_10028575 | 3300005458 | Bacteria | 5607 |
| 53 | Ga0068867_100659272 | 3300005459 | Bacteria | 919 |
| 54 | Ga0070707_100298037 | 3300005468 | Bacteria | 1567 |
| 55 | Ga0070679_100003106 | 3300005530 | Bacteria | 15181 |
| 56 | Ga0070679_100010037 | 3300005530 | Bacteria | 8968 |
| 57 | Ga0070679_100031042 | 3300005530 | Bacteria | 5279 |
| 58 | Ga0070679_100179267 | 3300005530 | Bacteria | 2091 |
| 59 | Ga0070679_100732545 | 3300005530 | Unclassified | 931 |
| 60 | Ga0070684_100045671 | 3300005535 | Bacteria | 3793 |
| 61 | Ga0070684_100121500 | 3300005535 | Bacteria | 2350 |
| 62 | Ga0070684_100360659 | 3300005535 | Bacteria | 1338 |
| 63 | Ga0068853_100663404 | 3300005539 | Bacteria | 993 |
| 64 | Ga0068853_100908282 | 3300005539 | Unclassified | 846 |
| 65 | Ga0070686_101540584 | 3300005544 | Bacteria | 561 |
| 66 | Ga0070665_100354437 | 3300005548 | Bacteria | 1473 |
| 67 | Ga0068855_100882592 | 3300005563 | Unclassified | 946 |
| 68 | Ga0070664_100686168 | 3300005564 | Unclassified | 953 |
| 69 | Ga0068857_100010501 | 3300005577 | Bacteria | 8048 |
| 70 | Ga0068857_100503324 | 3300005577 | Bacteria | 1137 |
| 71 | Ga0068854_100010504 | 3300005578 | Bacteria | 6007 |
| 72 | Ga0068854_100124568 | 3300005578 | Bacteria | 1961 |
| 73 | Ga0068856_100058409 | 3300005614 | Bacteria | 3809 |
| 74 | Ga0068856_100185941 | 3300005614 | Bacteria | 2091 |
| 75 | Ga0068856_100396961 | 3300005614 | Bacteria | 1399 |
| 76 | Ga0068859_100169217 | 3300005617 | Bacteria | 2266 |
| 77 | Ga0068859_100272974 | 3300005617 | Unclassified | 1783 |
| 78 | Ga0068864_100078974 | 3300005618 | Bacteria | 2880 |
| 79 | Ga0068864_100153671 | 3300005618 | Bacteria | 2087 |
| 80 | Ga0068863_100039103 | 3300005841 | Bacteria | 4515 |
| 81 | Ga0068863_100117560 | 3300005841 | Bacteria | 2534 |
| 82 | Ga0068858_100016978 | 3300005842 | Bacteria | 6834 |
| 83 | Ga0068858_100129338 | 3300005842 | Bacteria | 2367 |
| 84 | Ga0068860_100022068 | 3300005843 | Bacteria | 6162 |
| 85 | Ga0068860_100478895 | 3300005843 | Bacteria | 1240 |
| 86 | Ga0068862_100146485 | 3300005844 | Unclassified | 2099 |
| 87 | Ga0068862_100167043 | 3300005844 | Bacteria | 1967 |
| 88 | Ga0070715_10775251 | 3300006163 | Bacteria | 580 |
| 89 | Ga0070716_100030576 | 3300006173 | Bacteria | 2923 |
| 90 | Ga0070712_100170180 | 3300006175 | Bacteria | 1690 |
| 91 | Ga0070712_100442798 | 3300006175 | Bacteria | 1080 |
| 92 | Ga0075367_10843740 | 3300006178 | Bacteria | 584 |
| 93 | Ga0075366_10014267 | 3300006195 | Bacteria | 4538 |
| 94 | Ga0075366_10225293 | 3300006195 | Bacteria | 1142 |
| 95 | Ga0097621_101045333 | 3300006237 | Unclassified | 765 |
| 96 | Ga0097621_101949228 | 3300006237 | Bacteria | 561 |
| 97 | Ga0068871_100035193 | 3300006358 | Bacteria | 3977 |
| 98 | Ga0075428_100004140 | 3300006844 | Bacteria | 15965 |
| 99 | Ga0075428_100016361 | 3300006844 | Bacteria | 8195 |
| 100 | Ga0075428_100028092 | 3300006844 | Bacteria | 6222 |
| 101 | Ga0075428_101543359 | 3300006844 | Bacteria | 695 |
| 102 | Ga0075430_100019614 | 3300006846 | Bacteria | 5752 |
| 103 | Ga0075430_100130826 | 3300006846 | Bacteria | 2092 |
| 104 | Ga0075430_100148993 | 3300006846 | Bacteria | 1949 |
| 105 | Ga0075430_100294198 | 3300006846 | Bacteria | 1343 |
| 106 | Ga0075430_100334950 | 3300006846 | Bacteria | 1250 |
| 107 | Ga0075430_101371887 | 3300006846 | Unclassified | 581 |
| 108 | Ga0075431_100023675 | 3300006847 | Bacteria | 6286 |
| 109 | Ga0075431_100231433 | 3300006847 | Bacteria | 1883 |
| 110 | Ga0075431_100280514 | 3300006847 | Bacteria | 1687 |
| 111 | Ga0075433_10432183 | 3300006852 | Bacteria | 1161 |
| 112 | Ga0075433_10909464 | 3300006852 | Bacteria | 767 |
| 113 | Ga0075434_100006343 | 3300006871 | Bacteria | 10843 |
| 114 | Ga0075434_100008947 | 3300006871 | Bacteria | 9325 |
| 115 | Ga0075434_100201377 | 3300006871 | Bacteria | 2011 |
| 116 | Ga0075434_100495852 | 3300006871 | Bacteria | 1242 |
| 117 | Ga0075429_100065274 | 3300006880 | Bacteria | 3169 |
| 118 | Ga0075429_100471418 | 3300006880 | Bacteria | 1100 |
| 119 | Ga0075436_100041121 | 3300006914 | Bacteria | 3190 |
| 120 | Ga0097620_100169218 | 3300006931 | Bacteria | 2266 |
| 121 | Ga0097620_100272977 | 3300006931 | Unclassified | 1783 |
| 122 | Ga0075435_100007211 | 3300007076 | Bacteria | 7907 |
| 123 | Ga0075435_100474329 | 3300007076 | Unclassified | 1080 |
| 124 | Ga0111539_10115886 | 3300009094 | Bacteria | 3141 |
| 125 | Ga0111539_10253257 | 3300009094 | Bacteria | 2050 |
| 126 | Ga0105245_10249870 | 3300009098 | Bacteria | 1722 |
| 127 | Ga0105245_11156563 | 3300009098 | Bacteria | 821 |
| 128 | Ga0105245_11424234 | 3300009098 | Unclassified | 743 |
| 129 | Ga0105247_10120349 | 3300009101 | Bacteria | 1700 |
| 130 | Ga0114129_10024381 | 3300009147 | Bacteria | 8572 |
| 131 | Ga0114129_10054079 | 3300009147 | Bacteria | 5630 |
| 132 | Ga0114129_10774911 | 3300009147 | Bacteria | 1226 |
| 133 | Ga0105248_10024686 | 3300009177 | Bacteria | 6684 |
| 134 | Ga0105248_10478922 | 3300009177 | Bacteria | 1403 |
| 135 | Ga0105237_10732971 | 3300009545 | Unclassified | 995 |
| 136 | Ga0105238_10502464 | 3300009551 | Bacteria | 1213 |
| 137 | Ga0105249_12457515 | 3300009553 | Bacteria | 593 |
| 138 | Ga0105246_10278291 | 3300011119 | Bacteria | 1341 |
| 139 | Ga0157373_10259841 | 3300013100 | Unclassified | 1229 |
| 140 | Ga0157369_10022113 | 3300013105 | Bacteria | 7104 |
| 141 | Ga0157369_10076080 | 3300013105 | Bacteria | 3598 |
| 142 | Ga0157369_10776140 | 3300013105 | Bacteria | 985 |
| 143 | Ga0157374_10144195 | 3300013296 | Bacteria | 2313 |
| 144 | Ga0157378_10530712 | 3300013297 | Bacteria | 1180 |
| 145 | Ga0157378_10932424 | 3300013297 | Bacteria | 900 |
| 146 | Ga0157372_10727152 | 3300013307 | Bacteria | 1154 |
| 147 | Ga0157372_11701787 | 3300013307 | Unclassified | 726 |
| 148 | Ga0157372_12015031 | 3300013307 | Bacteria | 663 |
| 149 | Ga0157375_10122051 | 3300013308 | Bacteria | 2716 |
| 150 | Ga0157375_11260783 | 3300013308 | Bacteria | 868 |
| 151 | Ga0157375_11938197 | 3300013308 | Bacteria | 700 |
| 152 | Ga0163163_10014609 | 3300014325 | Bacteria | 7223 |
| 153 | Ga0163163_10044741 | 3300014325 | Bacteria | 4344 |
| 154 | Ga0163163_10893804 | 3300014325 | Unclassified | 952 |
| 155 | Ga0163163_11436036 | 3300014325 | Bacteria | 751 |
| 156 | Ga0157380_10201351 | 3300014326 | Unclassified | 1767 |
| 157 | Ga0157380_10260827 | 3300014326 | Bacteria | 1574 |
| 158 | Ga0157377_10768294 | 3300014745 | Unclassified | 707 |
| 159 | Ga0157379_10377709 | 3300014968 | Bacteria | 1300 |
| 160 | Ga0157376_10019738 | 3300014969 | Bacteria | 5201 |
| 161 | Ga0182005_1027799 | 3300015265 | Bacteria | 1542 |
| 162 | Ga0207692_10299337 | 3300025898 | Bacteria | 978 |
| 163 | Ga0207692_10571778 | 3300025898 | Bacteria | 724 |
| 164 | Ga0207692_10690115 | 3300025898 | Unclassified | 662 |
| 165 | Ga0207710_10061999 | 3300025900 | Bacteria | 1698 |
| 166 | Ga0207680_10171419 | 3300025903 | Bacteria | 1462 |
| 167 | Ga0207685_10061212 | 3300025905 | Bacteria | 1492 |
| 168 | Ga0207699_10093293 | 3300025906 | Bacteria | 1894 |
| 169 | Ga0207684_10983868 | 3300025910 | Bacteria | 706 |
| 170 | Ga0207707_10019304 | 3300025912 | Bacteria | 5949 |
| 171 | Ga0207707_10025936 | 3300025912 | Bacteria | 5126 |
| 172 | Ga0207707_10030972 | 3300025912 | Bacteria | 4679 |
| 173 | Ga0207707_10059964 | 3300025912 | Bacteria | 3310 |
| 174 | Ga0207693_10850994 | 3300025915 | Unclassified | 701 |
| 175 | Ga0207693_11267274 | 3300025915 | Bacteria | 553 |
| 176 | Ga0207693_11272936 | 3300025915 | Unclassified | 551 |
| 177 | Ga0207663_10003317 | 3300025916 | Bacteria | 7855 |
| 178 | Ga0207663_10345681 | 3300025916 | Bacteria | 1125 |
| 179 | Ga0207663_11551416 | 3300025916 | Bacteria | 533 |
| 180 | Ga0207660_10028143 | 3300025917 | Bacteria | 3843 |
| 181 | Ga0207660_10090602 | 3300025917 | Bacteria | 2266 |
| 182 | Ga0207657_10037512 | 3300025919 | Bacteria | 4326 |
| 183 | Ga0207657_10773782 | 3300025919 | Bacteria | 743 |
| 184 | Ga0207649_10007168 | 3300025920 | Bacteria | 6060 |
| 185 | Ga0207649_10502651 | 3300025920 | Unclassified | 922 |
| 186 | Ga0207652_10005180 | 3300025921 | Bacteria | 10585 |
| 187 | Ga0207652_10046125 | 3300025921 | Bacteria | 3717 |
| 188 | Ga0207652_10108760 | 3300025921 | Bacteria | 2457 |
| 189 | Ga0207652_10423250 | 3300025921 | Bacteria | 1201 |
| 190 | Ga0207652_10426377 | 3300025921 | Bacteria | 1196 |
| 191 | Ga0207652_10574950 | 3300025921 | Unclassified | 1012 |
| 192 | Ga0207646_10592611 | 3300025922 | Bacteria | 995 |
| 193 | Ga0207694_10347292 | 3300025924 | Bacteria | 1228 |
| 194 | Ga0207650_10058229 | 3300025925 | Unclassified | 2876 |
| 195 | Ga0207659_10010153 | 3300025926 | Bacteria | 5905 |
| 196 | Ga0207687_10913408 | 3300025927 | Bacteria | 751 |
| 197 | Ga0207700_10114721 | 3300025928 | Bacteria | 2174 |
| 198 | Ga0207700_10123414 | 3300025928 | Bacteria | 2103 |
| 199 | Ga0207700_10216741 | 3300025928 | Bacteria | 1621 |
| 200 | Ga0207700_10966899 | 3300025928 | Bacteria | 762 |
| 201 | Ga0207664_10630510 | 3300025929 | Bacteria | 963 |
| 202 | Ga0207644_10054218 | 3300025931 | Bacteria | 2887 |
| 203 | Ga0207644_11090686 | 3300025931 | Bacteria | 671 |
| 204 | Ga0207690_10002601 | 3300025932 | Bacteria | 10886 |
| 205 | Ga0207690_10549922 | 3300025932 | Unclassified | 938 |
| 206 | Ga0207690_10906059 | 3300025932 | Bacteria | 731 |
| 207 | Ga0207669_10084461 | 3300025937 | Bacteria | 2046 |
| 208 | Ga0207704_11273173 | 3300025938 | Unclassified | 628 |
| 209 | Ga0207691_10002077 | 3300025940 | Bacteria | 19544 |
| 210 | Ga0207711_10049338 | 3300025941 | Bacteria | 3604 |
| 211 | Ga0207689_10708216 | 3300025942 | Bacteria | 849 |
| 212 | Ga0207661_10374710 | 3300025944 | Bacteria | 1287 |
| 213 | Ga0207679_10007865 | 3300025945 | Bacteria | 6774 |
| 214 | Ga0207679_11581522 | 3300025945 | Unclassified | 601 |
| 215 | Ga0207667_10214927 | 3300025949 | Bacteria | 1970 |
| 216 | Ga0207667_10698930 | 3300025949 | Bacteria | 1017 |
| 217 | Ga0207668_10091888 | 3300025972 | Bacteria | 2232 |
| 218 | Ga0207668_11452375 | 3300025972 | Unclassified | 619 |
| 219 | Ga0207640_10011092 | 3300025981 | Bacteria | 5092 |
| 220 | Ga0207640_11875798 | 3300025981 | Unclassified | 542 |
| 221 | Ga0207703_10102263 | 3300026035 | Bacteria | 2431 |
| 222 | Ga0207639_10337152 | 3300026041 | Bacteria | 1343 |
| 223 | Ga0207639_10441563 | 3300026041 | Bacteria | 1180 |
| 224 | Ga0207639_10707525 | 3300026041 | Unclassified | 935 |
| 225 | Ga0207678_10038206 | 3300026067 | Bacteria | 4172 |
| 226 | Ga0207702_10104067 | 3300026078 | Bacteria | 2511 |
| 227 | Ga0207702_10247488 | 3300026078 | Bacteria | 1673 |
| 228 | Ga0207702_10470872 | 3300026078 | Unclassified | 1221 |
| 229 | Ga0207641_10090128 | 3300026088 | Bacteria | 2681 |
| 230 | Ga0207641_10579688 | 3300026088 | Bacteria | 1096 |
| 231 | Ga0207648_10967684 | 3300026089 | Bacteria | 796 |
| 232 | Ga0207676_10063085 | 3300026095 | Bacteria | 2942 |
| 233 | Ga0207676_10720595 | 3300026095 | Bacteria | 968 |
| 234 | Ga0207674_10001105 | 3300026116 | Bacteria | 35054 |
| 235 | Ga0207674_10769581 | 3300026116 | Bacteria | 929 |
| 236 | Ga0207675_100003327 | 3300026118 | Bacteria | 15736 |
| 237 | Ga0207683_10247677 | 3300026121 | Unclassified | 1626 |
| 238 | Ga0207683_10924187 | 3300026121 | Bacteria | 810 |
| 239 | Ga0207698_12071973 | 3300026142 | Unclassified | 583 |
| 240 | Ga0207698_12143014 | 3300026142 | Unclassified | 572 |
| 241 | Ga0268266_11551106 | 3300028379 | Bacteria | 638 |
| 242 | Ga0268265_10136316 | 3300028380 | Unclassified | 2048 |
| 243 | Ga0268265_11519544 | 3300028380 | Bacteria | 673 |
| 244 | Ga0268264_10031707 | 3300028381 | Bacteria | 4334 |
| 245 | Ga0307509_10094852 | 3300031507 | Bacteria | 3041 |
| 246 | Ga0307411_10322577 | 3300032005 | Unclassified | 1248 |
| 247 | Ga0307507_10029253 | 3300033179 | Bacteria | 5847 |
| 248 | Ga0373948_0206844 | 3300034817 | Bacteria | 514 |
| 249 | Ga0373958_0048946 | 3300034819 | Bacteria | 888 |
| 250 | Ga0373936_0051659 | 3300035113 | Bacteria | 1664 |
| 251 | Ga0373941_0021701 | 3300035115 | Unclassified | 1816 |
| 252 | Ga0373953_0070889 | 3300035117 | Bacteria | 1437 |
| 253 | Ga0373954_0634761 | 3300035118 | Bacteria | 529 |
| 254 | Ga0373957_0054954 | 3300035120 | Bacteria | 1530 |
| 255 | Ga0373960_0240631 | 3300035121 | Unclassified | 654 |
| 256 | Ga0373955_0471995 | 3300035172 | Unclassified | 765 |
| 257 | Ga0373931_0205742 | 3300035691 | Bacteria | 1178 |
| 258 | Ga0373927_0524517 | 3300035695 | Unclassified | 783 |
| 259 | Ga0373927_0591656 | 3300035695 | Bacteria | 733 |
| 260 | Ga0373933_0221341 | 3300035724 | Bacteria | 1214 |
| 261 | Ga0373937_0570766 | 3300036401 | Bacteria | 1074 |
| 262 | Ga0373925_0404970 | 3300037068 | Bacteria | 1113 |
| 263 | Ga0451791_0435390 | 3300041451 | Bacteria | 606 |
| 264 | Ga0466965_0092710 | 3300044683 | Bacteria | 1538 |
| 265 | Ga0466965_0283237 | 3300044683 | Bacteria | 896 |
| 266 | Ga0466966_0256098 | 3300044684 | Bacteria | 1054 |
| 267 | Ga0466961_0044304 | 3300044693 | Bacteria | 2847 |
| 268 | Ga0466963_0023612 | 3300044694 | Bacteria | 3908 |
| 269 | Ga0466963_0156833 | 3300044694 | Bacteria | 1583 |
| 270 | Ga0466963_0215084 | 3300044694 | Bacteria | 1345 |
| 271 | Ga0466963_0524423 | 3300044694 | Bacteria | 836 |
| 272 | Ga0466971_0027468 | 3300044719 | Bacteria | 2550 |
| 273 | Ga0466970_0107112 | 3300044765 | Bacteria | 1525 |
| 274 | Ga0466957_0378990 | 3300044842 | Bacteria | 964 |
| 275 | Ga0466960_0682969 | 3300044901 | Bacteria | 615 |
| 276 | Ga0466959_0131638 | 3300045049 | Bacteria | 1772 |
| 277 | Ga0451576_0126907 | 3300045051 | Bacteria | 2658 |
| 278 | Ga0466958_0001930 | 3300045836 | Bacteria | 10160 |
| 279 | Ga0466958_0083621 | 3300045836 | Bacteria | 1967 |
| 280 | Ga0466967_0054255 | 3300045976 | Bacteria | 3526 |
| 281 | Ga0466967_0084136 | 3300045976 | Bacteria | 2878 |
| 282 | Ga0466967_0456072 | 3300045976 | Bacteria | 1250 |
| 283 | Ga0495592_0011582 | 3300046454 | Bacteria | 6678 |
| 284 | Ga0495603_0522452 | 3300046455 | Bacteria | 680 |
| 285 | Ga0495629_0058023 | 3300046459 | Bacteria | 2706 |
| 286 | Ga0495629_0094848 | 3300046459 | Bacteria | 2082 |
| 287 | Ga0495638_0012956 | 3300046460 | Bacteria | 5693 |
| 288 | Ga0495641_0534605 | 3300046461 | Bacteria | 535 |
| 289 | Ga0495651_0002869 | 3300046462 | Bacteria | 13353 |
| 290 | Ga0495653_0050613 | 3300046463 | Bacteria | 3194 |
| 291 | Ga0495662_0032122 | 3300046476 | Bacteria | 2536 |
| 292 | Ga0495662_0451848 | 3300046476 | Bacteria | 630 |
| 293 | Ga0495664_0110842 | 3300046477 | Bacteria | 1656 |
| 294 | Ga0495608_0077381 | 3300046511 | Bacteria | 2165 |
| 295 | Ga0495618_0013624 | 3300046514 | Bacteria | 4948 |
| 296 | Ga0495620_0000060 | 3300046515 | Bacteria | 95642 |
| 297 | Ga0495628_0043289 | 3300046516 | Bacteria | 3587 |
| 298 | Ga0495652_0054089 | 3300046529 | Bacteria | 3419 |
| 299 | Ga0495665_0141233 | 3300046531 | Bacteria | 1259 |
| 300 | Ga0495665_0664002 | 3300046531 | Unclassified | 518 |
| 301 | Ga0495640_0092406 | 3300046533 | Bacteria | 1995 |
| 302 | Ga0495586_0202568 | 3300046535 | Bacteria | 1125 |
| 303 | Ga0495587_0029292 | 3300046536 | Bacteria | 3342 |
| 304 | Ga0495645_0024293 | 3300046543 | Bacteria | 4396 |
| 305 | Ga0495645_0659425 | 3300046543 | Bacteria | 638 |
| 306 | Ga0495667_0012241 | 3300046559 | Bacteria | 5813 |
| 307 | Ga0495634_0108540 | 3300046642 | Bacteria | 1786 |
| 308 | Ga0495635_0026312 | 3300046663 | Bacteria | 4049 |
| 309 | Ga0495657_0044122 | 3300046675 | Bacteria | 3035 |
| 310 | Ga0495599_0023916 | 3300046678 | Bacteria | 3820 |
| 311 | Ga0495646_0224092 | 3300046680 | Bacteria | 1015 |
| 312 | Ga0495624_0068541 | 3300046690 | Bacteria | 2211 |
| 313 | Ga0495604_0005531 | 3300047317 | Bacteria | 10017 |
| 314 | Ga0495604_0618009 | 3300047317 | Bacteria | 693 |
| 315 | Ga0495674_0022122 | 3300047319 | Bacteria | 5867 |
| 316 | Ga0495676_0887637 | 3300047321 | Bacteria | 571 |
| 317 | Ga0495676_1041661 | 3300047321 | Bacteria | 521 |
| 318 | Ga0495680_0032368 | 3300047322 | Bacteria | 4246 |
| 319 | Ga0495675_0064276 | 3300047444 | Bacteria | 2321 |
| 320 | Ga0495684_0015078 | 3300047471 | Bacteria | 5952 |
| 321 | Ga0495602_0018767 | 3300048088 | Bacteria | 6893 |
| 322 | Ga0496100_0357858 | 3300048903 | Bacteria | 1104 |
| 323 | Ga0496100_0482663 | 3300048903 | Unclassified | 953 |
| 324 | Ga0496101_0170100 | 3300048904 | Bacteria | 1675 |
| 325 | Ga0496101_0440657 | 3300048904 | Unclassified | 1028 |
| 326 | Ga0496102_0052747 | 3300048905 | Bacteria | 3707 |
| 327 | Ga0496102_0149195 | 3300048905 | Bacteria | 2196 |
| 328 | Ga0496104_0234974 | 3300048907 | Bacteria | 1745 |
| 329 | Ga0496105_0024910 | 3300048908 | Bacteria | 4864 |
| 330 | Ga0496106_0086583 | 3300048909 | Bacteria | 2413 |
| 331 | Ga0496106_0188787 | 3300048909 | Unclassified | 1638 |
| 332 | Ga0496107_0236958 | 3300048910 | Unclassified | 1358 |
| 333 | Ga0496107_0856605 | 3300048910 | Bacteria | 664 |
| 334 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 335 | Ga0496108_0049132 | 3300048911 | Bacteria | 3528 |
| 336 | Ga0496108_0099804 | 3300048911 | Bacteria | 2475 |
| 337 | Ga0496108_0111610 | 3300048911 | Bacteria | 2339 |
| 338 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 339 | Ga0496109_0010556 | 3300048912 | Bacteria | 7897 |
| 340 | Ga0496109_0083729 | 3300048912 | Unclassified | 2941 |
| 341 | Ga0496109_0089342 | 3300048912 | Bacteria | 2848 |
| 342 | Ga0496109_0491792 | 3300048912 | Bacteria | 1158 |
| 343 | Ga0496110_0044836 | 3300048913 | Unclassified | 3862 |
| 344 | Ga0496111_0082515 | 3300048914 | Bacteria | 2348 |
| 345 | Ga0496111_0241372 | 3300048914 | Bacteria | 1342 |
| 346 | Ga0496111_0388790 | 3300048914 | Unclassified | 1031 |
| 347 | Ga0496112_0061758 | 3300048915 | Bacteria | 3695 |
| 348 | Ga0496112_0182624 | 3300048915 | Unclassified | 2061 |
| 349 | Ga0496112_0514878 | 3300048915 | Unclassified | 1131 |
| 350 | Ga0496113_0269106 | 3300048916 | Bacteria | 1362 |
| 351 | Ga0496113_0274105 | 3300048916 | Bacteria | 1349 |
| 352 | Ga0496113_0643013 | 3300048916 | Unclassified | 848 |
| 353 | Ga0496114_0202044 | 3300048917 | Bacteria | 1741 |
| 354 | Ga0496114_1096959 | 3300048917 | Unclassified | 681 |
| 355 | Ga0496116_0364421 | 3300048919 | Unclassified | 655 |
| 356 | Ga0496118_0207827 | 3300048921 | Bacteria | 1152 |
| 357 | Ga0496125_0043688 | 3300048928 | Unclassified | 3799 |
| 358 | Ga0501033_0832461 | 3300049570 | Bacteria | 623 |
| 359 | Ga0501034_1192782 | 3300049571 | Bacteria | 640 |
| 360 | Ga0501038_0305188 | 3300049574 | Bacteria | 1248 |
| 361 | Ga0501039_0178295 | 3300049575 | Bacteria | 1671 |
| 362 | Ga0501040_0074762 | 3300049576 | Bacteria | 2342 |
| 363 | Ga0501042_0219303 | 3300049578 | Bacteria | 1372 |
| 364 | Ga0501046_0100289 | 3300049580 | Bacteria | 2222 |
| 365 | Ga0501046_0689949 | 3300049580 | Bacteria | 720 |
| 366 | Ga0501047_0178860 | 3300049581 | Bacteria | 1988 |
| 367 | Ga0501048_0185824 | 3300049582 | Bacteria | 1473 |
| 368 | Ga0501048_1372243 | 3300049582 | Bacteria | 508 |
| 369 | Ga0501068_0136583 | 3300049584 | Unclassified | 1535 |
| 370 | Ga0501068_0142842 | 3300049584 | Bacteria | 1501 |
| 371 | Ga0501069_0201288 | 3300049585 | Bacteria | 1154 |
| 372 | Ga0501070_1269507 | 3300049586 | Bacteria | 563 |
| 373 | Ga0501071_0271223 | 3300049587 | Bacteria | 1283 |
| 374 | Ga0501072_0008667 | 3300049588 | Bacteria | 7720 |
| 375 | Ga0501075_0017204 | 3300049591 | Bacteria | 5220 |
| 376 | Ga0501075_0052538 | 3300049591 | Bacteria | 3064 |
| 377 | Ga0501076_0047475 | 3300049592 | Bacteria | 3395 |
| 378 | Ga0501076_0365720 | 3300049592 | Bacteria | 1185 |
| 379 | Ga0501077_0112975 | 3300049593 | Bacteria | 1722 |
| 380 | Ga0501079_0020288 | 3300049741 | Bacteria | 5079 |
| 381 | Ga0501079_0507857 | 3300049741 | Bacteria | 948 |
| 382 | Ga0501080_0779022 | 3300049742 | Bacteria | 840 |
| 383 | Ga0501081_0211033 | 3300049743 | Bacteria | 1410 |
| 384 | Ga0501044_0077655 | 3300049823 | Bacteria | 3367 |
| 385 | Ga0501045_0385019 | 3300049824 | Unclassified | 1044 |
| 386 | nmdc:mga0yw44_1061464_c1 | 3300050492 | Unclassified | 548 |
| 387 | nmdc:mga05p37_117692_c1 | 3300050507 | Bacteria | 3265 |
| 388 | nmdc:mga05p37_327721_c1 | 3300050507 | Bacteria | 1810 |
| 389 | nmdc:mga09592_138495_c1 | 3300050508 | Bacteria | 2097 |
| 390 | nmdc:mga09592_277648_c1 | 3300050508 | Unclassified | 1453 |
| 391 | nmdc:mga0qj67_107742_c1 | 3300050509 | Bacteria | 2248 |
| 392 | nmdc:mga0qj67_13702_c1 | 3300050509 | Bacteria | 6120 |
| 393 | nmdc:mga0qj67_43147_c1 | 3300050509 | Bacteria | 3552 |
| 394 | nmdc:mga0qj67_496852_c1 | 3300050509 | Bacteria | 981 |
| 395 | nmdc:mga0qj67_586071_c1 | 3300050509 | Bacteria | 893 |
| 396 | nmdc:mga0qj67_74579_c1 | 3300050509 | Bacteria | 2711 |
| 397 | nmdc:mga06r32_350475_c1 | 3300050510 | Bacteria | 1461 |
| 398 | nmdc:mga06r32_512718_c1 | 3300050510 | Bacteria | 1175 |
| 399 | nmdc:mga08y16_309181_c1 | 3300050511 | Bacteria | 1628 |
| 400 | nmdc:mga08y16_646293_c1 | 3300050511 | Bacteria | 1062 |
| 401 | nmdc:mga0n895_19427_c1 | 3300050512 | Bacteria | 6316 |
| 402 | nmdc:mga0n895_2252530_c1 | 3300050512 | Unclassified | 500 |
| 403 | nmdc:mga0rr50_16263_c1 | 3300050513 | Bacteria | 4935 |
| 404 | nmdc:mga0rr50_459006_c1 | 3300050513 | Bacteria | 1080 |
| 405 | nmdc:mga0rr50_985683_c1 | 3300050513 | Unclassified | 718 |
| 406 | nmdc:mga08x19_110105_c1 | 3300050514 | Bacteria | 1836 |
| 407 | nmdc:mga0a205_430993_c1 | 3300050515 | Bacteria | 1180 |
| 408 | nmdc:mga0a205_48978_c1 | 3300050515 | Bacteria | 4078 |
| 409 | Ga0495601_0027620 | 3300053077 | Bacteria | 3509 |
| 410 | Ga0495655_0023323 | 3300053083 | Bacteria | 1426 |
| 411 | Ga0500592_015929 | 3300053116 | Bacteria | 1207 |
| 412 | Ga0501084_0228032 | 3300054114 | Bacteria | 1572 |
| 413 | Ga0501084_0273820 | 3300054114 | Bacteria | 1425 |
| 414 | Ga0501084_1669745 | 3300054114 | Unclassified | 532 |
| 415 | Ga0501082_0035739 | 3300060353 | Bacteria | 4282 |
| 416 | Ga0501082_0564585 | 3300060353 | Unclassified | 996 |
| 417 | Ga0466962_0035081 | 3300061719 | Bacteria | 2401 |
| 418 | Ga0530510_0172406 | 3300061734 | Bacteria | 1603 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025926 | Ga0207659_10010153 | Ga0207659_100101535 | 116 |
| 2 | 3300005614 | Ga0068856_100396961 | Ga0068856_1003969613 | 122 |
| 3 | 3300026078 | Ga0207702_10247488 | Ga0207702_102474882 | 122 |
| 4 | 3300005578 | Ga0068854_100010504 | Ga0068854_1000105045 | 125 |
| 5 | 3300025981 | Ga0207640_10011092 | Ga0207640_100110927 | 125 |
| 6 | 3300044901 | Ga0466960_0682969 | Ga0466960_0682969_33_422 | 125 |
| 7 | 3300044694 | Ga0466963_0524423 | Ga0466963_0524423_338_727 | 128 |
| 8 | 3300046515 | Ga0495620_0000060 | Ga0495620_0000060_61064_61456 | 128 |
| 9 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_494249_494656 | 128 |
| 10 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_494211_494618 | 128 |
| 11 | 3300048928 | Ga0496125_0043688 | Ga0496125_0043688_274_681 | 128 |
| 12 | 3300025898 | Ga0207692_10299337 | Ga0207692_102993371 | 130 |
| 13 | 3300005434 | Ga0070709_10761800 | Ga0070709_107618001 | 131 |
| 14 | 3300025928 | Ga0207700_10114721 | Ga0207700_101147211 | 132 |
| 15 | 3300044683 | Ga0466965_0092710 | Ga0466965_0092710_513_917 | 132 |
| 16 | iso_pu_bacteria | 2551306166 | 2552112202 | 132 |
| 17 | iso_pu_bacteria | 2751185782 | 2753270504 | 132 |
| 18 | 3300028379 | Ga0268266_11551106 | Ga0268266_115511061 | 133 |
| 19 | 3300044683 | Ga0466965_0283237 | Ga0466965_0283237_114_524 | 133 |
| 20 | 3300044684 | Ga0466966_0256098 | Ga0466966_0256098_331_741 | 133 |
| 21 | 3300044694 | Ga0466963_0023612 | Ga0466963_0023612_1512_1922 | 133 |
| 22 | 3300044694 | Ga0466963_0156833 | Ga0466963_0156833_1016_1417 | 133 |
| 23 | 3300044765 | Ga0466970_0107112 | Ga0466970_0107112_981_1391 | 133 |
| 24 | 3300044842 | Ga0466957_0378990 | Ga0466957_0378990_38_448 | 133 |
| 25 | 3300045049 | Ga0466959_0131638 | Ga0466959_0131638_81_491 | 133 |
| 26 | 3300045836 | Ga0466958_0001930 | Ga0466958_0001930_4609_5019 | 133 |
| 27 | 3300045976 | Ga0466967_0084136 | Ga0466967_0084136_1758_2168 | 133 |
| 28 | 3300005329 | Ga0070683_100225307 | Ga0070683_1002253072 | 134 |
| 29 | 3300005334 | Ga0068869_100398650 | Ga0068869_1003986502 | 134 |
| 30 | 3300005338 | Ga0068868_100187949 | Ga0068868_1001879492 | 134 |
| 31 | 3300005338 | Ga0068868_100692395 | Ga0068868_1006923951 | 134 |
| 32 | 3300005339 | Ga0070660_100990432 | Ga0070660_1009904321 | 134 |
| 33 | 3300005341 | Ga0070691_10015127 | Ga0070691_100151273 | 134 |
| 34 | 3300005347 | Ga0070668_100643144 | Ga0070668_1006431442 | 134 |
| 35 | 3300005355 | Ga0070671_100388555 | Ga0070671_1003885552 | 134 |
| 36 | 3300005355 | Ga0070671_101790446 | Ga0070671_1017904461 | 134 |
| 37 | 3300005367 | Ga0070667_100078769 | Ga0070667_1000787692 | 134 |
| 38 | 3300005435 | Ga0070714_100219837 | Ga0070714_1002198372 | 134 |
| 39 | 3300005435 | Ga0070714_100711633 | Ga0070714_1007116332 | 134 |
| 40 | 3300005436 | Ga0070713_100724674 | Ga0070713_1007246742 | 134 |
| 41 | 3300005436 | Ga0070713_100741349 | Ga0070713_1007413492 | 134 |
| 42 | 3300005436 | Ga0070713_100754018 | Ga0070713_1007540182 | 134 |
| 43 | 3300005437 | Ga0070710_10045055 | Ga0070710_100450554 | 134 |
| 44 | 3300005437 | Ga0070710_10547403 | Ga0070710_105474031 | 134 |
| 45 | 3300005439 | Ga0070711_100044736 | Ga0070711_1000447362 | 134 |
| 46 | 3300005439 | Ga0070711_100205494 | Ga0070711_1002054942 | 134 |
| 47 | 3300005439 | Ga0070711_100411852 | Ga0070711_1004118522 | 134 |
| 48 | 3300005445 | Ga0070708_101676624 | Ga0070708_1016766241 | 134 |
| 49 | 3300005468 | Ga0070707_100298037 | Ga0070707_1002980372 | 134 |
| 50 | 3300005535 | Ga0070684_100121500 | Ga0070684_1001215002 | 134 |
| 51 | 3300005539 | Ga0068853_100663404 | Ga0068853_1006634042 | 134 |
| 52 | 3300005544 | Ga0070686_101540584 | Ga0070686_1015405841 | 134 |
| 53 | 3300005548 | Ga0070665_100354437 | Ga0070665_1003544372 | 134 |
| 54 | 3300005577 | Ga0068857_100503324 | Ga0068857_1005033242 | 134 |
| 55 | 3300005614 | Ga0068856_100058409 | Ga0068856_1000584092 | 134 |
| 56 | 3300005614 | Ga0068856_100185941 | Ga0068856_1001859412 | 134 |
| 57 | 3300005617 | Ga0068859_100169217 | Ga0068859_1001692171 | 134 |
| 58 | 3300005617 | Ga0068859_100272974 | Ga0068859_1002729742 | 134 |
| 59 | 3300005618 | Ga0068864_100153671 | Ga0068864_1001536712 | 134 |
| 60 | 3300005841 | Ga0068863_100039103 | Ga0068863_1000391035 | 134 |
| 61 | 3300005841 | Ga0068863_100117560 | Ga0068863_1001175601 | 134 |
| 62 | 3300005842 | Ga0068858_100016978 | Ga0068858_1000169785 | 134 |
| 63 | 3300005842 | Ga0068858_100129338 | Ga0068858_1001293383 | 134 |
| 64 | 3300005843 | Ga0068860_100022068 | Ga0068860_1000220687 | 134 |
| 65 | 3300005844 | Ga0068862_100167043 | Ga0068862_1001670433 | 134 |
| 66 | 3300006163 | Ga0070715_10775251 | Ga0070715_107752511 | 134 |
| 67 | 3300006173 | Ga0070716_100030576 | Ga0070716_1000305763 | 134 |
| 68 | 3300006175 | Ga0070712_100442798 | Ga0070712_1004427982 | 134 |
| 69 | 3300006195 | Ga0075366_10014267 | Ga0075366_100142673 | 134 |
| 70 | 3300006237 | Ga0097621_101949228 | Ga0097621_1019492282 | 134 |
| 71 | 3300006358 | Ga0068871_100035193 | Ga0068871_1000351933 | 134 |
| 72 | 3300006871 | Ga0075434_100201377 | Ga0075434_1002013772 | 134 |
| 73 | 3300006931 | Ga0097620_100169218 | Ga0097620_1001692181 | 134 |
| 74 | 3300006931 | Ga0097620_100272977 | Ga0097620_1002729772 | 134 |
| 75 | 3300009098 | Ga0105245_10249870 | Ga0105245_102498703 | 134 |
| 76 | 3300009098 | Ga0105245_11156563 | Ga0105245_111565632 | 134 |
| 77 | 3300009098 | Ga0105245_11424234 | Ga0105245_114242341 | 134 |
| 78 | 3300009101 | Ga0105247_10120349 | Ga0105247_101203492 | 134 |
| 79 | 3300009553 | Ga0105249_12457515 | Ga0105249_124575151 | 134 |
| 80 | 3300013105 | Ga0157369_10076080 | Ga0157369_100760802 | 134 |
| 81 | 3300013105 | Ga0157369_10776140 | Ga0157369_107761402 | 134 |
| 82 | 3300013296 | Ga0157374_10144195 | Ga0157374_101441952 | 134 |
| 83 | 3300013297 | Ga0157378_10932424 | Ga0157378_109324242 | 134 |
| 84 | 3300013307 | Ga0157372_10727152 | Ga0157372_107271522 | 134 |
| 85 | 3300013307 | Ga0157372_12015031 | Ga0157372_120150312 | 134 |
| 86 | 3300013308 | Ga0157375_10122051 | Ga0157375_101220513 | 134 |
| 87 | 3300013308 | Ga0157375_11938197 | Ga0157375_119381971 | 134 |
| 88 | 3300014325 | Ga0163163_10044741 | Ga0163163_100447415 | 134 |
| 89 | 3300014325 | Ga0163163_10893804 | Ga0163163_108938042 | 134 |
| 90 | 3300014325 | Ga0163163_11436036 | Ga0163163_114360362 | 134 |
| 91 | 3300014326 | Ga0157380_10260827 | Ga0157380_102608272 | 134 |
| 92 | 3300014745 | Ga0157377_10768294 | Ga0157377_107682941 | 134 |
| 93 | 3300014968 | Ga0157379_10377709 | Ga0157379_103777092 | 134 |
| 94 | 3300014969 | Ga0157376_10019738 | Ga0157376_100197385 | 134 |
| 95 | 3300025898 | Ga0207692_10571778 | Ga0207692_105717781 | 134 |
| 96 | 3300025898 | Ga0207692_10690115 | Ga0207692_106901151 | 134 |
| 97 | 3300025900 | Ga0207710_10061999 | Ga0207710_100619992 | 134 |
| 98 | 3300025905 | Ga0207685_10061212 | Ga0207685_100612122 | 134 |
| 99 | 3300025906 | Ga0207699_10093293 | Ga0207699_100932932 | 134 |
| 100 | 3300025910 | Ga0207684_10983868 | Ga0207684_109838682 | 134 |
| 101 | 3300025915 | Ga0207693_10850994 | Ga0207693_108509941 | 134 |
| 102 | 3300025915 | Ga0207693_11272936 | Ga0207693_112729361 | 134 |
| 103 | 3300025916 | Ga0207663_10345681 | Ga0207663_103456812 | 134 |
| 104 | 3300025916 | Ga0207663_11551416 | Ga0207663_115514161 | 134 |
| 105 | 3300025919 | Ga0207657_10773782 | Ga0207657_107737822 | 134 |
| 106 | 3300025921 | Ga0207652_10423250 | Ga0207652_104232502 | 134 |
| 107 | 3300025922 | Ga0207646_10592611 | Ga0207646_105926112 | 134 |
| 108 | 3300025927 | Ga0207687_10913408 | Ga0207687_109134081 | 134 |
| 109 | 3300025928 | Ga0207700_10123414 | Ga0207700_101234142 | 134 |
| 110 | 3300025928 | Ga0207700_10966899 | Ga0207700_109668992 | 134 |
| 111 | 3300025929 | Ga0207664_10630510 | Ga0207664_106305102 | 134 |
| 112 | 3300025931 | Ga0207644_11090686 | Ga0207644_110906862 | 134 |
| 113 | 3300025932 | Ga0207690_10549922 | Ga0207690_105499222 | 134 |
| 114 | 3300025942 | Ga0207689_10708216 | Ga0207689_107082162 | 134 |
| 115 | 3300025945 | Ga0207679_11581522 | Ga0207679_115815221 | 134 |
| 116 | 3300025949 | Ga0207667_10214927 | Ga0207667_102149272 | 134 |
| 117 | 3300025972 | Ga0207668_10091888 | Ga0207668_100918882 | 134 |
| 118 | 3300026035 | Ga0207703_10102263 | Ga0207703_101022632 | 134 |
| 119 | 3300026041 | Ga0207639_10337152 | Ga0207639_103371522 | 134 |
| 120 | 3300026041 | Ga0207639_10441563 | Ga0207639_104415632 | 134 |
| 121 | 3300026078 | Ga0207702_10104067 | Ga0207702_101040673 | 134 |
| 122 | 3300026088 | Ga0207641_10090128 | Ga0207641_100901284 | 134 |
| 123 | 3300026088 | Ga0207641_10579688 | Ga0207641_105796882 | 134 |
| 124 | 3300026095 | Ga0207676_10063085 | Ga0207676_100630853 | 134 |
| 125 | 3300026095 | Ga0207676_10720595 | Ga0207676_107205951 | 134 |
| 126 | 3300026116 | Ga0207674_10769581 | Ga0207674_107695812 | 134 |
| 127 | 3300026142 | Ga0207698_12071973 | Ga0207698_120719731 | 134 |
| 128 | 3300028380 | Ga0268265_11519544 | Ga0268265_115195441 | 134 |
| 129 | 3300028381 | Ga0268264_10031707 | Ga0268264_100317075 | 134 |
| 130 | 3300031507 | Ga0307509_10094852 | Ga0307509_100948523 | 134 |
| 131 | 3300033179 | Ga0307507_10029253 | Ga0307507_100292535 | 134 |
| 132 | 3300035113 | Ga0373936_0051659 | Ga0373936_0051659_191_598 | 134 |
| 133 | 3300035117 | Ga0373953_0070889 | Ga0373953_0070889_288_695 | 134 |
| 134 | 3300035118 | Ga0373954_0634761 | Ga0373954_0634761_52_471 | 134 |
| 135 | 3300035120 | Ga0373957_0054954 | Ga0373957_0054954_704_1123 | 134 |
| 136 | 3300035172 | Ga0373955_0471995 | Ga0373955_0471995_212_631 | 134 |
| 137 | 3300035695 | Ga0373927_0524517 | Ga0373927_0524517_18_425 | 134 |
| 138 | 3300035695 | Ga0373927_0591656 | Ga0373927_0591656_227_706 | 134 |
| 139 | 3300035724 | Ga0373933_0221341 | Ga0373933_0221341_409_816 | 134 |
| 140 | 3300036401 | Ga0373937_0570766 | Ga0373937_0570766_651_1058 | 134 |
| 141 | 3300044693 | Ga0466961_0044304 | Ga0466961_0044304_1249_1659 | 134 |
| 142 | 3300044694 | Ga0466963_0215084 | Ga0466963_0215084_139_549 | 134 |
| 143 | 3300044719 | Ga0466971_0027468 | Ga0466971_0027468_805_1215 | 134 |
| 144 | 3300045836 | Ga0466958_0083621 | Ga0466958_0083621_1316_1726 | 134 |
| 145 | 3300045976 | Ga0466967_0054255 | Ga0466967_0054255_715_1125 | 134 |
| 146 | 3300045976 | Ga0466967_0456072 | Ga0466967_0456072_42_452 | 134 |
| 147 | 3300046454 | Ga0495592_0011582 | Ga0495592_0011582_1703_2122 | 134 |
| 148 | 3300046455 | Ga0495603_0522452 | Ga0495603_0522452_221_628 | 134 |
| 149 | 3300046459 | Ga0495629_0094848 | Ga0495629_0094848_717_1124 | 134 |
| 150 | 3300046461 | Ga0495641_0534605 | Ga0495641_0534605_106_525 | 134 |
| 151 | 3300046462 | Ga0495651_0002869 | Ga0495651_0002869_5903_6322 | 134 |
| 152 | 3300046463 | Ga0495653_0050613 | Ga0495653_0050613_777_1196 | 134 |
| 153 | 3300046476 | Ga0495662_0032122 | Ga0495662_0032122_2011_2430 | 134 |
| 154 | 3300046476 | Ga0495662_0451848 | Ga0495662_0451848_105_524 | 134 |
| 155 | 3300046477 | Ga0495664_0110842 | Ga0495664_0110842_1099_1518 | 134 |
| 156 | 3300046511 | Ga0495608_0077381 | Ga0495608_0077381_1309_1728 | 134 |
| 157 | 3300046514 | Ga0495618_0013624 | Ga0495618_0013624_3798_4217 | 134 |
| 158 | 3300046516 | Ga0495628_0043289 | Ga0495628_0043289_2343_2762 | 134 |
| 159 | 3300046529 | Ga0495652_0054089 | Ga0495652_0054089_438_857 | 134 |
| 160 | 3300046531 | Ga0495665_0141233 | Ga0495665_0141233_662_1069 | 134 |
| 161 | 3300046533 | Ga0495640_0092406 | Ga0495640_0092406_1394_1813 | 134 |
| 162 | 3300046535 | Ga0495586_0202568 | Ga0495586_0202568_468_887 | 134 |
| 163 | 3300046536 | Ga0495587_0029292 | Ga0495587_0029292_1405_1824 | 134 |
| 164 | 3300046543 | Ga0495645_0024293 | Ga0495645_0024293_1413_1832 | 134 |
| 165 | 3300046543 | Ga0495645_0659425 | Ga0495645_0659425_150_569 | 134 |
| 166 | 3300046559 | Ga0495667_0012241 | Ga0495667_0012241_4756_5175 | 134 |
| 167 | 3300046642 | Ga0495634_0108540 | Ga0495634_0108540_490_909 | 134 |
| 168 | 3300046663 | Ga0495635_0026312 | Ga0495635_0026312_1511_1918 | 134 |
| 169 | 3300046675 | Ga0495657_0044122 | Ga0495657_0044122_661_1068 | 134 |
| 170 | 3300046678 | Ga0495599_0023916 | Ga0495599_0023916_561_980 | 134 |
| 171 | 3300046680 | Ga0495646_0224092 | Ga0495646_0224092_403_822 | 134 |
| 172 | 3300046690 | Ga0495624_0068541 | Ga0495624_0068541_1089_1508 | 134 |
| 173 | 3300047317 | Ga0495604_0005531 | Ga0495604_0005531_68_487 | 134 |
| 174 | 3300047317 | Ga0495604_0618009 | Ga0495604_0618009_15_422 | 134 |
| 175 | 3300047319 | Ga0495674_0022122 | Ga0495674_0022122_179_598 | 134 |
| 176 | 3300047321 | Ga0495676_0887637 | Ga0495676_0887637_79_498 | 134 |
| 177 | 3300047321 | Ga0495676_1041661 | Ga0495676_1041661_27_506 | 134 |
| 178 | 3300047322 | Ga0495680_0032368 | Ga0495680_0032368_646_1065 | 134 |
| 179 | 3300047444 | Ga0495675_0064276 | Ga0495675_0064276_1660_2079 | 134 |
| 180 | 3300047471 | Ga0495684_0015078 | Ga0495684_0015078_2564_2983 | 134 |
| 181 | 3300048088 | Ga0495602_0018767 | Ga0495602_0018767_1587_2006 | 134 |
| 182 | 3300048905 | Ga0496102_0149195 | Ga0496102_0149195_1429_1848 | 134 |
| 183 | 3300048908 | Ga0496105_0024910 | Ga0496105_0024910_2921_3340 | 134 |
| 184 | 3300048910 | Ga0496107_0856605 | Ga0496107_0856605_232_651 | 134 |
| 185 | 3300048911 | Ga0496108_0049132 | Ga0496108_0049132_2455_2874 | 134 |
| 186 | 3300048912 | Ga0496109_0010556 | Ga0496109_0010556_2732_3151 | 134 |
| 187 | 3300048912 | Ga0496109_0491792 | Ga0496109_0491792_713_1129 | 134 |
| 188 | 3300048914 | Ga0496111_0082515 | Ga0496111_0082515_388_807 | 134 |
| 189 | 3300048914 | Ga0496111_0241372 | Ga0496111_0241372_873_1289 | 134 |
| 190 | 3300048915 | Ga0496112_0061758 | Ga0496112_0061758_1492_1911 | 134 |
| 191 | 3300048916 | Ga0496113_0269106 | Ga0496113_0269106_393_812 | 134 |
| 192 | 3300048917 | Ga0496114_1096959 | Ga0496114_1096959_67_483 | 134 |
| 193 | 3300049570 | Ga0501033_0832461 | Ga0501033_0832461_24_455 | 134 |
| 194 | 3300049571 | Ga0501034_1192782 | Ga0501034_1192782_39_455 | 134 |
| 195 | 3300049574 | Ga0501038_0305188 | Ga0501038_0305188_136_591 | 134 |
| 196 | 3300049575 | Ga0501039_0178295 | Ga0501039_0178295_1024_1479 | 134 |
| 197 | 3300049578 | Ga0501042_0219303 | Ga0501042_0219303_124_579 | 134 |
| 198 | 3300049580 | Ga0501046_0689949 | Ga0501046_0689949_253_708 | 134 |
| 199 | 3300049581 | Ga0501047_0178860 | Ga0501047_0178860_732_1163 | 134 |
| 200 | 3300049582 | Ga0501048_0185824 | Ga0501048_0185824_675_1130 | 134 |
| 201 | 3300049582 | Ga0501048_1372243 | Ga0501048_1372243_35_496 | 134 |
| 202 | 3300049584 | Ga0501068_0142842 | Ga0501068_0142842_1064_1480 | 134 |
| 203 | 3300049586 | Ga0501070_1269507 | Ga0501070_1269507_52_507 | 134 |
| 204 | 3300049587 | Ga0501071_0271223 | Ga0501071_0271223_303_728 | 134 |
| 205 | 3300049588 | Ga0501072_0008667 | Ga0501072_0008667_231_656 | 134 |
| 206 | 3300049591 | Ga0501075_0052538 | Ga0501075_0052538_1167_1622 | 134 |
| 207 | 3300049592 | Ga0501076_0365720 | Ga0501076_0365720_73_528 | 134 |
| 208 | 3300049743 | Ga0501081_0211033 | Ga0501081_0211033_877_1332 | 134 |
| 209 | 3300049823 | Ga0501044_0077655 | Ga0501044_0077655_2560_2991 | 134 |
| 210 | 3300050513 | nmdc:mga0rr50_459006_c1 | nmdc:mga0rr50_459006_c1_390_797 | 134 |
| 211 | 3300053077 | Ga0495601_0027620 | Ga0495601_0027620_642_1061 | 134 |
| 212 | 3300053083 | Ga0495655_0023323 | Ga0495655_0023323_653_1063 | 134 |
| 213 | 3300060353 | Ga0501082_0035739 | Ga0501082_0035739_3750_4205 | 134 |
| 214 | 3300061719 | Ga0466962_0035081 | Ga0466962_0035081_690_1100 | 134 |
| 215 | 3300061734 | Ga0530510_0172406 | Ga0530510_0172406_217_672 | 134 |
| 216 | 3300003316 | rootH1_10001257 | rootH1_100012574 | 135 |
| 217 | 3300003322 | rootL2_10035585 | rootL2_100355856 | 135 |
| 218 | 3300003323 | rootH1_10380731 | rootH1_103807313 | 135 |
| 219 | 3300004803 | Ga0058862_11966842 | Ga0058862_119668422 | 135 |
| 220 | 3300005329 | Ga0070683_100109993 | Ga0070683_1001099934 | 135 |
| 221 | 3300005331 | Ga0070670_100095555 | Ga0070670_1000955552 | 135 |
| 222 | 3300005333 | Ga0070677_10172794 | Ga0070677_101727942 | 135 |
| 223 | 3300005335 | Ga0070666_10351567 | Ga0070666_103515672 | 135 |
| 224 | 3300005336 | Ga0070680_100009914 | Ga0070680_1000099143 | 135 |
| 225 | 3300005337 | Ga0070682_100129709 | Ga0070682_1001297092 | 135 |
| 226 | 3300005338 | Ga0068868_101034290 | Ga0068868_1010342901 | 135 |
| 227 | 3300005340 | Ga0070689_100015623 | Ga0070689_1000156235 | 135 |
| 228 | 3300005343 | Ga0070687_100022735 | Ga0070687_1000227355 | 135 |
| 229 | 3300005344 | Ga0070661_100152800 | Ga0070661_1001528002 | 135 |
| 230 | 3300005344 | Ga0070661_100450017 | Ga0070661_1004500172 | 135 |
| 231 | 3300005355 | Ga0070671_100037794 | Ga0070671_1000377945 | 135 |
| 232 | 3300005355 | Ga0070671_100301415 | Ga0070671_1003014152 | 135 |
| 233 | 3300005356 | Ga0070674_100033394 | Ga0070674_1000333942 | 135 |
| 234 | 3300005366 | Ga0070659_100009099 | Ga0070659_1000090998 | 135 |
| 235 | 3300005436 | Ga0070713_100424828 | Ga0070713_1004248282 | 135 |
| 236 | 3300005439 | Ga0070711_100005421 | Ga0070711_1000054215 | 135 |
| 237 | 3300005441 | Ga0070700_100034292 | Ga0070700_1000342922 | 135 |
| 238 | 3300005455 | Ga0070663_100237188 | Ga0070663_1002371882 | 135 |
| 239 | 3300005456 | Ga0070678_100183667 | Ga0070678_1001836672 | 135 |
| 240 | 3300005456 | Ga0070678_101062017 | Ga0070678_1010620171 | 135 |
| 241 | 3300005457 | Ga0070662_100041686 | Ga0070662_1000416865 | 135 |
| 242 | 3300005458 | Ga0070681_10005299 | Ga0070681_1000529915 | 135 |
| 243 | 3300005458 | Ga0070681_10016679 | Ga0070681_100166797 | 135 |
| 244 | 3300005458 | Ga0070681_10024157 | Ga0070681_100241575 | 135 |
| 245 | 3300005458 | Ga0070681_10028575 | Ga0070681_100285756 | 135 |
| 246 | 3300005459 | Ga0068867_100659272 | Ga0068867_1006592722 | 135 |
| 247 | 3300005530 | Ga0070679_100003106 | Ga0070679_1000031062 | 135 |
| 248 | 3300005530 | Ga0070679_100010037 | Ga0070679_1000100376 | 135 |
| 249 | 3300005530 | Ga0070679_100031042 | Ga0070679_1000310423 | 135 |
| 250 | 3300005530 | Ga0070679_100179267 | Ga0070679_1001792672 | 135 |
| 251 | 3300005530 | Ga0070679_100732545 | Ga0070679_1007325452 | 135 |
| 252 | 3300005535 | Ga0070684_100045671 | Ga0070684_1000456714 | 135 |
| 253 | 3300005535 | Ga0070684_100360659 | Ga0070684_1003606592 | 135 |
| 254 | 3300005539 | Ga0068853_100908282 | Ga0068853_1009082822 | 135 |
| 255 | 3300005563 | Ga0068855_100882592 | Ga0068855_1008825922 | 135 |
| 256 | 3300005564 | Ga0070664_100686168 | Ga0070664_1006861682 | 135 |
| 257 | 3300005577 | Ga0068857_100010501 | Ga0068857_1000105015 | 135 |
| 258 | 3300005578 | Ga0068854_100124568 | Ga0068854_1001245682 | 135 |
| 259 | 3300005618 | Ga0068864_100078974 | Ga0068864_1000789742 | 135 |
| 260 | 3300005843 | Ga0068860_100478895 | Ga0068860_1004788951 | 135 |
| 261 | 3300005844 | Ga0068862_100146485 | Ga0068862_1001464852 | 135 |
| 262 | 3300006175 | Ga0070712_100170180 | Ga0070712_1001701801 | 135 |
| 263 | 3300006178 | Ga0075367_10843740 | Ga0075367_108437401 | 135 |
| 264 | 3300006195 | Ga0075366_10225293 | Ga0075366_102252931 | 135 |
| 265 | 3300006237 | Ga0097621_101045333 | Ga0097621_1010453332 | 135 |
| 266 | 3300006844 | Ga0075428_100004140 | Ga0075428_1000041407 | 135 |
| 267 | 3300006844 | Ga0075428_100016361 | Ga0075428_1000163619 | 135 |
| 268 | 3300006844 | Ga0075428_100028092 | Ga0075428_1000280923 | 135 |
| 269 | 3300006844 | Ga0075428_101543359 | Ga0075428_1015433592 | 135 |
| 270 | 3300006846 | Ga0075430_100019614 | Ga0075430_1000196144 | 135 |
| 271 | 3300006846 | Ga0075430_100130826 | Ga0075430_1001308262 | 135 |
| 272 | 3300006846 | Ga0075430_100148993 | Ga0075430_1001489933 | 135 |
| 273 | 3300006846 | Ga0075430_100294198 | Ga0075430_1002941982 | 135 |
| 274 | 3300006846 | Ga0075430_100334950 | Ga0075430_1003349502 | 135 |
| 275 | 3300006846 | Ga0075430_101371887 | Ga0075430_1013718871 | 135 |
| 276 | 3300006847 | Ga0075431_100023675 | Ga0075431_1000236755 | 135 |
| 277 | 3300006847 | Ga0075431_100231433 | Ga0075431_1002314333 | 135 |
| 278 | 3300006847 | Ga0075431_100280514 | Ga0075431_1002805143 | 135 |
| 279 | 3300006852 | Ga0075433_10432183 | Ga0075433_104321832 | 135 |
| 280 | 3300006852 | Ga0075433_10909464 | Ga0075433_109094641 | 135 |
| 281 | 3300006871 | Ga0075434_100006343 | Ga0075434_1000063439 | 135 |
| 282 | 3300006871 | Ga0075434_100008947 | Ga0075434_1000089471 | 135 |
| 283 | 3300006871 | Ga0075434_100495852 | Ga0075434_1004958522 | 135 |
| 284 | 3300006880 | Ga0075429_100065274 | Ga0075429_1000652744 | 135 |
| 285 | 3300006880 | Ga0075429_100471418 | Ga0075429_1004714181 | 135 |
| 286 | 3300006914 | Ga0075436_100041121 | Ga0075436_1000411213 | 135 |
| 287 | 3300007076 | Ga0075435_100007211 | Ga0075435_1000072111 | 135 |
| 288 | 3300007076 | Ga0075435_100474329 | Ga0075435_1004743292 | 135 |
| 289 | 3300009094 | Ga0111539_10115886 | Ga0111539_101158863 | 135 |
| 290 | 3300009094 | Ga0111539_10253257 | Ga0111539_102532572 | 135 |
| 291 | 3300009147 | Ga0114129_10024381 | Ga0114129_100243813 | 135 |
| 292 | 3300009147 | Ga0114129_10054079 | Ga0114129_100540795 | 135 |
| 293 | 3300009147 | Ga0114129_10774911 | Ga0114129_107749111 | 135 |
| 294 | 3300009177 | Ga0105248_10024686 | Ga0105248_100246865 | 135 |
| 295 | 3300009177 | Ga0105248_10478922 | Ga0105248_104789222 | 135 |
| 296 | 3300009545 | Ga0105237_10732971 | Ga0105237_107329712 | 135 |
| 297 | 3300009551 | Ga0105238_10502464 | Ga0105238_105024642 | 135 |
| 298 | 3300011119 | Ga0105246_10278291 | Ga0105246_102782912 | 135 |
| 299 | 3300013100 | Ga0157373_10259841 | Ga0157373_102598412 | 135 |
| 300 | 3300013105 | Ga0157369_10022113 | Ga0157369_100221135 | 135 |
| 301 | 3300013297 | Ga0157378_10530712 | Ga0157378_105307122 | 135 |
| 302 | 3300013307 | Ga0157372_11701787 | Ga0157372_117017872 | 135 |
| 303 | 3300013308 | Ga0157375_11260783 | Ga0157375_112607832 | 135 |
| 304 | 3300014325 | Ga0163163_10014609 | Ga0163163_100146092 | 135 |
| 305 | 3300014326 | Ga0157380_10201351 | Ga0157380_102013512 | 135 |
| 306 | 3300015265 | Ga0182005_1027799 | Ga0182005_10277992 | 135 |
| 307 | 3300025903 | Ga0207680_10171419 | Ga0207680_101714191 | 135 |
| 308 | 3300025912 | Ga0207707_10019304 | Ga0207707_100193045 | 135 |
| 309 | 3300025912 | Ga0207707_10025936 | Ga0207707_100259362 | 135 |
| 310 | 3300025912 | Ga0207707_10030972 | Ga0207707_100309724 | 135 |
| 311 | 3300025912 | Ga0207707_10059964 | Ga0207707_100599641 | 135 |
| 312 | 3300025915 | Ga0207693_11267274 | Ga0207693_112672741 | 135 |
| 313 | 3300025916 | Ga0207663_10003317 | Ga0207663_100033176 | 135 |
| 314 | 3300025917 | Ga0207660_10028143 | Ga0207660_100281435 | 135 |
| 315 | 3300025917 | Ga0207660_10090602 | Ga0207660_100906023 | 135 |
| 316 | 3300025919 | Ga0207657_10037512 | Ga0207657_100375122 | 135 |
| 317 | 3300025920 | Ga0207649_10007168 | Ga0207649_100071688 | 135 |
| 318 | 3300025920 | Ga0207649_10502651 | Ga0207649_105026512 | 135 |
| 319 | 3300025921 | Ga0207652_10005180 | Ga0207652_1000518018 | 135 |
| 320 | 3300025921 | Ga0207652_10046125 | Ga0207652_100461256 | 135 |
| 321 | 3300025921 | Ga0207652_10108760 | Ga0207652_101087602 | 135 |
| 322 | 3300025921 | Ga0207652_10426377 | Ga0207652_104263772 | 135 |
| 323 | 3300025921 | Ga0207652_10574950 | Ga0207652_105749502 | 135 |
| 324 | 3300025924 | Ga0207694_10347292 | Ga0207694_103472921 | 135 |
| 325 | 3300025925 | Ga0207650_10058229 | Ga0207650_100582292 | 135 |
| 326 | 3300025928 | Ga0207700_10216741 | Ga0207700_102167413 | 135 |
| 327 | 3300025931 | Ga0207644_10054218 | Ga0207644_100542185 | 135 |
| 328 | 3300025932 | Ga0207690_10002601 | Ga0207690_100026015 | 135 |
| 329 | 3300025932 | Ga0207690_10906059 | Ga0207690_109060591 | 135 |
| 330 | 3300025937 | Ga0207669_10084461 | Ga0207669_100844612 | 135 |
| 331 | 3300025938 | Ga0207704_11273173 | Ga0207704_112731731 | 135 |
| 332 | 3300025940 | Ga0207691_10002077 | Ga0207691_100020779 | 135 |
| 333 | 3300025941 | Ga0207711_10049338 | Ga0207711_100493381 | 135 |
| 334 | 3300025944 | Ga0207661_10374710 | Ga0207661_103747102 | 135 |
| 335 | 3300025945 | Ga0207679_10007865 | Ga0207679_100078657 | 135 |
| 336 | 3300025949 | Ga0207667_10698930 | Ga0207667_106989302 | 135 |
| 337 | 3300025972 | Ga0207668_11452375 | Ga0207668_114523752 | 135 |
| 338 | 3300025981 | Ga0207640_11875798 | Ga0207640_118757981 | 135 |
| 339 | 3300026041 | Ga0207639_10707525 | Ga0207639_107075252 | 135 |
| 340 | 3300026067 | Ga0207678_10038206 | Ga0207678_100382064 | 135 |
| 341 | 3300026078 | Ga0207702_10470872 | Ga0207702_104708722 | 135 |
| 342 | 3300026089 | Ga0207648_10967684 | Ga0207648_109676842 | 135 |
| 343 | 3300026116 | Ga0207674_10001105 | Ga0207674_1000110515 | 135 |
| 344 | 3300026118 | Ga0207675_100003327 | Ga0207675_10000332713 | 135 |
| 345 | 3300026121 | Ga0207683_10247677 | Ga0207683_102476772 | 135 |
| 346 | 3300026121 | Ga0207683_10924187 | Ga0207683_109241872 | 135 |
| 347 | 3300026142 | Ga0207698_12143014 | Ga0207698_121430141 | 135 |
| 348 | 3300028380 | Ga0268265_10136316 | Ga0268265_101363162 | 135 |
| 349 | 3300032005 | Ga0307411_10322577 | Ga0307411_103225772 | 135 |
| 350 | 3300034817 | Ga0373948_0206844 | Ga0373948_0206844_86_496 | 135 |
| 351 | 3300034819 | Ga0373958_0048946 | Ga0373958_0048946_109_528 | 135 |
| 352 | 3300035115 | Ga0373941_0021701 | Ga0373941_0021701_262_672 | 135 |
| 353 | 3300035121 | Ga0373960_0240631 | Ga0373960_0240631_215_625 | 135 |
| 354 | 3300035691 | Ga0373931_0205742 | Ga0373931_0205742_313_732 | 135 |
| 355 | 3300037068 | Ga0373925_0404970 | Ga0373925_0404970_76_486 | 135 |
| 356 | 3300041451 | Ga0451791_0435390 | Ga0451791_0435390_83_514 | 135 |
| 357 | 3300045051 | Ga0451576_0126907 | Ga0451576_0126907_1185_1595 | 135 |
| 358 | 3300046459 | Ga0495629_0058023 | Ga0495629_0058023_1620_2030 | 135 |
| 359 | 3300046460 | Ga0495638_0012956 | Ga0495638_0012956_4954_5373 | 135 |
| 360 | 3300046531 | Ga0495665_0664002 | Ga0495665_0664002_74_484 | 135 |
| 361 | 3300048903 | Ga0496100_0357858 | Ga0496100_0357858_155_568 | 135 |
| 362 | 3300048903 | Ga0496100_0482663 | Ga0496100_0482663_97_516 | 135 |
| 363 | 3300048904 | Ga0496101_0170100 | Ga0496101_0170100_764_1177 | 135 |
| 364 | 3300048904 | Ga0496101_0440657 | Ga0496101_0440657_415_834 | 135 |
| 365 | 3300048905 | Ga0496102_0052747 | Ga0496102_0052747_3140_3559 | 135 |
| 366 | 3300048907 | Ga0496104_0234974 | Ga0496104_0234974_427_840 | 135 |
| 367 | 3300048909 | Ga0496106_0086583 | Ga0496106_0086583_60_479 | 135 |
| 368 | 3300048909 | Ga0496106_0188787 | Ga0496106_0188787_696_1109 | 135 |
| 369 | 3300048910 | Ga0496107_0236958 | Ga0496107_0236958_813_1232 | 135 |
| 370 | 3300048911 | Ga0496108_0099804 | Ga0496108_0099804_1291_1704 | 135 |
| 371 | 3300048911 | Ga0496108_0111610 | Ga0496108_0111610_1598_2008 | 135 |
| 372 | 3300048912 | Ga0496109_0083729 | Ga0496109_0083729_299_712 | 135 |
| 373 | 3300048912 | Ga0496109_0089342 | Ga0496109_0089342_1266_1676 | 135 |
| 374 | 3300048913 | Ga0496110_0044836 | Ga0496110_0044836_2091_2504 | 135 |
| 375 | 3300048914 | Ga0496111_0388790 | Ga0496111_0388790_555_968 | 135 |
| 376 | 3300048915 | Ga0496112_0182624 | Ga0496112_0182624_288_701 | 135 |
| 377 | 3300048915 | Ga0496112_0514878 | Ga0496112_0514878_247_657 | 135 |
| 378 | 3300048916 | Ga0496113_0274105 | Ga0496113_0274105_897_1307 | 135 |
| 379 | 3300048916 | Ga0496113_0643013 | Ga0496113_0643013_77_490 | 135 |
| 380 | 3300048917 | Ga0496114_0202044 | Ga0496114_0202044_29_442 | 135 |
| 381 | 3300048919 | Ga0496116_0364421 | Ga0496116_0364421_28_441 | 135 |
| 382 | 3300048921 | Ga0496118_0207827 | Ga0496118_0207827_127_540 | 135 |
| 383 | 3300049576 | Ga0501040_0074762 | Ga0501040_0074762_860_1273 | 135 |
| 384 | 3300049580 | Ga0501046_0100289 | Ga0501046_0100289_435_848 | 135 |
| 385 | 3300049584 | Ga0501068_0136583 | Ga0501068_0136583_506_919 | 135 |
| 386 | 3300049585 | Ga0501069_0201288 | Ga0501069_0201288_491_904 | 135 |
| 387 | 3300049591 | Ga0501075_0017204 | Ga0501075_0017204_1239_1652 | 135 |
| 388 | 3300049592 | Ga0501076_0047475 | Ga0501076_0047475_1337_1750 | 135 |
| 389 | 3300049593 | Ga0501077_0112975 | Ga0501077_0112975_670_1083 | 135 |
| 390 | 3300049741 | Ga0501079_0020288 | Ga0501079_0020288_2409_2822 | 135 |
| 391 | 3300049741 | Ga0501079_0507857 | Ga0501079_0507857_119_532 | 135 |
| 392 | 3300049742 | Ga0501080_0779022 | Ga0501080_0779022_201_623 | 135 |
| 393 | 3300049824 | Ga0501045_0385019 | Ga0501045_0385019_161_574 | 135 |
| 394 | 3300050492 | nmdc:mga0yw44_1061464_c1 | nmdc:mga0yw44_1061464_c1_11_424 | 135 |
| 395 | 3300050507 | nmdc:mga05p37_117692_c1 | nmdc:mga05p37_117692_c1_1653_2063 | 135 |
| 396 | 3300050507 | nmdc:mga05p37_327721_c1 | nmdc:mga05p37_327721_c1_545_964 | 135 |
| 397 | 3300050508 | nmdc:mga09592_138495_c1 | nmdc:mga09592_138495_c1_1310_1720 | 135 |
| 398 | 3300050508 | nmdc:mga09592_277648_c1 | nmdc:mga09592_277648_c1_777_1196 | 135 |
| 399 | 3300050509 | nmdc:mga0qj67_107742_c1 | nmdc:mga0qj67_107742_c1_521_940 | 135 |
| 400 | 3300050509 | nmdc:mga0qj67_13702_c1 | nmdc:mga0qj67_13702_c1_3508_3921 | 135 |
| 401 | 3300050509 | nmdc:mga0qj67_43147_c1 | nmdc:mga0qj67_43147_c1_1616_2035 | 135 |
| 402 | 3300050509 | nmdc:mga0qj67_496852_c1 | nmdc:mga0qj67_496852_c1_369_782 | 135 |
| 403 | 3300050509 | nmdc:mga0qj67_586071_c1 | nmdc:mga0qj67_586071_c1_335_748 | 135 |
| 404 | 3300050509 | nmdc:mga0qj67_74579_c1 | nmdc:mga0qj67_74579_c1_720_1133 | 135 |
| 405 | 3300050510 | nmdc:mga06r32_350475_c1 | nmdc:mga06r32_350475_c1_710_1123 | 135 |
| 406 | 3300050510 | nmdc:mga06r32_512718_c1 | nmdc:mga06r32_512718_c1_538_951 | 135 |
| 407 | 3300050511 | nmdc:mga08y16_309181_c1 | nmdc:mga08y16_309181_c1_980_1390 | 135 |
| 408 | 3300050511 | nmdc:mga08y16_646293_c1 | nmdc:mga08y16_646293_c1_412_825 | 135 |
| 409 | 3300050512 | nmdc:mga0n895_19427_c1 | nmdc:mga0n895_19427_c1_3672_4082 | 135 |
| 410 | 3300050512 | nmdc:mga0n895_2252530_c1 | nmdc:mga0n895_2252530_c1_33_446 | 135 |
| 411 | 3300050513 | nmdc:mga0rr50_16263_c1 | nmdc:mga0rr50_16263_c1_4265_4678 | 135 |
| 412 | 3300050513 | nmdc:mga0rr50_985683_c1 | nmdc:mga0rr50_985683_c1_164_577 | 135 |
| 413 | 3300050514 | nmdc:mga08x19_110105_c1 | nmdc:mga08x19_110105_c1_469_882 | 135 |
| 414 | 3300050515 | nmdc:mga0a205_430993_c1 | nmdc:mga0a205_430993_c1_492_905 | 135 |
| 415 | 3300050515 | nmdc:mga0a205_48978_c1 | nmdc:mga0a205_48978_c1_3446_3856 | 135 |
| 416 | 3300053116 | Ga0500592_015929 | Ga0500592_015929_419_838 | 135 |
| 417 | 3300054114 | Ga0501084_0228032 | Ga0501084_0228032_378_791 | 135 |
| 418 | 3300054114 | Ga0501084_0273820 | Ga0501084_0273820_675_1088 | 135 |
| 419 | 3300054114 | Ga0501084_1669745 | Ga0501084_1669745_54_467 | 135 |
| 420 | 3300060353 | Ga0501082_0564585 | Ga0501082_0564585_411_824 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nv4-assembly1.cif.gz_B | crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 | 0.9495 | 2 | 128 |
| 3okx-assembly1.cif.gz_B | crystal structure of yaeb-like protein from rhodopseudomonas palustris | 0.9216 | 2 | 127 |
| 3okx-assembly1.cif.gz_A | crystal structure of yaeb-like protein from rhodopseudomonas palustris | 0.9107 | 2 | 135 |
| 2nv4-assembly1.cif.gz_B | crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 | 0.8877 | 2 | 128 |
| 3okx-assembly1.cif.gz_B | crystal structure of yaeb-like protein from rhodopseudomonas palustris | 0.8437 | 2 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nv4B00 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.9498 | 3 | 128 | 2.40.30.70 |
| af_Q58978_4_126_2.40.30.70 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.9155 | 4 | 128 | 2.40.30.70 |
| 3okxB00 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.8971 | 2 | 134 | 2.40.30.70 |
| af_Q9BU70_29_181_2.40.30.70 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.8949 | 3 | 128 | 2.40.30.70 |
| af_A1Z759_99_248_2.40.30.70 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.8948 | 3 | 128 | 2.40.30.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538A8W8-F1-model_v4 | tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO | 0.9841 | 1 | 128 |
GO:0008168
GO:0032259 |
| AF-A0A372JAW0-F1-model_v4 | tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO | 0.9833 | 1 | 130 |
GO:0008168
GO:0032259 |
| AF-A0A127JRV9-F1-model_v4 | Methyltransferase | 0.983 | 2 | 128 |
GO:0008168
GO:0032259 |
| AF-A0A5J5JZE6-F1-model_v4 | tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO | 0.9822 | 1 | 130 |
GO:0008168
GO:0032259 |
| AF-A0A4P2QHZ5-F1-model_v4 | TsaA-like domain-containing protein | 0.981 | 1 | 129 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar