F439767

General Info

Members Datasets Scaffolds Average Seq Length
420 264 840 395

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10152707|Ga0307513_101527073
Length 411
Sequence VRQVVVTGLGAVAPHGDDPHAMFAALMRGESAVRAVFPELQKPAAAAVTAFDAGRWFTKLQLPGVDRVSQLAAAAADLAMRDAGDLGDLDPERVGVFVGCGMGGAAALEAAYRSNGRVPPLTIPAFMPNAPAAQLAIRHGVQGPVLTYSVACASSSVAIAEAAKAVEHGEVDLAIAGGSEALVVPGVVLAWQAMQTLATFHPDEAARAVRPFASDRSGFALGEGAAFLILESAERAHARRARVYAALAGWGISSDATHLTKPDAPGQARALRAALRRADMAPRDIGYCNAHGTATRIGDVVERDALAATWGDELEHLRVSSTKALHGHLLGAAGALEALITVLALHHRQLPPNAHCESVDPACNLNLVLEAGTAAPQLQAAISSSFAFGGTNSVLLFADASAHKSKKQRLV

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
117 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
118 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
119 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
140 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
152 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
153 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
154 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
155 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
210 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
211 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
221 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
224 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
225 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
226 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
227 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
228 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
229 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
230 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
231 2643221658 Variovorax sp. Root411 Isolate Unclassified
232 2643221672 Variovorax sp. Root434 Isolate Unclassified
233 2643221683 Variovorax sp. Root473 Isolate Unclassified
234 2738541277 Variovorax sp. GV051 Isolate Unclassified
235 2738541307 Variovorax sp. GV008 Isolate Unclassified
236 2738543013 Variovorax sp. BT01 Isolate Unclassified
237 2738543019 Variovorax sp. GV040 Isolate Unclassified
238 2818991446 Variovorax sp. 1180 Isolate Unclassified
239 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
240 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
241 2842733646 Variovorax sp. R-72446 Isolate Unclassified
242 2842747753 Variovorax sp. R-72060 Isolate Unclassified
243 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
244 2885198086 Variovorax sp. 679 Isolate Unclassified
245 2885211737 Variovorax sp. 553 Isolate Unclassified
246 2899924645 Variovorax sp. 369 Isolate Unclassified
247 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
248 2904456579 Variovorax sp. 2002 Isolate Unclassified
249 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
250 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
251 2928037797 Variovorax sp. 1126 Isolate Unclassified
252 2928044640 Variovorax sp. 1128 Isolate Unclassified
253 2928051484 Variovorax sp. 1133 Isolate Unclassified
254 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
255 2928070936 Variovorax gossypii 1167 Isolate Unclassified
256 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
257 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
258 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
259 2929520902 Variovorax beijingensis 502 Isolate Unclassified
260 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
261 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
262 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
263 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
264 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.1
Nodule 0.71
Rhizoplane 1.67
Rhizosphere 45.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10152707 3300031456 Bacteria 2215
2 JGI24739J22299_10011902 3300001989 Bacteria 3202
3 JGI25152J39213_1001387 3300002773 Bacteria 10498
4 JGI25152J39213_1010797 3300002773 Bacteria 2061
5 JGI25150J39212_1002097 3300002774 Bacteria 5163
6 JGI25159J45721_1001737 3300002987 Bacteria 8778
7 JGI25151J46595_10001719 3300003187 Bacteria 14295
8 JGI25151J46595_10002659 3300003187 Bacteria 10486
9 JGI25151J46595_10015933 3300003187 Bacteria 3298
10 JGI25153J46596_10002893 3300003215 Bacteria 9739
11 rootL2_10008425 3300003322 Bacteria 29138
12 JGI25160J50197_1001995 3300003354 Bacteria 9739
13 JGI25160J50197_1018467 3300003354 Bacteria 2173
14 JGI25161J50226_1000931 3300003374 Bacteria 10498
15 JGI25161J50226_1001029 3300003374 Bacteria 9691
16 Ga0055535_1000392 3300003761 Bacteria 41361
17 Ga0055542_1000033 3300003762 Bacteria 233997
18 Ga0055526_1003591 3300003771 Bacteria 9739
19 Ga0055526_1003609 3300003771 Bacteria 9707
20 Ga0055537_1001046 3300003773 Bacteria 12403
21 Ga0055537_1001375 3300003773 Bacteria 9739
22 Ga0055524_1002382 3300003775 Bacteria 9739
23 Ga0055524_1002402 3300003775 Bacteria 9707
24 Ga0055536_1001865 3300003781 Bacteria 12295
25 Ga0055536_1002374 3300003781 Bacteria 10625
26 Ga0055536_1006469 3300003781 Bacteria 5461
27 Ga0055536_1030988 3300003781 Bacteria 1407
28 Ga0055534_1000401 3300003784 Bacteria 26682
29 Ga0055534_1002653 3300003784 Bacteria 6070
30 Ga0055534_1003249 3300003784 Bacteria 5198
31 Ga0055534_1007561 3300003784 Bacteria 2572
32 Ga0055528_1002529 3300003790 Bacteria 9739
33 Ga0055528_1003559 3300003790 Bacteria 7766
34 Ga0055530_10000894 3300003791 Bacteria 24528
35 Ga0055530_10002156 3300003791 Bacteria 13041
36 Ga0055530_10006200 3300003791 Bacteria 5409
37 Ga0055540_1000672 3300003792 Bacteria 23734
38 Ga0055540_1001287 3300003792 Bacteria 15227
39 Ga0055540_1001713 3300003792 Bacteria 12615
40 Ga0055540_1006892 3300003792 Bacteria 4406
41 Ga0055531_10000926 3300003794 Bacteria 23734
42 Ga0055531_10011053 3300003794 Bacteria 4406
43 Ga0055531_10014952 3300003794 Bacteria 3458
44 Ga0055543_1002672 3300004625 Bacteria 5724
45 Ga0065165_1003935 3300005262 Bacteria 9777
46 Ga0065165_1014132 3300005262 Bacteria 3117
47 Ga0070669_100023484 3300005353 Bacteria 4415
48 Ga0070667_100001132 3300005367 Bacteria 24302
49 Ga0068867_100008541 3300005459 Bacteria 7228
50 Ga0068867_100154347 3300005459 Bacteria 1806
51 Ga0068853_100132171 3300005539 Bacteria 2235
52 Ga0070672_100224546 3300005543 Bacteria 1576
53 Ga0070665_100362782 3300005548 Bacteria 1455
54 Ga0068855_100081726 3300005563 Bacteria 3745
55 Ga0070664_100017963 3300005564 Bacteria 5806
56 Ga0068852_100164101 3300005616 Bacteria 2077
57 Ga0068859_100152470 3300005617 Bacteria 2387
58 Ga0068864_100008599 3300005618 Bacteria 8425
59 Ga0068866_10021809 3300005718 Bacteria 2955
60 Ga0068861_100002598 3300005719 Bacteria 11823
61 Ga0068851_10017496 3300005834 Bacteria 3444
62 Ga0068863_100008729 3300005841 Bacteria 9899
63 Ga0068858_100075588 3300005842 Bacteria 3129
64 Ga0068860_100001219 3300005843 Bacteria 28009
65 Ga0068860_100038522 3300005843 Bacteria 4573
66 Ga0068862_100012222 3300005844 Bacteria 7097
67 Ga0068862_100019823 3300005844 Bacteria 5616
68 Ga0068862_100089766 3300005844 Bacteria 2675
69 Ga0075367_10033583 3300006178 Bacteria 2959
70 Ga0075366_10001878 3300006195 Bacteria 10598
71 Ga0075366_10019777 3300006195 Bacteria 3902
72 Ga0075366_10021986 3300006195 Bacteria 3708
73 Ga0075370_10000784 3300006353 Bacteria 12697
74 Ga0075370_10003275 3300006353 Bacteria 7680
75 Ga0075370_10005140 3300006353 Bacteria 6456
76 Ga0075370_10014286 3300006353 Bacteria 4235
77 Ga0097620_100152463 3300006931 Bacteria 2387
78 Ga0099826_10013421 3300006948 Bacteria 6192
79 Ga0105240_10003282 3300009093 Bacteria 25301
80 Ga0105245_10014972 3300009098 Bacteria 6757
81 Ga0105243_10002338 3300009148 Bacteria 15864
82 Ga0105243_10003767 3300009148 Bacteria 12156
83 Ga0105243_10023765 3300009148 Bacteria 4671
84 Ga0105237_10001435 3300009545 Bacteria 31496
85 Ga0105238_10035600 3300009551 Bacteria 5061
86 Ga0105249_10038310 3300009553 Bacteria 4350
87 Ga0105239_10001553 3300010375 Bacteria 30349
88 Ga0105246_10017494 3300011119 Bacteria 4557
89 Ga0157373_10205869 3300013100 Bacteria 1387
90 Ga0157370_10008173 3300013104 Bacteria 11309
91 Ga0157369_10018464 3300013105 Bacteria 7819
92 Ga0157378_10011125 3300013297 Bacteria 7875
93 Ga0163162_10004321 3300013306 Bacteria 13683
94 Ga0157375_10263770 3300013308 Bacteria 1884
95 Ga0163163_10056936 3300014325 Bacteria 3865
96 Ga0157380_10064972 3300014326 Bacteria 2931
97 Ga0182008_10001298 3300014497 Bacteria 17055
98 Ga0182008_10002071 3300014497 Bacteria 12832
99 Ga0182008_10006660 3300014497 Bacteria 6432
100 Ga0182008_10016898 3300014497 Bacteria 3785
101 Ga0157379_10021862 3300014968 Bacteria 5667
102 Ga0157379_10090073 3300014968 Bacteria 2752
103 Ga0157379_10098195 3300014968 Bacteria 2629
104 Ga0157379_10332179 3300014968 Bacteria 1389
105 Ga0157376_10117988 3300014969 Bacteria 2347
106 Ga0182006_1000895 3300015261 Bacteria 19978
107 Ga0182007_10000647 3300015262 Bacteria 20069
108 Ga0183362_10003 3300015683 Bacteria 977584
109 Ga0163161_10000166 3300017792 Bacteria 60327
110 Ga0163161_10010912 3300017792 Bacteria 6298
111 Ga0213872_10017782 3300021361 Bacteria 3282
112 Ga0209672_100794 3300025228 Bacteria 15056
113 Ga0209147_104087 3300025229 Bacteria 2546
114 Ga0209258_100089 3300025242 Bacteria 234040
115 Ga0207425_1000603 3300025245 Bacteria 20837
116 Ga0207425_1011544 3300025245 Bacteria 2101
117 Ga0209148_1000097 3300025254 Bacteria 234049
118 Ga0209129_1000071 3300025258 Bacteria 210729
119 Ga0209565_1000175 3300025263 Bacteria 81833
120 Ga0209565_1000334 3300025263 Bacteria 41939
121 Ga0209673_1000099 3300025273 Bacteria 193248
122 Ga0209673_1001065 3300025273 Bacteria 31373
123 Ga0209673_1001338 3300025273 Bacteria 24643
124 Ga0209673_1002081 3300025273 Bacteria 15039
125 Ga0209130_1000456 3300025284 Bacteria 43000
126 Ga0209130_1000812 3300025284 Bacteria 26378
127 Ga0209130_1005272 3300025284 Bacteria 4548
128 Ga0209675_1000054 3300025291 Bacteria 193248
129 Ga0209675_1001110 3300025291 Bacteria 16417
130 Ga0209675_1001269 3300025291 Bacteria 15100
131 Ga0209675_1001575 3300025291 Bacteria 12922
132 Ga0209675_1004395 3300025291 Bacteria 6286
133 Ga0209676_1000005 3300025292 Bacteria 1076001
134 Ga0209676_1000260 3300025292 Bacteria 111683
135 Ga0209676_1001229 3300025292 Bacteria 27108
136 Ga0209676_1006720 3300025292 Bacteria 5599
137 Ga0209676_1015719 3300025292 Bacteria 2772
138 Ga0209676_1024453 3300025292 Bacteria 1956
139 Ga0209025_1000854 3300025294 Bacteria 48260
140 Ga0209025_1001065 3300025294 Bacteria 39873
141 Ga0209025_1001296 3300025294 Bacteria 34134
142 Ga0209025_1001409 3300025294 Bacteria 31873
143 Ga0209025_1013915 3300025294 Bacteria 5009
144 Ga0209025_1016601 3300025294 Bacteria 4325
145 Ga0209564_1000239 3300025295 Bacteria 119761
146 Ga0209564_1000890 3300025295 Bacteria 39405
147 Ga0209758_1000027 3300025297 Bacteria 549650
148 Ga0209050_1000007 3300025298 Bacteria 1187891
149 Ga0209050_1000954 3300025298 Bacteria 37580
150 Ga0209050_1019190 3300025298 Bacteria 2612
151 Ga0209256_1000081 3300025299 Bacteria 222908
152 Ga0209256_1003946 3300025299 Bacteria 9759
153 Ga0207426_1000027 3300025302 Bacteria 513176
154 Ga0207426_1000614 3300025302 Bacteria 45951
155 Ga0209051_1000009 3300025303 Bacteria 706778
156 Ga0209051_1000319 3300025303 Bacteria 72894
157 Ga0209051_1000619 3300025303 Bacteria 40839
158 Ga0209051_1000661 3300025303 Bacteria 38725
159 Ga0209051_1010230 3300025303 Bacteria 4763
160 Ga0209051_1014811 3300025303 Bacteria 3621
161 Ga0209257_1000873 3300025304 Bacteria 42738
162 Ga0209257_1002439 3300025304 Bacteria 18494
163 Ga0209257_1007485 3300025304 Bacteria 6574
164 Ga0209257_1007871 3300025304 Bacteria 6276
165 Ga0209257_1011229 3300025304 Bacteria 4347
166 Ga0207655_1002596 3300025728 Bacteria 14387
167 Ga0207695_10192513 3300025913 Bacteria 1956
168 Ga0207671_10039364 3300025914 Bacteria 3501
169 Ga0207681_10052887 3300025923 Bacteria 2755
170 Ga0207694_10039803 3300025924 Bacteria 3618
171 Ga0207694_10074862 3300025924 Bacteria 2650
172 Ga0207687_10010676 3300025927 Bacteria 5999
173 Ga0207709_10001232 3300025935 Bacteria 18384
174 Ga0207709_10002287 3300025935 Bacteria 12156
175 Ga0207709_10129027 3300025935 Bacteria 1720
176 Ga0207704_10202622 3300025938 Bacteria 1454
177 Ga0207679_10072549 3300025945 Bacteria 2601
178 Ga0207667_10146630 3300025949 Bacteria 2430
179 Ga0207712_10058939 3300025961 Bacteria 2715
180 Ga0207658_10001749 3300025986 Bacteria 16347
181 Ga0207639_10059021 3300026041 Bacteria 2954
182 Ga0207639_10107742 3300026041 Bacteria 2264
183 Ga0207678_10138849 3300026067 Bacteria 2074
184 Ga0207708_10011916 3300026075 Bacteria 6477
185 Ga0207641_10092528 3300026088 Bacteria 2648
186 Ga0207648_10000765 3300026089 Bacteria 36119
187 Ga0207676_10006096 3300026095 Bacteria 8508
188 Ga0207675_100001028 3300026118 Bacteria 27641
189 Ga0207675_100285304 3300026118 Bacteria 1605
190 Ga0207698_10095760 3300026142 Bacteria 2444
191 Ga0209282_1000328 3300027666 Bacteria 23523
192 Ga0268265_10009804 3300028380 Bacteria 6466
193 Ga0268265_10076744 3300028380 Bacteria 2622
194 Ga0268264_10004657 3300028381 Bacteria 11658
195 Ga0307517_10004027 3300028786 Bacteria 22740
196 Ga0307517_10185020 3300028786 Bacteria 1335
197 Ga0307515_10000049 3300028794 Bacteria 278611
198 Ga0307515_10000066 3300028794 Bacteria 244076
199 Ga0307515_10000219 3300028794 Bacteria 141532
200 Ga0307515_10000347 3300028794 Bacteria 114603
201 Ga0307515_10002435 3300028794 Bacteria 40544
202 Ga0307515_10012248 3300028794 Bacteria 16152
203 Ga0307515_10013197 3300028794 Bacteria 15457
204 Ga0307515_10047560 3300028794 Bacteria 6516
205 Ga0307515_10081962 3300028794 Bacteria 4181
206 Ga0307512_10012282 3300030522 Bacteria 8091
207 Ga0316177_1054315 3300030731 Bacteria 5366
208 Ga0316179_1017836 3300030734 Bacteria 2264
209 Ga0316178_1150052 3300030735 Bacteria 3795
210 Ga0316180_1132740 3300030736 Bacteria 4845
211 Ga0316183_1062425 3300030742 Bacteria 4416
212 Ga0316182_1091823 3300030745 Bacteria 3014
213 Ga0265327_10000851 3300031251 Bacteria 45640
214 Ga0265327_10005998 3300031251 Bacteria 9881
215 Ga0307513_10063060 3300031456 Bacteria 3913
216 Ga0307513_10086875 3300031456 Bacteria 3204
217 Ga0307513_10088835 3300031456 Bacteria 3157
218 Ga0307513_10091856 3300031456 Bacteria 3092
219 Ga0307513_10094081 3300031456 Bacteria 3043
220 Ga0307513_10098664 3300031456 Bacteria 2951
221 Ga0307513_10281717 3300031456 Bacteria 1439
222 Ga0307509_10002117 3300031507 Bacteria 32688
223 Ga0307509_10008345 3300031507 Bacteria 13233
224 Ga0307509_10008437 3300031507 Bacteria 13144
225 Ga0307509_10017568 3300031507 Bacteria 8226
226 Ga0307509_10045445 3300031507 Bacteria 4735
227 Ga0307408_100068783 3300031548 Bacteria 2608
228 Ga0307508_10000392 3300031616 Bacteria 52650
229 Ga0307508_10001018 3300031616 Bacteria 32597
230 Ga0307508_10001804 3300031616 Bacteria 23735
231 Ga0307514_10018273 3300031649 Bacteria 5752
232 Ga0307514_10056033 3300031649 Bacteria 3027
233 Ga0307516_10001538 3300031730 Bacteria 31719
234 Ga0307516_10005041 3300031730 Bacteria 15980
235 Ga0307405_10128061 3300031731 Bacteria 1749
236 Ga0307412_10005171 3300031911 Bacteria 7309
237 Ga0307416_100014412 3300032002 Bacteria 5418
238 Ga0307414_10042076 3300032004 Bacteria 3101
239 Ga0307414_10043275 3300032004 Bacteria 3066
240 Ga0307411_10031863 3300032005 Bacteria 3250
241 Ga0307507_10025359 3300033179 Bacteria 6433
242 Ga0307510_10013446 3300033180 Bacteria 9706
243 Ga0307510_10016809 3300033180 Bacteria 8632
244 Ga0307510_10057049 3300033180 Bacteria 4058
245 Ga0373927_0009084 3300035695 Bacteria 6671
246 Ga0373925_0014737 3300037068 Bacteria 5648
247 Ga0373925_0026637 3300037068 Bacteria 4231
248 Ga0436361_0425741 3300039447 Bacteria 44363
249 Ga0436361_0561928 3300039447 Bacteria 10291
250 Ga0436361_0856108 3300039447 Bacteria 17978
251 Ga0439436_0003789 3300041404 Bacteria 4625
252 Ga0439447_005462 3300041407 Bacteria 4229
253 Ga0439461_0014126 3300041410 Bacteria 1514
254 Ga0439466_0003353 3300041411 Bacteria 6230
255 Ga0439466_0006727 3300041411 Bacteria 4361
256 Ga0451843_1322652 3300041509 Bacteria 1879
257 Ga0439431_0000498 3300041997 Bacteria 8312
258 Ga0439431_0010048 3300041997 Bacteria 2143
259 Ga0439433_0008161 3300041999 Bacteria 2267
260 Ga0439442_001009 3300042002 Bacteria 5687
261 Ga0439442_010391 3300042002 Bacteria 1887
262 Ga0439445_0001052 3300042004 Bacteria 5898
263 Ga0439445_0005390 3300042004 Bacteria 2916
264 Ga0439432_002426 3300042006 Bacteria 7019
265 Ga0439432_008862 3300042006 Bacteria 3518
266 Ga0439449_0002385 3300042007 Bacteria 7353
267 Ga0439449_0007720 3300042007 Bacteria 4085
268 Ga0439457_003333 3300042014 Bacteria 4389
269 Ga0439462_0002381 3300042015 Bacteria 4361
270 Ga0450911_000061 3300042115 Bacteria 44228
271 Ga0450920_013455 3300042122 Bacteria 1541
272 Ga0450923_000531 3300042125 Bacteria 4266
273 Ga0450898_008307 3300042134 Bacteria 1635
274 Ga0450898_008436 3300042134 Bacteria 1626
275 Ga0450908_003789 3300042184 Bacteria 2926
276 Ga0439434_0004079 3300042435 Bacteria 4265
277 Ga0439434_0009389 3300042435 Bacteria 2875
278 Ga0439434_0016372 3300042435 Bacteria 2215
279 Ga0451577_0000137 3300042876 Bacteria 163955
280 Ga0453684_0000014 3300044712 Bacteria 993311
281 Ga0453684_0000384 3300044712 Bacteria 181189
282 Ga0453684_0003729 3300044712 Bacteria 33733
283 Ga0453684_0073453 3300044712 Bacteria 4311
284 Ga0466957_0005242 3300044842 Bacteria 7258
285 Ga0466960_0028914 3300044901 Bacteria 2540
286 Ga0451576_0000169 3300045051 Bacteria 164329
287 Ga0495627_006311 3300046453 Bacteria 4656
288 Ga0495592_0000370 3300046454 Bacteria 35460
289 Ga0495629_0160954 3300046459 Bacteria 1559
290 Ga0495638_0033194 3300046460 Bacteria 3302
291 Ga0495638_0073304 3300046460 Bacteria 2090
292 Ga0495582_0070245 3300046473 Bacteria 1937
293 Ga0495610_0010133 3300046512 Bacteria 5883
294 Ga0495616_0022905 3300046513 Bacteria 3367
295 Ga0495620_0035242 3300046515 Bacteria 2252
296 Ga0495620_0048211 3300046515 Bacteria 1830
297 Ga0495630_0153252 3300046517 Bacteria 1754
298 Ga0495631_0002245 3300046518 Bacteria 11094
299 Ga0495637_0004546 3300046520 Bacteria 7173
300 Ga0495586_0019141 3300046535 Bacteria 3642
301 Ga0495621_0007194 3300046539 Bacteria 3286
302 Ga0495668_0024457 3300046616 Bacteria 3435
303 Ga0495625_0000896 3300046660 Bacteria 40225
304 Ga0495625_0008969 3300046660 Bacteria 8447
305 Ga0495625_0041741 3300046660 Bacteria 3338
306 Ga0495588_0012218 3300046674 Bacteria 4051
307 Ga0495588_0015389 3300046674 Bacteria 3681
308 Ga0495588_0040798 3300046674 Bacteria 2368
309 Ga0495658_0018565 3300046683 Bacteria 3618
310 Ga0495613_0175536 3300046689 Bacteria 1519
311 Ga0495624_0081270 3300046690 Bacteria 2007
312 Ga0495671_0050380 3300046692 Bacteria 2073
313 Ga0495660_0019101 3300046810 Bacteria 3935
314 Ga0495636_0021809 3300047318 Bacteria 2587
315 Ga0495676_0026281 3300047321 Bacteria 5014
316 Ga0495676_0103644 3300047321 Bacteria 2100
317 Ga0495593_0030036 3300047673 Bacteria 2976
318 Ga0495593_0033930 3300047673 Bacteria 2778
319 Ga0495602_0155638 3300048088 Bacteria 1790
320 Ga0495614_0021155 3300048089 Bacteria 2811
321 Ga0495614_0032663 3300048089 Bacteria 2240
322 Ga0496102_0001150 3300048905 Bacteria 24162
323 Ga0496102_0028412 3300048905 Bacteria 4995
324 Ga0496108_0028950 3300048911 Bacteria 4583
325 Ga0496114_0142907 3300048917 Bacteria 2073
326 Ga0496116_0042787 3300048919 Bacteria 3092
327 Ga0496117_0035531 3300048920 Bacteria 3739
328 Ga0496118_0015401 3300048921 Bacteria 7079
329 Ga0496118_0078733 3300048921 Bacteria 2330
330 Ga0496121_0002603 3300048924 Bacteria 27252
331 Ga0496122_0000688 3300048925 Bacteria 67392
332 Ga0496122_0025558 3300048925 Bacteria 5125
333 Ga0496122_0049457 3300048925 Bacteria 3219
334 Ga0496122_0064881 3300048925 Bacteria 2653
335 Ga0496123_0001158 3300048926 Bacteria 39125
336 Ga0496123_0030384 3300048926 Bacteria 3955
337 Ga0496124_0032773 3300048927 Bacteria 4582
338 Ga0496124_0191536 3300048927 Bacteria 1564
339 Ga0496124_0276609 3300048927 Bacteria 1226
340 Ga0496125_0012084 3300048928 Bacteria 8592
341 Ga0496125_0012324 3300048928 Bacteria 8494
342 Ga0496125_0015670 3300048928 Bacteria 7314
343 Ga0496125_0037100 3300048928 Bacteria 4242
344 Ga0496126_0080866 3300048929 Bacteria 2874
345 nmdc:mga03683_3988_c1 3300050489 Bacteria 4835
346 nmdc:mga03683_5284_c1 3300050489 Bacteria 4353
347 nmdc:mga0yw44_125962_c1 3300050492 Bacteria 1654
348 nmdc:mga0k408_11117_c1 3300050493 Bacteria 4892
349 nmdc:mga07m45_14769_c1 3300050496 Bacteria 3544
350 nmdc:mga07m45_14996_c1 3300050496 Bacteria 4137
351 nmdc:mga07m45_3999_c1 3300050496 Bacteria 7172
352 nmdc:mga07m45_637_c1 3300050496 Bacteria 14921
353 nmdc:mga0qj67_245562_c1 3300050509 Bacteria 1452
354 Ga0500578_0020786 3300053086 Bacteria 4220
355 Ga0500643_012370 3300053087 Bacteria 3057
356 Ga0500644_0016184 3300053088 Bacteria 2144
357 Ga0500644_0022148 3300053088 Bacteria 1913
358 Ga0500651_0000029 3300053093 Bacteria 113528
359 Ga0500562_005715 3300053108 Bacteria 3131
360 Ga0500562_007153 3300053108 Bacteria 2817
361 Ga0500571_000115 3300053110 Bacteria 26083
362 Ga0500593_000703 3300053117 Bacteria 12759
363 Ga0500594_0000934 3300053118 Bacteria 6280
364 Ga0500607_001057 3300053121 Bacteria 25918
365 Ga0500607_034327 3300053121 Bacteria 2778
366 Ga0500608_008770 3300053122 Bacteria 4266
367 Ga0500655_001331 3300053133 Bacteria 4687
368 Ga0500658_0000245 3300053134 Bacteria 25454
369 Ga0500658_0000252 3300053134 Bacteria 24949
370 Ga0500559_0000195 3300053136 Bacteria 48743
371 Ga0500559_0001309 3300053136 Bacteria 14367
372 Ga0500559_0004121 3300053136 Bacteria 6968
373 Ga0500559_0012713 3300053136 Bacteria 3573
374 Ga0500564_015041 3300053138 Bacteria 3490
375 Ga0500590_013646 3300053148 Bacteria 4174
376 Ga0500619_000078 3300053154 Bacteria 27132
377 Ga0500634_0021440 3300053161 Bacteria 3501
378 Ga0500645_000801 3300053730 Bacteria 18863
379 2513227989 2513020051 Bacteria 6053213
380 2587758878 2585428062 Bacteria 6842168
381 2599624043 2599185214 Bacteria 8209958
382 2599672054 2599185226 Bacteria 8233575
383 2599681864 2599185227 Bacteria 8246414
384 2599693877 2599185229 Bacteria 8216126
385 2644162611 2643221628 Bacteria 5745828
386 2644303894 2643221654 Bacteria 5273570
387 2644328800 2643221658 Bacteria 6064537
388 2644397981 2643221672 Bacteria 6322190
389 2644469167 2643221683 Bacteria 5749203
390 2738719953 2738541277 Bacteria 7458140
391 2738881452 2738541307 Bacteria 8606193
392 2739249628 2738543013 Bacteria 5618633
393 2739279152 2738543019 Bacteria 7459457
394 2819596492 2818991446 Bacteria 7757362
395 2831269530 2831265667 Bacteria 7184833
396 2838060021 2838054893 Bacteria 7451788
397 2842736793 2842733646 Bacteria 5716726
398 2842747864 2842747753 Bacteria 5578255
399 2885193421 2885192300 Bacteria 5882526
400 2885199626 2885198086 Bacteria 7212419
401 2885213101 2885211737 Bacteria 7212420
402 2899931209 2899924645 Bacteria 7487985
403 2904450076 2904449895 Bacteria 6927402
404 2904457108 2904456579 Bacteria 6819253
405 2904543912 2904541872 Bacteria 8915136
406 2919464996 2919462493 Bacteria 5817112
407 2928038018 2928037797 Bacteria 7273642
408 2928046376 2928044640 Bacteria 7271509
409 2928054072 2928051484 Bacteria 7773759
410 2928065825 2928064002 Bacteria 7419480
411 2928076725 2928070936 Bacteria 8062541
412 2928090525 2928084124 Bacteria 7159212
413 2928119360 2928115317 Bacteria 6477646
414 2929162529 2929160207 Bacteria 9075316
415 2929525359 2929520902 Bacteria 6765052
416 2945913090 2945909444 Bacteria 7065066
417 2945948734 2945945610 Bacteria 5951079
418 2945972858 2945972063 Bacteria 6086495
419 2945984623 2945984333 Bacteria 7358892
420 2954772877 2954767861 Bacteria 5535784
421 Ga0307513_10152707
422 JGI24739J22299_10011902
423 JGI25152J39213_1001387
424 JGI25152J39213_1010797
425 JGI25150J39212_1002097
426 JGI25159J45721_1001737
427 JGI25151J46595_10001719
428 JGI25151J46595_10002659
429 JGI25151J46595_10015933
430 JGI25153J46596_10002893
431 rootL2_10008425
432 JGI25160J50197_1001995
433 JGI25160J50197_1018467
434 JGI25161J50226_1000931
435 JGI25161J50226_1001029
436 Ga0055535_1000392
437 Ga0055542_1000033
438 Ga0055526_1003591
439 Ga0055526_1003609
440 Ga0055537_1001046
441 Ga0055537_1001375
442 Ga0055524_1002382
443 Ga0055524_1002402
444 Ga0055536_1001865
445 Ga0055536_1002374
446 Ga0055536_1006469
447 Ga0055536_1030988
448 Ga0055534_1000401
449 Ga0055534_1002653
450 Ga0055534_1003249
451 Ga0055534_1007561
452 Ga0055528_1002529
453 Ga0055528_1003559
454 Ga0055530_10000894
455 Ga0055530_10002156
456 Ga0055530_10006200
457 Ga0055540_1000672
458 Ga0055540_1001287
459 Ga0055540_1001713
460 Ga0055540_1006892
461 Ga0055531_10000926
462 Ga0055531_10011053
463 Ga0055531_10014952
464 Ga0055543_1002672
465 Ga0065165_1003935
466 Ga0065165_1014132
467 Ga0070669_100023484
468 Ga0070667_100001132
469 Ga0068867_100008541
470 Ga0068867_100154347
471 Ga0068853_100132171
472 Ga0070672_100224546
473 Ga0070665_100362782
474 Ga0068855_100081726
475 Ga0070664_100017963
476 Ga0068852_100164101
477 Ga0068859_100152470
478 Ga0068864_100008599
479 Ga0068866_10021809
480 Ga0068861_100002598
481 Ga0068851_10017496
482 Ga0068863_100008729
483 Ga0068858_100075588
484 Ga0068860_100001219
485 Ga0068860_100038522
486 Ga0068862_100012222
487 Ga0068862_100019823
488 Ga0068862_100089766
489 Ga0075367_10033583
490 Ga0075366_10001878
491 Ga0075366_10019777
492 Ga0075366_10021986
493 Ga0075370_10000784
494 Ga0075370_10003275
495 Ga0075370_10005140
496 Ga0075370_10014286
497 Ga0097620_100152463
498 Ga0099826_10013421
499 Ga0105240_10003282
500 Ga0105245_10014972
501 Ga0105243_10002338
502 Ga0105243_10003767
503 Ga0105243_10023765
504 Ga0105237_10001435
505 Ga0105238_10035600
506 Ga0105249_10038310
507 Ga0105239_10001553
508 Ga0105246_10017494
509 Ga0157373_10205869
510 Ga0157370_10008173
511 Ga0157369_10018464
512 Ga0157378_10011125
513 Ga0163162_10004321
514 Ga0157375_10263770
515 Ga0163163_10056936
516 Ga0157380_10064972
517 Ga0182008_10001298
518 Ga0182008_10002071
519 Ga0182008_10006660
520 Ga0182008_10016898
521 Ga0157379_10021862
522 Ga0157379_10090073
523 Ga0157379_10098195
524 Ga0157379_10332179
525 Ga0157376_10117988
526 Ga0182006_1000895
527 Ga0182007_10000647
528 Ga0183362_10003
529 Ga0163161_10000166
530 Ga0163161_10010912
531 Ga0213872_10017782
532 Ga0209672_100794
533 Ga0209147_104087
534 Ga0209258_100089
535 Ga0207425_1000603
536 Ga0207425_1011544
537 Ga0209148_1000097
538 Ga0209129_1000071
539 Ga0209565_1000175
540 Ga0209565_1000334
541 Ga0209673_1000099
542 Ga0209673_1001065
543 Ga0209673_1001338
544 Ga0209673_1002081
545 Ga0209130_1000456
546 Ga0209130_1000812
547 Ga0209130_1005272
548 Ga0209675_1000054
549 Ga0209675_1001110
550 Ga0209675_1001269
551 Ga0209675_1001575
552 Ga0209675_1004395
553 Ga0209676_1000005
554 Ga0209676_1000260
555 Ga0209676_1001229
556 Ga0209676_1006720
557 Ga0209676_1015719
558 Ga0209676_1024453
559 Ga0209025_1000854
560 Ga0209025_1001065
561 Ga0209025_1001296
562 Ga0209025_1001409
563 Ga0209025_1013915
564 Ga0209025_1016601
565 Ga0209564_1000239
566 Ga0209564_1000890
567 Ga0209758_1000027
568 Ga0209050_1000007
569 Ga0209050_1000954
570 Ga0209050_1019190
571 Ga0209256_1000081
572 Ga0209256_1003946
573 Ga0207426_1000027
574 Ga0207426_1000614
575 Ga0209051_1000009
576 Ga0209051_1000319
577 Ga0209051_1000619
578 Ga0209051_1000661
579 Ga0209051_1010230
580 Ga0209051_1014811
581 Ga0209257_1000873
582 Ga0209257_1002439
583 Ga0209257_1007485
584 Ga0209257_1007871
585 Ga0209257_1011229
586 Ga0207655_1002596
587 Ga0207695_10192513
588 Ga0207671_10039364
589 Ga0207681_10052887
590 Ga0207694_10039803
591 Ga0207694_10074862
592 Ga0207687_10010676
593 Ga0207709_10001232
594 Ga0207709_10002287
595 Ga0207709_10129027
596 Ga0207704_10202622
597 Ga0207679_10072549
598 Ga0207667_10146630
599 Ga0207712_10058939
600 Ga0207658_10001749
601 Ga0207639_10059021
602 Ga0207639_10107742
603 Ga0207678_10138849
604 Ga0207708_10011916
605 Ga0207641_10092528
606 Ga0207648_10000765
607 Ga0207676_10006096
608 Ga0207675_100001028
609 Ga0207675_100285304
610 Ga0207698_10095760
611 Ga0209282_1000328
612 Ga0268265_10009804
613 Ga0268265_10076744
614 Ga0268264_10004657
615 Ga0307517_10004027
616 Ga0307517_10185020
617 Ga0307515_10000049
618 Ga0307515_10000066
619 Ga0307515_10000219
620 Ga0307515_10000347
621 Ga0307515_10002435
622 Ga0307515_10012248
623 Ga0307515_10013197
624 Ga0307515_10047560
625 Ga0307515_10081962
626 Ga0307512_10012282
627 Ga0316177_1054315
628 Ga0316179_1017836
629 Ga0316178_1150052
630 Ga0316180_1132740
631 Ga0316183_1062425
632 Ga0316182_1091823
633 Ga0265327_10000851
634 Ga0265327_10005998
635 Ga0307513_10063060
636 Ga0307513_10086875
637 Ga0307513_10088835
638 Ga0307513_10091856
639 Ga0307513_10094081
640 Ga0307513_10098664
641 Ga0307513_10281717
642 Ga0307509_10002117
643 Ga0307509_10008345
644 Ga0307509_10008437
645 Ga0307509_10017568
646 Ga0307509_10045445
647 Ga0307408_100068783
648 Ga0307508_10000392
649 Ga0307508_10001018
650 Ga0307508_10001804
651 Ga0307514_10018273
652 Ga0307514_10056033
653 Ga0307516_10001538
654 Ga0307516_10005041
655 Ga0307405_10128061
656 Ga0307412_10005171
657 Ga0307416_100014412
658 Ga0307414_10042076
659 Ga0307414_10043275
660 Ga0307411_10031863
661 Ga0307507_10025359
662 Ga0307510_10013446
663 Ga0307510_10016809
664 Ga0307510_10057049
665 Ga0373927_0009084
666 Ga0373925_0014737
667 Ga0373925_0026637
668 Ga0436361_0425741
669 Ga0436361_0561928
670 Ga0436361_0856108
671 Ga0439436_0003789
672 Ga0439447_005462
673 Ga0439461_0014126
674 Ga0439466_0003353
675 Ga0439466_0006727
676 Ga0451843_1322652
677 Ga0439431_0000498
678 Ga0439431_0010048
679 Ga0439433_0008161
680 Ga0439442_001009
681 Ga0439442_010391
682 Ga0439445_0001052
683 Ga0439445_0005390
684 Ga0439432_002426
685 Ga0439432_008862
686 Ga0439449_0002385
687 Ga0439449_0007720
688 Ga0439457_003333
689 Ga0439462_0002381
690 Ga0450911_000061
691 Ga0450920_013455
692 Ga0450923_000531
693 Ga0450898_008307
694 Ga0450898_008436
695 Ga0450908_003789
696 Ga0439434_0004079
697 Ga0439434_0009389
698 Ga0439434_0016372
699 Ga0451577_0000137
700 Ga0453684_0000014
701 Ga0453684_0000384
702 Ga0453684_0003729
703 Ga0453684_0073453
704 Ga0466957_0005242
705 Ga0466960_0028914
706 Ga0451576_0000169
707 Ga0495627_006311
708 Ga0495592_0000370
709 Ga0495629_0160954
710 Ga0495638_0033194
711 Ga0495638_0073304
712 Ga0495582_0070245
713 Ga0495610_0010133
714 Ga0495616_0022905
715 Ga0495620_0035242
716 Ga0495620_0048211
717 Ga0495630_0153252
718 Ga0495631_0002245
719 Ga0495637_0004546
720 Ga0495586_0019141
721 Ga0495621_0007194
722 Ga0495668_0024457
723 Ga0495625_0000896
724 Ga0495625_0008969
725 Ga0495625_0041741
726 Ga0495588_0012218
727 Ga0495588_0015389
728 Ga0495588_0040798
729 Ga0495658_0018565
730 Ga0495613_0175536
731 Ga0495624_0081270
732 Ga0495671_0050380
733 Ga0495660_0019101
734 Ga0495636_0021809
735 Ga0495676_0026281
736 Ga0495676_0103644
737 Ga0495593_0030036
738 Ga0495593_0033930
739 Ga0495602_0155638
740 Ga0495614_0021155
741 Ga0495614_0032663
742 Ga0496102_0001150
743 Ga0496102_0028412
744 Ga0496108_0028950
745 Ga0496114_0142907
746 Ga0496116_0042787
747 Ga0496117_0035531
748 Ga0496118_0015401
749 Ga0496118_0078733
750 Ga0496121_0002603
751 Ga0496122_0000688
752 Ga0496122_0025558
753 Ga0496122_0049457
754 Ga0496122_0064881
755 Ga0496123_0001158
756 Ga0496123_0030384
757 Ga0496124_0032773
758 Ga0496124_0191536
759 Ga0496124_0276609
760 Ga0496125_0012084
761 Ga0496125_0012324
762 Ga0496125_0015670
763 Ga0496125_0037100
764 Ga0496126_0080866
765 nmdc:mga03683_3988_c1
766 nmdc:mga03683_5284_c1
767 nmdc:mga0yw44_125962_c1
768 nmdc:mga0k408_11117_c1
769 nmdc:mga07m45_14769_c1
770 nmdc:mga07m45_14996_c1
771 nmdc:mga07m45_3999_c1
772 nmdc:mga07m45_637_c1
773 nmdc:mga0qj67_245562_c1
774 Ga0500578_0020786
775 Ga0500643_012370
776 Ga0500644_0016184
777 Ga0500644_0022148
778 Ga0500651_0000029
779 Ga0500562_005715
780 Ga0500562_007153
781 Ga0500571_000115
782 Ga0500593_000703
783 Ga0500594_0000934
784 Ga0500607_001057
785 Ga0500607_034327
786 Ga0500608_008770
787 Ga0500655_001331
788 Ga0500658_0000245
789 Ga0500658_0000252
790 Ga0500559_0000195
791 Ga0500559_0001309
792 Ga0500559_0004121
793 Ga0500559_0012713
794 Ga0500564_015041
795 Ga0500590_013646
796 Ga0500619_000078
797 Ga0500634_0021440
798 Ga0500645_000801
799 2513227989
800 2587758878
801 2599624043
802 2599672054
803 2599681864
804 2599693877
805 2644162611
806 2644303894
807 2644328800
808 2644397981
809 2644469167
810 2738719953
811 2738881452
812 2739249628
813 2739279152
814 2819596492
815 2831269530
816 2838060021
817 2842736793
818 2842747864
819 2885193421
820 2885199626
821 2885213101
822 2899931209
823 2904450076
824 2904457108
825 2904543912
826 2919464996
827 2928038018
828 2928046376
829 2928054072
830 2928065825
831 2928076725
832 2928090525
833 2928119360
834 2929162529
835 2929525359
836 2945913090
837 2945948734
838 2945972858
839 2945984623
840 2954772877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

244

357

0.97

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

1

236

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hnz-assembly1.cif.gz_A structure of e. coli fabf(c163a) in complex with platensimycin 0.9552 2 403
2gfy-assembly1.cif.gz_A-2 structure of e. coli fabf(k335a) mutant with covalently linked dodecanoic acid 0.9545 2 403
6olt-assembly1.cif.gz_A crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabf, and c12-crypto acyl carrier protein, acpp 0.9538 1 403
4r8e-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from yersinia pestis 0.9535 2 403
4jrm-assembly2.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from vibrio cholerae (space group p212121) at 1.75 angstrom 0.9531 2 403
ID Description Score Start End Superfamily
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9551 2 403 3.40.47.10
af_P0AAI5_1_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9528 2 403 3.40.47.10
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9505 2 403 3.40.47.10
4ewgB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.95 254 403 3.40.47.10
4xoxB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9492 254 403 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A353Y2R0-F1-model_v4 Beta-ketoacyl-ACP synthase 0.9808 241 369 GO:0004315
GO:0005829
GO:0006633
AF-A0A7C7PAC7-F1-model_v4 Nodulation protein E (Host-specificity of nodulation protein B) 0.9682 105 403 GO:0004315
GO:0006633
AF-A0A7C7GJ16-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.967 162 403 GO:0004315
GO:0005829
GO:0006633
AF-X0YZS4-F1-model_v4 Ketosynthase family 3 (KS3) domain-containing protein 0.9653 234 403 GO:0004315
GO:0005829
GO:0006633
AF-A0A530L7T1-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9641 123 245 GO:0004315
GO:0005829
GO:0006633

Map