F439762

General Info

Members Datasets Scaffolds Average Seq Length
420 255 418 137

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_11551106|Ga0268266_115511061
Length 135
Sequence MTSFVLRPVGRVESPLTDPSDAPRQPDEGAPEAWLVFDAFAPALEGLAPGTDMLLFTWLDRGDRETLAVHPRGDLSRPLTGVFATRAPDRPNPIGLHTVHVLAVEGNRVRVRHLEAVDGTPILDVKPLLGPTPER

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.24
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 8.1
Rhizosphere 88.81
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001257 3300003316 Bacteria 2063
2 rootL2_10035585 3300003322 Bacteria 4460
3 rootH1_10380731 3300003323 Bacteria 1938
4 Ga0058862_11966842 3300004803 Bacteria 1194
5 Ga0070683_100109993 3300005329 Bacteria 2599
6 Ga0070683_100225307 3300005329 Bacteria 1782
7 Ga0070670_100095555 3300005331 Unclassified 2556
8 Ga0070677_10172794 3300005333 Bacteria 1023
9 Ga0068869_100398650 3300005334 Bacteria 1131
10 Ga0070666_10351567 3300005335 Bacteria 1055
11 Ga0070680_100009914 3300005336 Bacteria 7335
12 Ga0070682_100129709 3300005337 Bacteria 1705
13 Ga0068868_100187949 3300005338 Bacteria 1717
14 Ga0068868_100692395 3300005338 Bacteria 911
15 Ga0068868_101034290 3300005338 Bacteria 753
16 Ga0070660_100990432 3300005339 Bacteria 710
17 Ga0070689_100015623 3300005340 Bacteria 5540
18 Ga0070691_10015127 3300005341 Bacteria 3545
19 Ga0070687_100022735 3300005343 Unclassified 2968
20 Ga0070661_100152800 3300005344 Bacteria 1746
21 Ga0070661_100450017 3300005344 Unclassified 1024
22 Ga0070668_100643144 3300005347 Bacteria 931
23 Ga0070671_100037794 3300005355 Bacteria 4005
24 Ga0070671_100301415 3300005355 Unclassified 1364
25 Ga0070671_100388555 3300005355 Bacteria 1193
26 Ga0070671_101790446 3300005355 Bacteria 546
27 Ga0070674_100033394 3300005356 Bacteria 3425
28 Ga0070659_100009099 3300005366 Bacteria 7285
29 Ga0070667_100078769 3300005367 Bacteria 2816
30 Ga0070709_10761800 3300005434 Bacteria 757
31 Ga0070714_100219837 3300005435 Bacteria 1745
32 Ga0070714_100711633 3300005435 Bacteria 969
33 Ga0070713_100424828 3300005436 Bacteria 1245
34 Ga0070713_100724674 3300005436 Bacteria 950
35 Ga0070713_100741349 3300005436 Bacteria 939
36 Ga0070713_100754018 3300005436 Bacteria 931
37 Ga0070710_10045055 3300005437 Bacteria 2450
38 Ga0070710_10547403 3300005437 Bacteria 799
39 Ga0070711_100005421 3300005439 Bacteria 7624
40 Ga0070711_100044736 3300005439 Bacteria 3006
41 Ga0070711_100205494 3300005439 Bacteria 1522
42 Ga0070711_100411852 3300005439 Bacteria 1099
43 Ga0070700_100034292 3300005441 Bacteria 3065
44 Ga0070708_101676624 3300005445 Unclassified 591
45 Ga0070663_100237188 3300005455 Bacteria 1438
46 Ga0070678_100183667 3300005456 Unclassified 1714
47 Ga0070678_101062017 3300005456 Bacteria 746
48 Ga0070662_100041686 3300005457 Bacteria 3276
49 Ga0070681_10005299 3300005458 Bacteria 12453
50 Ga0070681_10016679 3300005458 Bacteria 7333
51 Ga0070681_10024157 3300005458 Bacteria 6119
52 Ga0070681_10028575 3300005458 Bacteria 5607
53 Ga0068867_100659272 3300005459 Bacteria 919
54 Ga0070707_100298037 3300005468 Bacteria 1567
55 Ga0070679_100003106 3300005530 Bacteria 15181
56 Ga0070679_100010037 3300005530 Bacteria 8968
57 Ga0070679_100031042 3300005530 Bacteria 5279
58 Ga0070679_100179267 3300005530 Bacteria 2091
59 Ga0070679_100732545 3300005530 Unclassified 931
60 Ga0070684_100045671 3300005535 Bacteria 3793
61 Ga0070684_100121500 3300005535 Bacteria 2350
62 Ga0070684_100360659 3300005535 Bacteria 1338
63 Ga0068853_100663404 3300005539 Bacteria 993
64 Ga0068853_100908282 3300005539 Unclassified 846
65 Ga0070686_101540584 3300005544 Bacteria 561
66 Ga0070665_100354437 3300005548 Bacteria 1473
67 Ga0068855_100882592 3300005563 Unclassified 946
68 Ga0070664_100686168 3300005564 Unclassified 953
69 Ga0068857_100010501 3300005577 Bacteria 8048
70 Ga0068857_100503324 3300005577 Bacteria 1137
71 Ga0068854_100010504 3300005578 Bacteria 6007
72 Ga0068854_100124568 3300005578 Bacteria 1961
73 Ga0068856_100058409 3300005614 Bacteria 3809
74 Ga0068856_100185941 3300005614 Bacteria 2091
75 Ga0068856_100396961 3300005614 Bacteria 1399
76 Ga0068859_100169217 3300005617 Bacteria 2266
77 Ga0068859_100272974 3300005617 Unclassified 1783
78 Ga0068864_100078974 3300005618 Bacteria 2880
79 Ga0068864_100153671 3300005618 Bacteria 2087
80 Ga0068863_100039103 3300005841 Bacteria 4515
81 Ga0068863_100117560 3300005841 Bacteria 2534
82 Ga0068858_100016978 3300005842 Bacteria 6834
83 Ga0068858_100129338 3300005842 Bacteria 2367
84 Ga0068860_100022068 3300005843 Bacteria 6162
85 Ga0068860_100478895 3300005843 Bacteria 1240
86 Ga0068862_100146485 3300005844 Unclassified 2099
87 Ga0068862_100167043 3300005844 Bacteria 1967
88 Ga0070715_10775251 3300006163 Bacteria 580
89 Ga0070716_100030576 3300006173 Bacteria 2923
90 Ga0070712_100170180 3300006175 Bacteria 1690
91 Ga0070712_100442798 3300006175 Bacteria 1080
92 Ga0075367_10843740 3300006178 Bacteria 584
93 Ga0075366_10014267 3300006195 Bacteria 4538
94 Ga0075366_10225293 3300006195 Bacteria 1142
95 Ga0097621_101045333 3300006237 Unclassified 765
96 Ga0097621_101949228 3300006237 Bacteria 561
97 Ga0068871_100035193 3300006358 Bacteria 3977
98 Ga0075428_100004140 3300006844 Bacteria 15965
99 Ga0075428_100016361 3300006844 Bacteria 8195
100 Ga0075428_100028092 3300006844 Bacteria 6222
101 Ga0075428_101543359 3300006844 Bacteria 695
102 Ga0075430_100019614 3300006846 Bacteria 5752
103 Ga0075430_100130826 3300006846 Bacteria 2092
104 Ga0075430_100148993 3300006846 Bacteria 1949
105 Ga0075430_100294198 3300006846 Bacteria 1343
106 Ga0075430_100334950 3300006846 Bacteria 1250
107 Ga0075430_101371887 3300006846 Unclassified 581
108 Ga0075431_100023675 3300006847 Bacteria 6286
109 Ga0075431_100231433 3300006847 Bacteria 1883
110 Ga0075431_100280514 3300006847 Bacteria 1687
111 Ga0075433_10432183 3300006852 Bacteria 1161
112 Ga0075433_10909464 3300006852 Bacteria 767
113 Ga0075434_100006343 3300006871 Bacteria 10843
114 Ga0075434_100008947 3300006871 Bacteria 9325
115 Ga0075434_100201377 3300006871 Bacteria 2011
116 Ga0075434_100495852 3300006871 Bacteria 1242
117 Ga0075429_100065274 3300006880 Bacteria 3169
118 Ga0075429_100471418 3300006880 Bacteria 1100
119 Ga0075436_100041121 3300006914 Bacteria 3190
120 Ga0097620_100169218 3300006931 Bacteria 2266
121 Ga0097620_100272977 3300006931 Unclassified 1783
122 Ga0075435_100007211 3300007076 Bacteria 7907
123 Ga0075435_100474329 3300007076 Unclassified 1080
124 Ga0111539_10115886 3300009094 Bacteria 3141
125 Ga0111539_10253257 3300009094 Bacteria 2050
126 Ga0105245_10249870 3300009098 Bacteria 1722
127 Ga0105245_11156563 3300009098 Bacteria 821
128 Ga0105245_11424234 3300009098 Unclassified 743
129 Ga0105247_10120349 3300009101 Bacteria 1700
130 Ga0114129_10024381 3300009147 Bacteria 8572
131 Ga0114129_10054079 3300009147 Bacteria 5630
132 Ga0114129_10774911 3300009147 Bacteria 1226
133 Ga0105248_10024686 3300009177 Bacteria 6684
134 Ga0105248_10478922 3300009177 Bacteria 1403
135 Ga0105237_10732971 3300009545 Unclassified 995
136 Ga0105238_10502464 3300009551 Bacteria 1213
137 Ga0105249_12457515 3300009553 Bacteria 593
138 Ga0105246_10278291 3300011119 Bacteria 1341
139 Ga0157373_10259841 3300013100 Unclassified 1229
140 Ga0157369_10022113 3300013105 Bacteria 7104
141 Ga0157369_10076080 3300013105 Bacteria 3598
142 Ga0157369_10776140 3300013105 Bacteria 985
143 Ga0157374_10144195 3300013296 Bacteria 2313
144 Ga0157378_10530712 3300013297 Bacteria 1180
145 Ga0157378_10932424 3300013297 Bacteria 900
146 Ga0157372_10727152 3300013307 Bacteria 1154
147 Ga0157372_11701787 3300013307 Unclassified 726
148 Ga0157372_12015031 3300013307 Bacteria 663
149 Ga0157375_10122051 3300013308 Bacteria 2716
150 Ga0157375_11260783 3300013308 Bacteria 868
151 Ga0157375_11938197 3300013308 Bacteria 700
152 Ga0163163_10014609 3300014325 Bacteria 7223
153 Ga0163163_10044741 3300014325 Bacteria 4344
154 Ga0163163_10893804 3300014325 Unclassified 952
155 Ga0163163_11436036 3300014325 Bacteria 751
156 Ga0157380_10201351 3300014326 Unclassified 1767
157 Ga0157380_10260827 3300014326 Bacteria 1574
158 Ga0157377_10768294 3300014745 Unclassified 707
159 Ga0157379_10377709 3300014968 Bacteria 1300
160 Ga0157376_10019738 3300014969 Bacteria 5201
161 Ga0182005_1027799 3300015265 Bacteria 1542
162 Ga0207692_10299337 3300025898 Bacteria 978
163 Ga0207692_10571778 3300025898 Bacteria 724
164 Ga0207692_10690115 3300025898 Unclassified 662
165 Ga0207710_10061999 3300025900 Bacteria 1698
166 Ga0207680_10171419 3300025903 Bacteria 1462
167 Ga0207685_10061212 3300025905 Bacteria 1492
168 Ga0207699_10093293 3300025906 Bacteria 1894
169 Ga0207684_10983868 3300025910 Bacteria 706
170 Ga0207707_10019304 3300025912 Bacteria 5949
171 Ga0207707_10025936 3300025912 Bacteria 5126
172 Ga0207707_10030972 3300025912 Bacteria 4679
173 Ga0207707_10059964 3300025912 Bacteria 3310
174 Ga0207693_10850994 3300025915 Unclassified 701
175 Ga0207693_11267274 3300025915 Bacteria 553
176 Ga0207693_11272936 3300025915 Unclassified 551
177 Ga0207663_10003317 3300025916 Bacteria 7855
178 Ga0207663_10345681 3300025916 Bacteria 1125
179 Ga0207663_11551416 3300025916 Bacteria 533
180 Ga0207660_10028143 3300025917 Bacteria 3843
181 Ga0207660_10090602 3300025917 Bacteria 2266
182 Ga0207657_10037512 3300025919 Bacteria 4326
183 Ga0207657_10773782 3300025919 Bacteria 743
184 Ga0207649_10007168 3300025920 Bacteria 6060
185 Ga0207649_10502651 3300025920 Unclassified 922
186 Ga0207652_10005180 3300025921 Bacteria 10585
187 Ga0207652_10046125 3300025921 Bacteria 3717
188 Ga0207652_10108760 3300025921 Bacteria 2457
189 Ga0207652_10423250 3300025921 Bacteria 1201
190 Ga0207652_10426377 3300025921 Bacteria 1196
191 Ga0207652_10574950 3300025921 Unclassified 1012
192 Ga0207646_10592611 3300025922 Bacteria 995
193 Ga0207694_10347292 3300025924 Bacteria 1228
194 Ga0207650_10058229 3300025925 Unclassified 2876
195 Ga0207659_10010153 3300025926 Bacteria 5905
196 Ga0207687_10913408 3300025927 Bacteria 751
197 Ga0207700_10114721 3300025928 Bacteria 2174
198 Ga0207700_10123414 3300025928 Bacteria 2103
199 Ga0207700_10216741 3300025928 Bacteria 1621
200 Ga0207700_10966899 3300025928 Bacteria 762
201 Ga0207664_10630510 3300025929 Bacteria 963
202 Ga0207644_10054218 3300025931 Bacteria 2887
203 Ga0207644_11090686 3300025931 Bacteria 671
204 Ga0207690_10002601 3300025932 Bacteria 10886
205 Ga0207690_10549922 3300025932 Unclassified 938
206 Ga0207690_10906059 3300025932 Bacteria 731
207 Ga0207669_10084461 3300025937 Bacteria 2046
208 Ga0207704_11273173 3300025938 Unclassified 628
209 Ga0207691_10002077 3300025940 Bacteria 19544
210 Ga0207711_10049338 3300025941 Bacteria 3604
211 Ga0207689_10708216 3300025942 Bacteria 849
212 Ga0207661_10374710 3300025944 Bacteria 1287
213 Ga0207679_10007865 3300025945 Bacteria 6774
214 Ga0207679_11581522 3300025945 Unclassified 601
215 Ga0207667_10214927 3300025949 Bacteria 1970
216 Ga0207667_10698930 3300025949 Bacteria 1017
217 Ga0207668_10091888 3300025972 Bacteria 2232
218 Ga0207668_11452375 3300025972 Unclassified 619
219 Ga0207640_10011092 3300025981 Bacteria 5092
220 Ga0207640_11875798 3300025981 Unclassified 542
221 Ga0207703_10102263 3300026035 Bacteria 2431
222 Ga0207639_10337152 3300026041 Bacteria 1343
223 Ga0207639_10441563 3300026041 Bacteria 1180
224 Ga0207639_10707525 3300026041 Unclassified 935
225 Ga0207678_10038206 3300026067 Bacteria 4172
226 Ga0207702_10104067 3300026078 Bacteria 2511
227 Ga0207702_10247488 3300026078 Bacteria 1673
228 Ga0207702_10470872 3300026078 Unclassified 1221
229 Ga0207641_10090128 3300026088 Bacteria 2681
230 Ga0207641_10579688 3300026088 Bacteria 1096
231 Ga0207648_10967684 3300026089 Bacteria 796
232 Ga0207676_10063085 3300026095 Bacteria 2942
233 Ga0207676_10720595 3300026095 Bacteria 968
234 Ga0207674_10001105 3300026116 Bacteria 35054
235 Ga0207674_10769581 3300026116 Bacteria 929
236 Ga0207675_100003327 3300026118 Bacteria 15736
237 Ga0207683_10247677 3300026121 Unclassified 1626
238 Ga0207683_10924187 3300026121 Bacteria 810
239 Ga0207698_12071973 3300026142 Unclassified 583
240 Ga0207698_12143014 3300026142 Unclassified 572
241 Ga0268266_11551106 3300028379 Bacteria 638
242 Ga0268265_10136316 3300028380 Unclassified 2048
243 Ga0268265_11519544 3300028380 Bacteria 673
244 Ga0268264_10031707 3300028381 Bacteria 4334
245 Ga0307509_10094852 3300031507 Bacteria 3041
246 Ga0307411_10322577 3300032005 Unclassified 1248
247 Ga0307507_10029253 3300033179 Bacteria 5847
248 Ga0373948_0206844 3300034817 Bacteria 514
249 Ga0373958_0048946 3300034819 Bacteria 888
250 Ga0373936_0051659 3300035113 Bacteria 1664
251 Ga0373941_0021701 3300035115 Unclassified 1816
252 Ga0373953_0070889 3300035117 Bacteria 1437
253 Ga0373954_0634761 3300035118 Bacteria 529
254 Ga0373957_0054954 3300035120 Bacteria 1530
255 Ga0373960_0240631 3300035121 Unclassified 654
256 Ga0373955_0471995 3300035172 Unclassified 765
257 Ga0373931_0205742 3300035691 Bacteria 1178
258 Ga0373927_0524517 3300035695 Unclassified 783
259 Ga0373927_0591656 3300035695 Bacteria 733
260 Ga0373933_0221341 3300035724 Bacteria 1214
261 Ga0373937_0570766 3300036401 Bacteria 1074
262 Ga0373925_0404970 3300037068 Bacteria 1113
263 Ga0451791_0435390 3300041451 Bacteria 606
264 Ga0466965_0092710 3300044683 Bacteria 1538
265 Ga0466965_0283237 3300044683 Bacteria 896
266 Ga0466966_0256098 3300044684 Bacteria 1054
267 Ga0466961_0044304 3300044693 Bacteria 2847
268 Ga0466963_0023612 3300044694 Bacteria 3908
269 Ga0466963_0156833 3300044694 Bacteria 1583
270 Ga0466963_0215084 3300044694 Bacteria 1345
271 Ga0466963_0524423 3300044694 Bacteria 836
272 Ga0466971_0027468 3300044719 Bacteria 2550
273 Ga0466970_0107112 3300044765 Bacteria 1525
274 Ga0466957_0378990 3300044842 Bacteria 964
275 Ga0466960_0682969 3300044901 Bacteria 615
276 Ga0466959_0131638 3300045049 Bacteria 1772
277 Ga0451576_0126907 3300045051 Bacteria 2658
278 Ga0466958_0001930 3300045836 Bacteria 10160
279 Ga0466958_0083621 3300045836 Bacteria 1967
280 Ga0466967_0054255 3300045976 Bacteria 3526
281 Ga0466967_0084136 3300045976 Bacteria 2878
282 Ga0466967_0456072 3300045976 Bacteria 1250
283 Ga0495592_0011582 3300046454 Bacteria 6678
284 Ga0495603_0522452 3300046455 Bacteria 680
285 Ga0495629_0058023 3300046459 Bacteria 2706
286 Ga0495629_0094848 3300046459 Bacteria 2082
287 Ga0495638_0012956 3300046460 Bacteria 5693
288 Ga0495641_0534605 3300046461 Bacteria 535
289 Ga0495651_0002869 3300046462 Bacteria 13353
290 Ga0495653_0050613 3300046463 Bacteria 3194
291 Ga0495662_0032122 3300046476 Bacteria 2536
292 Ga0495662_0451848 3300046476 Bacteria 630
293 Ga0495664_0110842 3300046477 Bacteria 1656
294 Ga0495608_0077381 3300046511 Bacteria 2165
295 Ga0495618_0013624 3300046514 Bacteria 4948
296 Ga0495620_0000060 3300046515 Bacteria 95642
297 Ga0495628_0043289 3300046516 Bacteria 3587
298 Ga0495652_0054089 3300046529 Bacteria 3419
299 Ga0495665_0141233 3300046531 Bacteria 1259
300 Ga0495665_0664002 3300046531 Unclassified 518
301 Ga0495640_0092406 3300046533 Bacteria 1995
302 Ga0495586_0202568 3300046535 Bacteria 1125
303 Ga0495587_0029292 3300046536 Bacteria 3342
304 Ga0495645_0024293 3300046543 Bacteria 4396
305 Ga0495645_0659425 3300046543 Bacteria 638
306 Ga0495667_0012241 3300046559 Bacteria 5813
307 Ga0495634_0108540 3300046642 Bacteria 1786
308 Ga0495635_0026312 3300046663 Bacteria 4049
309 Ga0495657_0044122 3300046675 Bacteria 3035
310 Ga0495599_0023916 3300046678 Bacteria 3820
311 Ga0495646_0224092 3300046680 Bacteria 1015
312 Ga0495624_0068541 3300046690 Bacteria 2211
313 Ga0495604_0005531 3300047317 Bacteria 10017
314 Ga0495604_0618009 3300047317 Bacteria 693
315 Ga0495674_0022122 3300047319 Bacteria 5867
316 Ga0495676_0887637 3300047321 Bacteria 571
317 Ga0495676_1041661 3300047321 Bacteria 521
318 Ga0495680_0032368 3300047322 Bacteria 4246
319 Ga0495675_0064276 3300047444 Bacteria 2321
320 Ga0495684_0015078 3300047471 Bacteria 5952
321 Ga0495602_0018767 3300048088 Bacteria 6893
322 Ga0496100_0357858 3300048903 Bacteria 1104
323 Ga0496100_0482663 3300048903 Unclassified 953
324 Ga0496101_0170100 3300048904 Bacteria 1675
325 Ga0496101_0440657 3300048904 Unclassified 1028
326 Ga0496102_0052747 3300048905 Bacteria 3707
327 Ga0496102_0149195 3300048905 Bacteria 2196
328 Ga0496104_0234974 3300048907 Bacteria 1745
329 Ga0496105_0024910 3300048908 Bacteria 4864
330 Ga0496106_0086583 3300048909 Bacteria 2413
331 Ga0496106_0188787 3300048909 Unclassified 1638
332 Ga0496107_0236958 3300048910 Unclassified 1358
333 Ga0496107_0856605 3300048910 Bacteria 664
334 Ga0496108_0000002 3300048911 Bacteria 700890
335 Ga0496108_0049132 3300048911 Bacteria 3528
336 Ga0496108_0099804 3300048911 Bacteria 2475
337 Ga0496108_0111610 3300048911 Bacteria 2339
338 Ga0496109_0000001 3300048912 Bacteria 700852
339 Ga0496109_0010556 3300048912 Bacteria 7897
340 Ga0496109_0083729 3300048912 Unclassified 2941
341 Ga0496109_0089342 3300048912 Bacteria 2848
342 Ga0496109_0491792 3300048912 Bacteria 1158
343 Ga0496110_0044836 3300048913 Unclassified 3862
344 Ga0496111_0082515 3300048914 Bacteria 2348
345 Ga0496111_0241372 3300048914 Bacteria 1342
346 Ga0496111_0388790 3300048914 Unclassified 1031
347 Ga0496112_0061758 3300048915 Bacteria 3695
348 Ga0496112_0182624 3300048915 Unclassified 2061
349 Ga0496112_0514878 3300048915 Unclassified 1131
350 Ga0496113_0269106 3300048916 Bacteria 1362
351 Ga0496113_0274105 3300048916 Bacteria 1349
352 Ga0496113_0643013 3300048916 Unclassified 848
353 Ga0496114_0202044 3300048917 Bacteria 1741
354 Ga0496114_1096959 3300048917 Unclassified 681
355 Ga0496116_0364421 3300048919 Unclassified 655
356 Ga0496118_0207827 3300048921 Bacteria 1152
357 Ga0496125_0043688 3300048928 Unclassified 3799
358 Ga0501033_0832461 3300049570 Bacteria 623
359 Ga0501034_1192782 3300049571 Bacteria 640
360 Ga0501038_0305188 3300049574 Bacteria 1248
361 Ga0501039_0178295 3300049575 Bacteria 1671
362 Ga0501040_0074762 3300049576 Bacteria 2342
363 Ga0501042_0219303 3300049578 Bacteria 1372
364 Ga0501046_0100289 3300049580 Bacteria 2222
365 Ga0501046_0689949 3300049580 Bacteria 720
366 Ga0501047_0178860 3300049581 Bacteria 1988
367 Ga0501048_0185824 3300049582 Bacteria 1473
368 Ga0501048_1372243 3300049582 Bacteria 508
369 Ga0501068_0136583 3300049584 Unclassified 1535
370 Ga0501068_0142842 3300049584 Bacteria 1501
371 Ga0501069_0201288 3300049585 Bacteria 1154
372 Ga0501070_1269507 3300049586 Bacteria 563
373 Ga0501071_0271223 3300049587 Bacteria 1283
374 Ga0501072_0008667 3300049588 Bacteria 7720
375 Ga0501075_0017204 3300049591 Bacteria 5220
376 Ga0501075_0052538 3300049591 Bacteria 3064
377 Ga0501076_0047475 3300049592 Bacteria 3395
378 Ga0501076_0365720 3300049592 Bacteria 1185
379 Ga0501077_0112975 3300049593 Bacteria 1722
380 Ga0501079_0020288 3300049741 Bacteria 5079
381 Ga0501079_0507857 3300049741 Bacteria 948
382 Ga0501080_0779022 3300049742 Bacteria 840
383 Ga0501081_0211033 3300049743 Bacteria 1410
384 Ga0501044_0077655 3300049823 Bacteria 3367
385 Ga0501045_0385019 3300049824 Unclassified 1044
386 nmdc:mga0yw44_1061464_c1 3300050492 Unclassified 548
387 nmdc:mga05p37_117692_c1 3300050507 Bacteria 3265
388 nmdc:mga05p37_327721_c1 3300050507 Bacteria 1810
389 nmdc:mga09592_138495_c1 3300050508 Bacteria 2097
390 nmdc:mga09592_277648_c1 3300050508 Unclassified 1453
391 nmdc:mga0qj67_107742_c1 3300050509 Bacteria 2248
392 nmdc:mga0qj67_13702_c1 3300050509 Bacteria 6120
393 nmdc:mga0qj67_43147_c1 3300050509 Bacteria 3552
394 nmdc:mga0qj67_496852_c1 3300050509 Bacteria 981
395 nmdc:mga0qj67_586071_c1 3300050509 Bacteria 893
396 nmdc:mga0qj67_74579_c1 3300050509 Bacteria 2711
397 nmdc:mga06r32_350475_c1 3300050510 Bacteria 1461
398 nmdc:mga06r32_512718_c1 3300050510 Bacteria 1175
399 nmdc:mga08y16_309181_c1 3300050511 Bacteria 1628
400 nmdc:mga08y16_646293_c1 3300050511 Bacteria 1062
401 nmdc:mga0n895_19427_c1 3300050512 Bacteria 6316
402 nmdc:mga0n895_2252530_c1 3300050512 Unclassified 500
403 nmdc:mga0rr50_16263_c1 3300050513 Bacteria 4935
404 nmdc:mga0rr50_459006_c1 3300050513 Bacteria 1080
405 nmdc:mga0rr50_985683_c1 3300050513 Unclassified 718
406 nmdc:mga08x19_110105_c1 3300050514 Bacteria 1836
407 nmdc:mga0a205_430993_c1 3300050515 Bacteria 1180
408 nmdc:mga0a205_48978_c1 3300050515 Bacteria 4078
409 Ga0495601_0027620 3300053077 Bacteria 3509
410 Ga0495655_0023323 3300053083 Bacteria 1426
411 Ga0500592_015929 3300053116 Bacteria 1207
412 Ga0501084_0228032 3300054114 Bacteria 1572
413 Ga0501084_0273820 3300054114 Bacteria 1425
414 Ga0501084_1669745 3300054114 Unclassified 532
415 Ga0501082_0035739 3300060353 Bacteria 4282
416 Ga0501082_0564585 3300060353 Unclassified 996
417 Ga0466962_0035081 3300061719 Bacteria 2401
418 Ga0530510_0172406 3300061734 Bacteria 1603

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_10010153 Ga0207659_100101535 116
2 3300005614 Ga0068856_100396961 Ga0068856_1003969613 122
3 3300026078 Ga0207702_10247488 Ga0207702_102474882 122
4 3300005578 Ga0068854_100010504 Ga0068854_1000105045 125
5 3300025981 Ga0207640_10011092 Ga0207640_100110927 125
6 3300044901 Ga0466960_0682969 Ga0466960_0682969_33_422 125
7 3300044694 Ga0466963_0524423 Ga0466963_0524423_338_727 128
8 3300046515 Ga0495620_0000060 Ga0495620_0000060_61064_61456 128
9 3300048911 Ga0496108_0000002 Ga0496108_0000002_494249_494656 128
10 3300048912 Ga0496109_0000001 Ga0496109_0000001_494211_494618 128
11 3300048928 Ga0496125_0043688 Ga0496125_0043688_274_681 128
12 3300025898 Ga0207692_10299337 Ga0207692_102993371 130
13 3300005434 Ga0070709_10761800 Ga0070709_107618001 131
14 3300025928 Ga0207700_10114721 Ga0207700_101147211 132
15 3300044683 Ga0466965_0092710 Ga0466965_0092710_513_917 132
16 iso_pu_bacteria 2551306166 2552112202 132
17 iso_pu_bacteria 2751185782 2753270504 132
18 3300028379 Ga0268266_11551106 Ga0268266_115511061 133
19 3300044683 Ga0466965_0283237 Ga0466965_0283237_114_524 133
20 3300044684 Ga0466966_0256098 Ga0466966_0256098_331_741 133
21 3300044694 Ga0466963_0023612 Ga0466963_0023612_1512_1922 133
22 3300044694 Ga0466963_0156833 Ga0466963_0156833_1016_1417 133
23 3300044765 Ga0466970_0107112 Ga0466970_0107112_981_1391 133
24 3300044842 Ga0466957_0378990 Ga0466957_0378990_38_448 133
25 3300045049 Ga0466959_0131638 Ga0466959_0131638_81_491 133
26 3300045836 Ga0466958_0001930 Ga0466958_0001930_4609_5019 133
27 3300045976 Ga0466967_0084136 Ga0466967_0084136_1758_2168 133
28 3300005329 Ga0070683_100225307 Ga0070683_1002253072 134
29 3300005334 Ga0068869_100398650 Ga0068869_1003986502 134
30 3300005338 Ga0068868_100187949 Ga0068868_1001879492 134
31 3300005338 Ga0068868_100692395 Ga0068868_1006923951 134
32 3300005339 Ga0070660_100990432 Ga0070660_1009904321 134
33 3300005341 Ga0070691_10015127 Ga0070691_100151273 134
34 3300005347 Ga0070668_100643144 Ga0070668_1006431442 134
35 3300005355 Ga0070671_100388555 Ga0070671_1003885552 134
36 3300005355 Ga0070671_101790446 Ga0070671_1017904461 134
37 3300005367 Ga0070667_100078769 Ga0070667_1000787692 134
38 3300005435 Ga0070714_100219837 Ga0070714_1002198372 134
39 3300005435 Ga0070714_100711633 Ga0070714_1007116332 134
40 3300005436 Ga0070713_100724674 Ga0070713_1007246742 134
41 3300005436 Ga0070713_100741349 Ga0070713_1007413492 134
42 3300005436 Ga0070713_100754018 Ga0070713_1007540182 134
43 3300005437 Ga0070710_10045055 Ga0070710_100450554 134
44 3300005437 Ga0070710_10547403 Ga0070710_105474031 134
45 3300005439 Ga0070711_100044736 Ga0070711_1000447362 134
46 3300005439 Ga0070711_100205494 Ga0070711_1002054942 134
47 3300005439 Ga0070711_100411852 Ga0070711_1004118522 134
48 3300005445 Ga0070708_101676624 Ga0070708_1016766241 134
49 3300005468 Ga0070707_100298037 Ga0070707_1002980372 134
50 3300005535 Ga0070684_100121500 Ga0070684_1001215002 134
51 3300005539 Ga0068853_100663404 Ga0068853_1006634042 134
52 3300005544 Ga0070686_101540584 Ga0070686_1015405841 134
53 3300005548 Ga0070665_100354437 Ga0070665_1003544372 134
54 3300005577 Ga0068857_100503324 Ga0068857_1005033242 134
55 3300005614 Ga0068856_100058409 Ga0068856_1000584092 134
56 3300005614 Ga0068856_100185941 Ga0068856_1001859412 134
57 3300005617 Ga0068859_100169217 Ga0068859_1001692171 134
58 3300005617 Ga0068859_100272974 Ga0068859_1002729742 134
59 3300005618 Ga0068864_100153671 Ga0068864_1001536712 134
60 3300005841 Ga0068863_100039103 Ga0068863_1000391035 134
61 3300005841 Ga0068863_100117560 Ga0068863_1001175601 134
62 3300005842 Ga0068858_100016978 Ga0068858_1000169785 134
63 3300005842 Ga0068858_100129338 Ga0068858_1001293383 134
64 3300005843 Ga0068860_100022068 Ga0068860_1000220687 134
65 3300005844 Ga0068862_100167043 Ga0068862_1001670433 134
66 3300006163 Ga0070715_10775251 Ga0070715_107752511 134
67 3300006173 Ga0070716_100030576 Ga0070716_1000305763 134
68 3300006175 Ga0070712_100442798 Ga0070712_1004427982 134
69 3300006195 Ga0075366_10014267 Ga0075366_100142673 134
70 3300006237 Ga0097621_101949228 Ga0097621_1019492282 134
71 3300006358 Ga0068871_100035193 Ga0068871_1000351933 134
72 3300006871 Ga0075434_100201377 Ga0075434_1002013772 134
73 3300006931 Ga0097620_100169218 Ga0097620_1001692181 134
74 3300006931 Ga0097620_100272977 Ga0097620_1002729772 134
75 3300009098 Ga0105245_10249870 Ga0105245_102498703 134
76 3300009098 Ga0105245_11156563 Ga0105245_111565632 134
77 3300009098 Ga0105245_11424234 Ga0105245_114242341 134
78 3300009101 Ga0105247_10120349 Ga0105247_101203492 134
79 3300009553 Ga0105249_12457515 Ga0105249_124575151 134
80 3300013105 Ga0157369_10076080 Ga0157369_100760802 134
81 3300013105 Ga0157369_10776140 Ga0157369_107761402 134
82 3300013296 Ga0157374_10144195 Ga0157374_101441952 134
83 3300013297 Ga0157378_10932424 Ga0157378_109324242 134
84 3300013307 Ga0157372_10727152 Ga0157372_107271522 134
85 3300013307 Ga0157372_12015031 Ga0157372_120150312 134
86 3300013308 Ga0157375_10122051 Ga0157375_101220513 134
87 3300013308 Ga0157375_11938197 Ga0157375_119381971 134
88 3300014325 Ga0163163_10044741 Ga0163163_100447415 134
89 3300014325 Ga0163163_10893804 Ga0163163_108938042 134
90 3300014325 Ga0163163_11436036 Ga0163163_114360362 134
91 3300014326 Ga0157380_10260827 Ga0157380_102608272 134
92 3300014745 Ga0157377_10768294 Ga0157377_107682941 134
93 3300014968 Ga0157379_10377709 Ga0157379_103777092 134
94 3300014969 Ga0157376_10019738 Ga0157376_100197385 134
95 3300025898 Ga0207692_10571778 Ga0207692_105717781 134
96 3300025898 Ga0207692_10690115 Ga0207692_106901151 134
97 3300025900 Ga0207710_10061999 Ga0207710_100619992 134
98 3300025905 Ga0207685_10061212 Ga0207685_100612122 134
99 3300025906 Ga0207699_10093293 Ga0207699_100932932 134
100 3300025910 Ga0207684_10983868 Ga0207684_109838682 134
101 3300025915 Ga0207693_10850994 Ga0207693_108509941 134
102 3300025915 Ga0207693_11272936 Ga0207693_112729361 134
103 3300025916 Ga0207663_10345681 Ga0207663_103456812 134
104 3300025916 Ga0207663_11551416 Ga0207663_115514161 134
105 3300025919 Ga0207657_10773782 Ga0207657_107737822 134
106 3300025921 Ga0207652_10423250 Ga0207652_104232502 134
107 3300025922 Ga0207646_10592611 Ga0207646_105926112 134
108 3300025927 Ga0207687_10913408 Ga0207687_109134081 134
109 3300025928 Ga0207700_10123414 Ga0207700_101234142 134
110 3300025928 Ga0207700_10966899 Ga0207700_109668992 134
111 3300025929 Ga0207664_10630510 Ga0207664_106305102 134
112 3300025931 Ga0207644_11090686 Ga0207644_110906862 134
113 3300025932 Ga0207690_10549922 Ga0207690_105499222 134
114 3300025942 Ga0207689_10708216 Ga0207689_107082162 134
115 3300025945 Ga0207679_11581522 Ga0207679_115815221 134
116 3300025949 Ga0207667_10214927 Ga0207667_102149272 134
117 3300025972 Ga0207668_10091888 Ga0207668_100918882 134
118 3300026035 Ga0207703_10102263 Ga0207703_101022632 134
119 3300026041 Ga0207639_10337152 Ga0207639_103371522 134
120 3300026041 Ga0207639_10441563 Ga0207639_104415632 134
121 3300026078 Ga0207702_10104067 Ga0207702_101040673 134
122 3300026088 Ga0207641_10090128 Ga0207641_100901284 134
123 3300026088 Ga0207641_10579688 Ga0207641_105796882 134
124 3300026095 Ga0207676_10063085 Ga0207676_100630853 134
125 3300026095 Ga0207676_10720595 Ga0207676_107205951 134
126 3300026116 Ga0207674_10769581 Ga0207674_107695812 134
127 3300026142 Ga0207698_12071973 Ga0207698_120719731 134
128 3300028380 Ga0268265_11519544 Ga0268265_115195441 134
129 3300028381 Ga0268264_10031707 Ga0268264_100317075 134
130 3300031507 Ga0307509_10094852 Ga0307509_100948523 134
131 3300033179 Ga0307507_10029253 Ga0307507_100292535 134
132 3300035113 Ga0373936_0051659 Ga0373936_0051659_191_598 134
133 3300035117 Ga0373953_0070889 Ga0373953_0070889_288_695 134
134 3300035118 Ga0373954_0634761 Ga0373954_0634761_52_471 134
135 3300035120 Ga0373957_0054954 Ga0373957_0054954_704_1123 134
136 3300035172 Ga0373955_0471995 Ga0373955_0471995_212_631 134
137 3300035695 Ga0373927_0524517 Ga0373927_0524517_18_425 134
138 3300035695 Ga0373927_0591656 Ga0373927_0591656_227_706 134
139 3300035724 Ga0373933_0221341 Ga0373933_0221341_409_816 134
140 3300036401 Ga0373937_0570766 Ga0373937_0570766_651_1058 134
141 3300044693 Ga0466961_0044304 Ga0466961_0044304_1249_1659 134
142 3300044694 Ga0466963_0215084 Ga0466963_0215084_139_549 134
143 3300044719 Ga0466971_0027468 Ga0466971_0027468_805_1215 134
144 3300045836 Ga0466958_0083621 Ga0466958_0083621_1316_1726 134
145 3300045976 Ga0466967_0054255 Ga0466967_0054255_715_1125 134
146 3300045976 Ga0466967_0456072 Ga0466967_0456072_42_452 134
147 3300046454 Ga0495592_0011582 Ga0495592_0011582_1703_2122 134
148 3300046455 Ga0495603_0522452 Ga0495603_0522452_221_628 134
149 3300046459 Ga0495629_0094848 Ga0495629_0094848_717_1124 134
150 3300046461 Ga0495641_0534605 Ga0495641_0534605_106_525 134
151 3300046462 Ga0495651_0002869 Ga0495651_0002869_5903_6322 134
152 3300046463 Ga0495653_0050613 Ga0495653_0050613_777_1196 134
153 3300046476 Ga0495662_0032122 Ga0495662_0032122_2011_2430 134
154 3300046476 Ga0495662_0451848 Ga0495662_0451848_105_524 134
155 3300046477 Ga0495664_0110842 Ga0495664_0110842_1099_1518 134
156 3300046511 Ga0495608_0077381 Ga0495608_0077381_1309_1728 134
157 3300046514 Ga0495618_0013624 Ga0495618_0013624_3798_4217 134
158 3300046516 Ga0495628_0043289 Ga0495628_0043289_2343_2762 134
159 3300046529 Ga0495652_0054089 Ga0495652_0054089_438_857 134
160 3300046531 Ga0495665_0141233 Ga0495665_0141233_662_1069 134
161 3300046533 Ga0495640_0092406 Ga0495640_0092406_1394_1813 134
162 3300046535 Ga0495586_0202568 Ga0495586_0202568_468_887 134
163 3300046536 Ga0495587_0029292 Ga0495587_0029292_1405_1824 134
164 3300046543 Ga0495645_0024293 Ga0495645_0024293_1413_1832 134
165 3300046543 Ga0495645_0659425 Ga0495645_0659425_150_569 134
166 3300046559 Ga0495667_0012241 Ga0495667_0012241_4756_5175 134
167 3300046642 Ga0495634_0108540 Ga0495634_0108540_490_909 134
168 3300046663 Ga0495635_0026312 Ga0495635_0026312_1511_1918 134
169 3300046675 Ga0495657_0044122 Ga0495657_0044122_661_1068 134
170 3300046678 Ga0495599_0023916 Ga0495599_0023916_561_980 134
171 3300046680 Ga0495646_0224092 Ga0495646_0224092_403_822 134
172 3300046690 Ga0495624_0068541 Ga0495624_0068541_1089_1508 134
173 3300047317 Ga0495604_0005531 Ga0495604_0005531_68_487 134
174 3300047317 Ga0495604_0618009 Ga0495604_0618009_15_422 134
175 3300047319 Ga0495674_0022122 Ga0495674_0022122_179_598 134
176 3300047321 Ga0495676_0887637 Ga0495676_0887637_79_498 134
177 3300047321 Ga0495676_1041661 Ga0495676_1041661_27_506 134
178 3300047322 Ga0495680_0032368 Ga0495680_0032368_646_1065 134
179 3300047444 Ga0495675_0064276 Ga0495675_0064276_1660_2079 134
180 3300047471 Ga0495684_0015078 Ga0495684_0015078_2564_2983 134
181 3300048088 Ga0495602_0018767 Ga0495602_0018767_1587_2006 134
182 3300048905 Ga0496102_0149195 Ga0496102_0149195_1429_1848 134
183 3300048908 Ga0496105_0024910 Ga0496105_0024910_2921_3340 134
184 3300048910 Ga0496107_0856605 Ga0496107_0856605_232_651 134
185 3300048911 Ga0496108_0049132 Ga0496108_0049132_2455_2874 134
186 3300048912 Ga0496109_0010556 Ga0496109_0010556_2732_3151 134
187 3300048912 Ga0496109_0491792 Ga0496109_0491792_713_1129 134
188 3300048914 Ga0496111_0082515 Ga0496111_0082515_388_807 134
189 3300048914 Ga0496111_0241372 Ga0496111_0241372_873_1289 134
190 3300048915 Ga0496112_0061758 Ga0496112_0061758_1492_1911 134
191 3300048916 Ga0496113_0269106 Ga0496113_0269106_393_812 134
192 3300048917 Ga0496114_1096959 Ga0496114_1096959_67_483 134
193 3300049570 Ga0501033_0832461 Ga0501033_0832461_24_455 134
194 3300049571 Ga0501034_1192782 Ga0501034_1192782_39_455 134
195 3300049574 Ga0501038_0305188 Ga0501038_0305188_136_591 134
196 3300049575 Ga0501039_0178295 Ga0501039_0178295_1024_1479 134
197 3300049578 Ga0501042_0219303 Ga0501042_0219303_124_579 134
198 3300049580 Ga0501046_0689949 Ga0501046_0689949_253_708 134
199 3300049581 Ga0501047_0178860 Ga0501047_0178860_732_1163 134
200 3300049582 Ga0501048_0185824 Ga0501048_0185824_675_1130 134
201 3300049582 Ga0501048_1372243 Ga0501048_1372243_35_496 134
202 3300049584 Ga0501068_0142842 Ga0501068_0142842_1064_1480 134
203 3300049586 Ga0501070_1269507 Ga0501070_1269507_52_507 134
204 3300049587 Ga0501071_0271223 Ga0501071_0271223_303_728 134
205 3300049588 Ga0501072_0008667 Ga0501072_0008667_231_656 134
206 3300049591 Ga0501075_0052538 Ga0501075_0052538_1167_1622 134
207 3300049592 Ga0501076_0365720 Ga0501076_0365720_73_528 134
208 3300049743 Ga0501081_0211033 Ga0501081_0211033_877_1332 134
209 3300049823 Ga0501044_0077655 Ga0501044_0077655_2560_2991 134
210 3300050513 nmdc:mga0rr50_459006_c1 nmdc:mga0rr50_459006_c1_390_797 134
211 3300053077 Ga0495601_0027620 Ga0495601_0027620_642_1061 134
212 3300053083 Ga0495655_0023323 Ga0495655_0023323_653_1063 134
213 3300060353 Ga0501082_0035739 Ga0501082_0035739_3750_4205 134
214 3300061719 Ga0466962_0035081 Ga0466962_0035081_690_1100 134
215 3300061734 Ga0530510_0172406 Ga0530510_0172406_217_672 134
216 3300003316 rootH1_10001257 rootH1_100012574 135
217 3300003322 rootL2_10035585 rootL2_100355856 135
218 3300003323 rootH1_10380731 rootH1_103807313 135
219 3300004803 Ga0058862_11966842 Ga0058862_119668422 135
220 3300005329 Ga0070683_100109993 Ga0070683_1001099934 135
221 3300005331 Ga0070670_100095555 Ga0070670_1000955552 135
222 3300005333 Ga0070677_10172794 Ga0070677_101727942 135
223 3300005335 Ga0070666_10351567 Ga0070666_103515672 135
224 3300005336 Ga0070680_100009914 Ga0070680_1000099143 135
225 3300005337 Ga0070682_100129709 Ga0070682_1001297092 135
226 3300005338 Ga0068868_101034290 Ga0068868_1010342901 135
227 3300005340 Ga0070689_100015623 Ga0070689_1000156235 135
228 3300005343 Ga0070687_100022735 Ga0070687_1000227355 135
229 3300005344 Ga0070661_100152800 Ga0070661_1001528002 135
230 3300005344 Ga0070661_100450017 Ga0070661_1004500172 135
231 3300005355 Ga0070671_100037794 Ga0070671_1000377945 135
232 3300005355 Ga0070671_100301415 Ga0070671_1003014152 135
233 3300005356 Ga0070674_100033394 Ga0070674_1000333942 135
234 3300005366 Ga0070659_100009099 Ga0070659_1000090998 135
235 3300005436 Ga0070713_100424828 Ga0070713_1004248282 135
236 3300005439 Ga0070711_100005421 Ga0070711_1000054215 135
237 3300005441 Ga0070700_100034292 Ga0070700_1000342922 135
238 3300005455 Ga0070663_100237188 Ga0070663_1002371882 135
239 3300005456 Ga0070678_100183667 Ga0070678_1001836672 135
240 3300005456 Ga0070678_101062017 Ga0070678_1010620171 135
241 3300005457 Ga0070662_100041686 Ga0070662_1000416865 135
242 3300005458 Ga0070681_10005299 Ga0070681_1000529915 135
243 3300005458 Ga0070681_10016679 Ga0070681_100166797 135
244 3300005458 Ga0070681_10024157 Ga0070681_100241575 135
245 3300005458 Ga0070681_10028575 Ga0070681_100285756 135
246 3300005459 Ga0068867_100659272 Ga0068867_1006592722 135
247 3300005530 Ga0070679_100003106 Ga0070679_1000031062 135
248 3300005530 Ga0070679_100010037 Ga0070679_1000100376 135
249 3300005530 Ga0070679_100031042 Ga0070679_1000310423 135
250 3300005530 Ga0070679_100179267 Ga0070679_1001792672 135
251 3300005530 Ga0070679_100732545 Ga0070679_1007325452 135
252 3300005535 Ga0070684_100045671 Ga0070684_1000456714 135
253 3300005535 Ga0070684_100360659 Ga0070684_1003606592 135
254 3300005539 Ga0068853_100908282 Ga0068853_1009082822 135
255 3300005563 Ga0068855_100882592 Ga0068855_1008825922 135
256 3300005564 Ga0070664_100686168 Ga0070664_1006861682 135
257 3300005577 Ga0068857_100010501 Ga0068857_1000105015 135
258 3300005578 Ga0068854_100124568 Ga0068854_1001245682 135
259 3300005618 Ga0068864_100078974 Ga0068864_1000789742 135
260 3300005843 Ga0068860_100478895 Ga0068860_1004788951 135
261 3300005844 Ga0068862_100146485 Ga0068862_1001464852 135
262 3300006175 Ga0070712_100170180 Ga0070712_1001701801 135
263 3300006178 Ga0075367_10843740 Ga0075367_108437401 135
264 3300006195 Ga0075366_10225293 Ga0075366_102252931 135
265 3300006237 Ga0097621_101045333 Ga0097621_1010453332 135
266 3300006844 Ga0075428_100004140 Ga0075428_1000041407 135
267 3300006844 Ga0075428_100016361 Ga0075428_1000163619 135
268 3300006844 Ga0075428_100028092 Ga0075428_1000280923 135
269 3300006844 Ga0075428_101543359 Ga0075428_1015433592 135
270 3300006846 Ga0075430_100019614 Ga0075430_1000196144 135
271 3300006846 Ga0075430_100130826 Ga0075430_1001308262 135
272 3300006846 Ga0075430_100148993 Ga0075430_1001489933 135
273 3300006846 Ga0075430_100294198 Ga0075430_1002941982 135
274 3300006846 Ga0075430_100334950 Ga0075430_1003349502 135
275 3300006846 Ga0075430_101371887 Ga0075430_1013718871 135
276 3300006847 Ga0075431_100023675 Ga0075431_1000236755 135
277 3300006847 Ga0075431_100231433 Ga0075431_1002314333 135
278 3300006847 Ga0075431_100280514 Ga0075431_1002805143 135
279 3300006852 Ga0075433_10432183 Ga0075433_104321832 135
280 3300006852 Ga0075433_10909464 Ga0075433_109094641 135
281 3300006871 Ga0075434_100006343 Ga0075434_1000063439 135
282 3300006871 Ga0075434_100008947 Ga0075434_1000089471 135
283 3300006871 Ga0075434_100495852 Ga0075434_1004958522 135
284 3300006880 Ga0075429_100065274 Ga0075429_1000652744 135
285 3300006880 Ga0075429_100471418 Ga0075429_1004714181 135
286 3300006914 Ga0075436_100041121 Ga0075436_1000411213 135
287 3300007076 Ga0075435_100007211 Ga0075435_1000072111 135
288 3300007076 Ga0075435_100474329 Ga0075435_1004743292 135
289 3300009094 Ga0111539_10115886 Ga0111539_101158863 135
290 3300009094 Ga0111539_10253257 Ga0111539_102532572 135
291 3300009147 Ga0114129_10024381 Ga0114129_100243813 135
292 3300009147 Ga0114129_10054079 Ga0114129_100540795 135
293 3300009147 Ga0114129_10774911 Ga0114129_107749111 135
294 3300009177 Ga0105248_10024686 Ga0105248_100246865 135
295 3300009177 Ga0105248_10478922 Ga0105248_104789222 135
296 3300009545 Ga0105237_10732971 Ga0105237_107329712 135
297 3300009551 Ga0105238_10502464 Ga0105238_105024642 135
298 3300011119 Ga0105246_10278291 Ga0105246_102782912 135
299 3300013100 Ga0157373_10259841 Ga0157373_102598412 135
300 3300013105 Ga0157369_10022113 Ga0157369_100221135 135
301 3300013297 Ga0157378_10530712 Ga0157378_105307122 135
302 3300013307 Ga0157372_11701787 Ga0157372_117017872 135
303 3300013308 Ga0157375_11260783 Ga0157375_112607832 135
304 3300014325 Ga0163163_10014609 Ga0163163_100146092 135
305 3300014326 Ga0157380_10201351 Ga0157380_102013512 135
306 3300015265 Ga0182005_1027799 Ga0182005_10277992 135
307 3300025903 Ga0207680_10171419 Ga0207680_101714191 135
308 3300025912 Ga0207707_10019304 Ga0207707_100193045 135
309 3300025912 Ga0207707_10025936 Ga0207707_100259362 135
310 3300025912 Ga0207707_10030972 Ga0207707_100309724 135
311 3300025912 Ga0207707_10059964 Ga0207707_100599641 135
312 3300025915 Ga0207693_11267274 Ga0207693_112672741 135
313 3300025916 Ga0207663_10003317 Ga0207663_100033176 135
314 3300025917 Ga0207660_10028143 Ga0207660_100281435 135
315 3300025917 Ga0207660_10090602 Ga0207660_100906023 135
316 3300025919 Ga0207657_10037512 Ga0207657_100375122 135
317 3300025920 Ga0207649_10007168 Ga0207649_100071688 135
318 3300025920 Ga0207649_10502651 Ga0207649_105026512 135
319 3300025921 Ga0207652_10005180 Ga0207652_1000518018 135
320 3300025921 Ga0207652_10046125 Ga0207652_100461256 135
321 3300025921 Ga0207652_10108760 Ga0207652_101087602 135
322 3300025921 Ga0207652_10426377 Ga0207652_104263772 135
323 3300025921 Ga0207652_10574950 Ga0207652_105749502 135
324 3300025924 Ga0207694_10347292 Ga0207694_103472921 135
325 3300025925 Ga0207650_10058229 Ga0207650_100582292 135
326 3300025928 Ga0207700_10216741 Ga0207700_102167413 135
327 3300025931 Ga0207644_10054218 Ga0207644_100542185 135
328 3300025932 Ga0207690_10002601 Ga0207690_100026015 135
329 3300025932 Ga0207690_10906059 Ga0207690_109060591 135
330 3300025937 Ga0207669_10084461 Ga0207669_100844612 135
331 3300025938 Ga0207704_11273173 Ga0207704_112731731 135
332 3300025940 Ga0207691_10002077 Ga0207691_100020779 135
333 3300025941 Ga0207711_10049338 Ga0207711_100493381 135
334 3300025944 Ga0207661_10374710 Ga0207661_103747102 135
335 3300025945 Ga0207679_10007865 Ga0207679_100078657 135
336 3300025949 Ga0207667_10698930 Ga0207667_106989302 135
337 3300025972 Ga0207668_11452375 Ga0207668_114523752 135
338 3300025981 Ga0207640_11875798 Ga0207640_118757981 135
339 3300026041 Ga0207639_10707525 Ga0207639_107075252 135
340 3300026067 Ga0207678_10038206 Ga0207678_100382064 135
341 3300026078 Ga0207702_10470872 Ga0207702_104708722 135
342 3300026089 Ga0207648_10967684 Ga0207648_109676842 135
343 3300026116 Ga0207674_10001105 Ga0207674_1000110515 135
344 3300026118 Ga0207675_100003327 Ga0207675_10000332713 135
345 3300026121 Ga0207683_10247677 Ga0207683_102476772 135
346 3300026121 Ga0207683_10924187 Ga0207683_109241872 135
347 3300026142 Ga0207698_12143014 Ga0207698_121430141 135
348 3300028380 Ga0268265_10136316 Ga0268265_101363162 135
349 3300032005 Ga0307411_10322577 Ga0307411_103225772 135
350 3300034817 Ga0373948_0206844 Ga0373948_0206844_86_496 135
351 3300034819 Ga0373958_0048946 Ga0373958_0048946_109_528 135
352 3300035115 Ga0373941_0021701 Ga0373941_0021701_262_672 135
353 3300035121 Ga0373960_0240631 Ga0373960_0240631_215_625 135
354 3300035691 Ga0373931_0205742 Ga0373931_0205742_313_732 135
355 3300037068 Ga0373925_0404970 Ga0373925_0404970_76_486 135
356 3300041451 Ga0451791_0435390 Ga0451791_0435390_83_514 135
357 3300045051 Ga0451576_0126907 Ga0451576_0126907_1185_1595 135
358 3300046459 Ga0495629_0058023 Ga0495629_0058023_1620_2030 135
359 3300046460 Ga0495638_0012956 Ga0495638_0012956_4954_5373 135
360 3300046531 Ga0495665_0664002 Ga0495665_0664002_74_484 135
361 3300048903 Ga0496100_0357858 Ga0496100_0357858_155_568 135
362 3300048903 Ga0496100_0482663 Ga0496100_0482663_97_516 135
363 3300048904 Ga0496101_0170100 Ga0496101_0170100_764_1177 135
364 3300048904 Ga0496101_0440657 Ga0496101_0440657_415_834 135
365 3300048905 Ga0496102_0052747 Ga0496102_0052747_3140_3559 135
366 3300048907 Ga0496104_0234974 Ga0496104_0234974_427_840 135
367 3300048909 Ga0496106_0086583 Ga0496106_0086583_60_479 135
368 3300048909 Ga0496106_0188787 Ga0496106_0188787_696_1109 135
369 3300048910 Ga0496107_0236958 Ga0496107_0236958_813_1232 135
370 3300048911 Ga0496108_0099804 Ga0496108_0099804_1291_1704 135
371 3300048911 Ga0496108_0111610 Ga0496108_0111610_1598_2008 135
372 3300048912 Ga0496109_0083729 Ga0496109_0083729_299_712 135
373 3300048912 Ga0496109_0089342 Ga0496109_0089342_1266_1676 135
374 3300048913 Ga0496110_0044836 Ga0496110_0044836_2091_2504 135
375 3300048914 Ga0496111_0388790 Ga0496111_0388790_555_968 135
376 3300048915 Ga0496112_0182624 Ga0496112_0182624_288_701 135
377 3300048915 Ga0496112_0514878 Ga0496112_0514878_247_657 135
378 3300048916 Ga0496113_0274105 Ga0496113_0274105_897_1307 135
379 3300048916 Ga0496113_0643013 Ga0496113_0643013_77_490 135
380 3300048917 Ga0496114_0202044 Ga0496114_0202044_29_442 135
381 3300048919 Ga0496116_0364421 Ga0496116_0364421_28_441 135
382 3300048921 Ga0496118_0207827 Ga0496118_0207827_127_540 135
383 3300049576 Ga0501040_0074762 Ga0501040_0074762_860_1273 135
384 3300049580 Ga0501046_0100289 Ga0501046_0100289_435_848 135
385 3300049584 Ga0501068_0136583 Ga0501068_0136583_506_919 135
386 3300049585 Ga0501069_0201288 Ga0501069_0201288_491_904 135
387 3300049591 Ga0501075_0017204 Ga0501075_0017204_1239_1652 135
388 3300049592 Ga0501076_0047475 Ga0501076_0047475_1337_1750 135
389 3300049593 Ga0501077_0112975 Ga0501077_0112975_670_1083 135
390 3300049741 Ga0501079_0020288 Ga0501079_0020288_2409_2822 135
391 3300049741 Ga0501079_0507857 Ga0501079_0507857_119_532 135
392 3300049742 Ga0501080_0779022 Ga0501080_0779022_201_623 135
393 3300049824 Ga0501045_0385019 Ga0501045_0385019_161_574 135
394 3300050492 nmdc:mga0yw44_1061464_c1 nmdc:mga0yw44_1061464_c1_11_424 135
395 3300050507 nmdc:mga05p37_117692_c1 nmdc:mga05p37_117692_c1_1653_2063 135
396 3300050507 nmdc:mga05p37_327721_c1 nmdc:mga05p37_327721_c1_545_964 135
397 3300050508 nmdc:mga09592_138495_c1 nmdc:mga09592_138495_c1_1310_1720 135
398 3300050508 nmdc:mga09592_277648_c1 nmdc:mga09592_277648_c1_777_1196 135
399 3300050509 nmdc:mga0qj67_107742_c1 nmdc:mga0qj67_107742_c1_521_940 135
400 3300050509 nmdc:mga0qj67_13702_c1 nmdc:mga0qj67_13702_c1_3508_3921 135
401 3300050509 nmdc:mga0qj67_43147_c1 nmdc:mga0qj67_43147_c1_1616_2035 135
402 3300050509 nmdc:mga0qj67_496852_c1 nmdc:mga0qj67_496852_c1_369_782 135
403 3300050509 nmdc:mga0qj67_586071_c1 nmdc:mga0qj67_586071_c1_335_748 135
404 3300050509 nmdc:mga0qj67_74579_c1 nmdc:mga0qj67_74579_c1_720_1133 135
405 3300050510 nmdc:mga06r32_350475_c1 nmdc:mga06r32_350475_c1_710_1123 135
406 3300050510 nmdc:mga06r32_512718_c1 nmdc:mga06r32_512718_c1_538_951 135
407 3300050511 nmdc:mga08y16_309181_c1 nmdc:mga08y16_309181_c1_980_1390 135
408 3300050511 nmdc:mga08y16_646293_c1 nmdc:mga08y16_646293_c1_412_825 135
409 3300050512 nmdc:mga0n895_19427_c1 nmdc:mga0n895_19427_c1_3672_4082 135
410 3300050512 nmdc:mga0n895_2252530_c1 nmdc:mga0n895_2252530_c1_33_446 135
411 3300050513 nmdc:mga0rr50_16263_c1 nmdc:mga0rr50_16263_c1_4265_4678 135
412 3300050513 nmdc:mga0rr50_985683_c1 nmdc:mga0rr50_985683_c1_164_577 135
413 3300050514 nmdc:mga08x19_110105_c1 nmdc:mga08x19_110105_c1_469_882 135
414 3300050515 nmdc:mga0a205_430993_c1 nmdc:mga0a205_430993_c1_492_905 135
415 3300050515 nmdc:mga0a205_48978_c1 nmdc:mga0a205_48978_c1_3446_3856 135
416 3300053116 Ga0500592_015929 Ga0500592_015929_419_838 135
417 3300054114 Ga0501084_0228032 Ga0501084_0228032_378_791 135
418 3300054114 Ga0501084_0273820 Ga0501084_0273820_675_1088 135
419 3300054114 Ga0501084_1669745 Ga0501084_1669745_54_467 135
420 3300060353 Ga0501082_0564585 Ga0501082_0564585_411_824 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

21

131

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.9495 2 128
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9216 2 127
3okx-assembly1.cif.gz_A crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9107 2 135
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8877 2 128
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8437 2 127
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9498 3 128 2.40.30.70
af_Q58978_4_126_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9155 4 128 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8971 2 134 2.40.30.70
af_Q9BU70_29_181_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8949 3 128 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8948 3 128 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A538A8W8-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9841 1 128 GO:0008168
GO:0032259
AF-A0A372JAW0-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9833 1 130 GO:0008168
GO:0032259
AF-A0A127JRV9-F1-model_v4 Methyltransferase 0.983 2 128 GO:0008168
GO:0032259
AF-A0A5J5JZE6-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9822 1 130 GO:0008168
GO:0032259
AF-A0A4P2QHZ5-F1-model_v4 TsaA-like domain-containing protein 0.981 1 129

Feature Viewer

pLDDT pTM Quality
91.49 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map