F439776

General Info

Members Datasets Scaffolds Average Seq Length
420 212 420 193

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0287543|Ga0373936_0287543_25_711
Length 228
Sequence LPTPPLAGHQWSKVLYCEASLLYFLAELNEFNNLGKGPGTMKVPYAKKWQKETDKLRQIALDGDLTEELKWGKPCFTFLKKNVAIVIPLKESCAFSFFKGALLKDPKHILQKIGQAQAGRWIKFTSPREIAAVQSTLKDYLYEAIALEKSGRRVVLKKPSDYPIPEELQRKLDDNAVLRSAFQTLTPGRRKSYIFHVSSAKQAKTRAARAEKCVPMILSGRGFNELPS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.67
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10372676 3300003322 Bacteria 1059
2 rootH1_10230584 3300003323 Bacteria 2410
3 Ga0070658_10102300 3300005327 Bacteria 2369
4 Ga0070658_10477940 3300005327 Bacteria 1075
5 Ga0070683_100267385 3300005329 Unclassified 1626
6 Ga0070683_100547380 3300005329 Bacteria 1106
7 Ga0070690_100463539 3300005330 Unclassified 942
8 Ga0070670_100063387 3300005331 Bacteria 3172
9 Ga0070670_100417759 3300005331 Unclassified 1185
10 Ga0068869_100027562 3300005334 Bacteria 3962
11 Ga0070666_10126123 3300005335 Unclassified 1777
12 Ga0070680_100200931 3300005336 Bacteria 1681
13 Ga0070680_100974639 3300005336 Bacteria 732
14 Ga0070682_100195483 3300005337 Bacteria 1423
15 Ga0068868_100110678 3300005338 Bacteria 2231
16 Ga0070660_100011747 3300005339 Bacteria 6235
17 Ga0070660_100098024 3300005339 Bacteria 2320
18 Ga0070691_10180858 3300005341 Bacteria 1098
19 Ga0070661_100001452 3300005344 Bacteria 16450
20 Ga0070661_100007067 3300005344 Bacteria 7744
21 Ga0070661_100031221 3300005344 Unclassified 3851
22 Ga0070675_100115119 3300005354 Unclassified 2279
23 Ga0070671_100243679 3300005355 Bacteria 1526
24 Ga0070671_100244734 3300005355 Bacteria 1523
25 Ga0070671_100678828 3300005355 Bacteria 893
26 Ga0070659_100077391 3300005366 Bacteria 2653
27 Ga0070667_100338386 3300005367 Unclassified 1360
28 Ga0070714_100076876 3300005435 Bacteria 2899
29 Ga0070714_100614023 3300005435 Bacteria 1045
30 Ga0070714_101102382 3300005435 Bacteria 773
31 Ga0070713_100002052 3300005436 Bacteria 13018
32 Ga0070713_100434259 3300005436 Bacteria 1231
33 Ga0070713_100789638 3300005436 Bacteria 910
34 Ga0070713_101156305 3300005436 Unclassified 749
35 Ga0070711_100500610 3300005439 Unclassified 1001
36 Ga0070700_100652652 3300005441 Unclassified 831
37 Ga0070708_100083727 3300005445 Bacteria 2892
38 Ga0070708_100215575 3300005445 Unclassified 1799
39 Ga0070708_100302324 3300005445 Unclassified 1506
40 Ga0070681_10064516 3300005458 Bacteria 3632
41 Ga0068867_100275629 3300005459 Unclassified 1377
42 Ga0070685_10053453 3300005466 Unclassified 2340
43 Ga0070706_100058608 3300005467 Bacteria 3553
44 Ga0070707_100463142 3300005468 Bacteria 1229
45 Ga0070699_100036989 3300005518 Bacteria 4223
46 Ga0070699_100840006 3300005518 Bacteria 841
47 Ga0070679_100171689 3300005530 Bacteria 2141
48 Ga0070679_100460766 3300005530 Bacteria 1216
49 Ga0070684_100112059 3300005535 Bacteria 2447
50 Ga0070684_100215271 3300005535 Unclassified 1752
51 Ga0070684_100884676 3300005535 Bacteria 836
52 Ga0070697_100290803 3300005536 Bacteria 1403
53 Ga0070697_100598272 3300005536 Bacteria 969
54 Ga0068853_100000389 3300005539 Bacteria 30055
55 Ga0068853_100123756 3300005539 Bacteria 2309
56 Ga0070672_100041991 3300005543 Bacteria 3519
57 Ga0070696_100400970 3300005546 Bacteria 1073
58 Ga0070693_100123100 3300005547 Bacteria 1611
59 Ga0070693_100694033 3300005547 Unclassified 744
60 Ga0070665_100004179 3300005548 Bacteria 15183
61 Ga0070665_100067997 3300005548 Unclassified 3572
62 Ga0070704_100527562 3300005549 Unclassified 1029
63 Ga0068855_100008696 3300005563 Bacteria 12274
64 Ga0068855_100015423 3300005563 Bacteria 9198
65 Ga0068855_100017682 3300005563 Bacteria 8574
66 Ga0068855_100030773 3300005563 Bacteria 6417
67 Ga0068855_100060922 3300005563 Bacteria 4410
68 Ga0068855_100201727 3300005563 Bacteria 2239
69 Ga0068855_100829487 3300005563 Unclassified 981
70 Ga0068855_100990574 3300005563 Unclassified 884
71 Ga0070664_100036094 3300005564 Bacteria 4152
72 Ga0070664_100083092 3300005564 Bacteria 2763
73 Ga0070664_100284363 3300005564 Unclassified 1492
74 Ga0068857_100407776 3300005577 Bacteria 1265
75 Ga0068857_100719916 3300005577 Bacteria 949
76 Ga0068854_100045088 3300005578 Bacteria 3134
77 Ga0068856_100002276 3300005614 Bacteria 19807
78 Ga0068856_100016784 3300005614 Bacteria 7095
79 Ga0068856_100076325 3300005614 Bacteria 3320
80 Ga0068856_100308673 3300005614 Bacteria 1599
81 Ga0068856_100376043 3300005614 Bacteria 1439
82 Ga0068852_100000028 3300005616 Bacteria 113383
83 Ga0068852_100002690 3300005616 Bacteria 12278
84 Ga0068859_100177817 3300005617 Unclassified 2210
85 Ga0068864_100022314 3300005618 Bacteria 5307
86 Ga0068851_10117162 3300005834 Bacteria 1428
87 Ga0068863_100010471 3300005841 Bacteria 9014
88 Ga0068863_100056887 3300005841 Bacteria 3702
89 Ga0068858_100099497 3300005842 Bacteria 2711
90 Ga0068860_100019612 3300005843 Bacteria 6558
91 Ga0068862_100022170 3300005844 Bacteria 5314
92 Ga0081455_10340684 3300005937 Unclassified 1061
93 Ga0070717_10007402 3300006028 Bacteria 8151
94 Ga0070717_10012466 3300006028 Bacteria 6483
95 Ga0070717_10664374 3300006028 Bacteria 946
96 Ga0070717_10706193 3300006028 Unclassified 916
97 Ga0070716_100310498 3300006173 Bacteria 1101
98 Ga0097621_100002055 3300006237 Bacteria 13767
99 Ga0097621_100092902 3300006237 Unclassified 2528
100 Ga0097621_100971546 3300006237 Bacteria 794
101 Ga0068871_100036502 3300006358 Unclassified 3913
102 Ga0068871_100050640 3300006358 Bacteria 3360
103 Ga0068871_100088809 3300006358 Bacteria 2572
104 Ga0068871_100306399 3300006358 Unclassified 1395
105 Ga0068871_100316701 3300006358 Unclassified 1373
106 Ga0075434_100150743 3300006871 Bacteria 2346
107 Ga0075436_100140545 3300006914 Bacteria 1697
108 Ga0097620_100177829 3300006931 Unclassified 2210
109 Ga0075435_100690501 3300007076 Bacteria 887
110 Ga0099794_10134064 3300007265 Bacteria 1252
111 Ga0105240_10000499 3300009093 Bacteria 72315
112 Ga0105240_10011560 3300009093 Bacteria 12284
113 Ga0105240_10025804 3300009093 Bacteria 7717
114 Ga0105240_10029267 3300009093 Bacteria 7180
115 Ga0105240_10042942 3300009093 Bacteria 5759
116 Ga0105240_10065554 3300009093 Bacteria 4508
117 Ga0105240_10075115 3300009093 Bacteria 4169
118 Ga0105240_10302234 3300009093 Bacteria 1830
119 Ga0105240_10347954 3300009093 Bacteria 1682
120 Ga0105240_10743068 3300009093 Unclassified 1067
121 Ga0105240_10996396 3300009093 Unclassified 896
122 Ga0111539_11473703 3300009094 Bacteria 789
123 Ga0105245_10008733 3300009098 Bacteria 8837
124 Ga0114129_10357215 3300009147 Bacteria 1934
125 Ga0105241_10000162 3300009174 Bacteria 48662
126 Ga0105241_10007698 3300009174 Bacteria 7920
127 Ga0105241_10011464 3300009174 Bacteria 6498
128 Ga0105241_10174639 3300009174 Unclassified 1777
129 Ga0105241_10589132 3300009174 Unclassified 1003
130 Ga0105242_10033515 3300009176 Bacteria 4112
131 Ga0105242_10034813 3300009176 Bacteria 4038
132 Ga0105242_10071063 3300009176 Unclassified 2887
133 Ga0105248_10002940 3300009177 Bacteria 18909
134 Ga0105248_10017141 3300009177 Bacteria 7980
135 Ga0105248_10390656 3300009177 Bacteria 1566
136 Ga0105248_10582158 3300009177 Unclassified 1263
137 Ga0105248_10624089 3300009177 Unclassified 1216
138 Ga0105237_10001188 3300009545 Bacteria 34842
139 Ga0105237_10005789 3300009545 Bacteria 13875
140 Ga0105237_10139281 3300009545 Bacteria 2421
141 Ga0105238_10000373 3300009551 Bacteria 48142
142 Ga0105238_10004314 3300009551 Bacteria 14106
143 Ga0105238_10007350 3300009551 Bacteria 11029
144 Ga0105238_10042073 3300009551 Bacteria 4626
145 Ga0105238_10268114 3300009551 Unclassified 1688
146 Ga0105238_10348521 3300009551 Bacteria 1470
147 Ga0105238_10396355 3300009551 Bacteria 1373
148 Ga0105238_10561251 3300009551 Bacteria 1147
149 Ga0105249_10039288 3300009553 Bacteria 4296
150 Ga0105249_10088514 3300009553 Bacteria 2892
151 Ga0105249_10171754 3300009553 Bacteria 2103
152 Ga0099796_10279381 3300010159 Unclassified 702
153 Ga0105239_10000774 3300010375 Bacteria 45307
154 Ga0105239_10002768 3300010375 Bacteria 21990
155 Ga0105239_10370773 3300010375 Bacteria 1618
156 Ga0105239_10643758 3300010375 Bacteria 1210
157 Ga0105246_10003461 3300011119 Bacteria 9569
158 Ga0157373_10082873 3300013100 Bacteria 2260
159 Ga0157373_10204846 3300013100 Bacteria 1391
160 Ga0157373_10593866 3300013100 Bacteria 806
161 Ga0157373_10712214 3300013100 Bacteria 736
162 Ga0157370_10000551 3300013104 Bacteria 46757
163 Ga0157370_10064231 3300013104 Unclassified 3476
164 Ga0157370_10766484 3300013104 Unclassified 879
165 Ga0157369_10003839 3300013105 Bacteria 17854
166 Ga0157369_10007839 3300013105 Bacteria 12284
167 Ga0157369_10015425 3300013105 Bacteria 8611
168 Ga0157369_10030078 3300013105 Bacteria 5993
169 Ga0157369_10044951 3300013105 Unclassified 4805
170 Ga0157369_10108506 3300013105 Bacteria 2952
171 Ga0157369_10418142 3300013105 Bacteria 1390
172 Ga0157369_10853526 3300013105 Unclassified 935
173 Ga0157374_10016347 3300013296 Bacteria 6518
174 Ga0157374_10023970 3300013296 Bacteria 5465
175 Ga0157374_10074553 3300013296 Bacteria 3205
176 Ga0157374_10116240 3300013296 Unclassified 2577
177 Ga0157374_10708799 3300013296 Unclassified 1020
178 Ga0157378_10016783 3300013297 Bacteria 6416
179 Ga0157378_10032514 3300013297 Unclassified 4609
180 Ga0157378_10379873 3300013297 Bacteria 1387
181 Ga0163162_10024673 3300013306 Bacteria 5938
182 Ga0163162_10058550 3300013306 Unclassified 3882
183 Ga0163162_10141803 3300013306 Bacteria 2517
184 Ga0163162_10259429 3300013306 Bacteria 1870
185 Ga0157372_10005803 3300013307 Bacteria 13149
186 Ga0157372_10006668 3300013307 Bacteria 12284
187 Ga0157372_10010703 3300013307 Bacteria 9761
188 Ga0157372_10014027 3300013307 Bacteria 8562
189 Ga0157372_10047024 3300013307 Bacteria 4792
190 Ga0157372_10063009 3300013307 Bacteria 4156
191 Ga0157372_10116382 3300013307 Unclassified 3065
192 Ga0157372_10415637 3300013307 Bacteria 1567
193 Ga0157375_10214497 3300013308 Bacteria 2083
194 Ga0157375_10285207 3300013308 Unclassified 1814
195 Ga0163163_10017078 3300014325 Bacteria 6760
196 Ga0163163_10032735 3300014325 Bacteria 5023
197 Ga0157380_10810029 3300014326 Unclassified 954
198 Ga0157377_10033415 3300014745 Bacteria 2808
199 Ga0157379_10163555 3300014968 Bacteria 2009
200 Ga0157379_10788960 3300014968 Bacteria 896
201 Ga0157379_11327067 3300014968 Unclassified 695
202 Ga0157376_10045790 3300014969 Unclassified 3604
203 Ga0213874_10038429 3300021377 Bacteria 1421
204 Ga0213876_10100797 3300021384 Bacteria 1531
205 Ga0207692_10385213 3300025898 Bacteria 871
206 Ga0207710_10540326 3300025900 Bacteria 607
207 Ga0207680_10368433 3300025903 Bacteria 1011
208 Ga0207680_10733382 3300025903 Unclassified 708
209 Ga0207647_10102334 3300025904 Bacteria 1699
210 Ga0207699_10279718 3300025906 Unclassified 1159
211 Ga0207705_10137292 3300025909 Bacteria 1824
212 Ga0207684_10170016 3300025910 Bacteria 1879
213 Ga0207654_10000199 3300025911 Bacteria 37066
214 Ga0207654_10000895 3300025911 Bacteria 16506
215 Ga0207654_10068570 3300025911 Unclassified 2099
216 Ga0207654_10382050 3300025911 Unclassified 976
217 Ga0207654_10757775 3300025911 Unclassified 700
218 Ga0207707_10028131 3300025912 Bacteria 4914
219 Ga0207707_10079823 3300025912 Bacteria 2857
220 Ga0207695_10000140 3300025913 Bacteria 216271
221 Ga0207695_10000598 3300025913 Bacteria 72240
222 Ga0207695_10003747 3300025913 Bacteria 21137
223 Ga0207695_10006234 3300025913 Bacteria 15533
224 Ga0207695_10009144 3300025913 Bacteria 12296
225 Ga0207695_10027625 3300025913 Bacteria 6314
226 Ga0207695_10050325 3300025913 Bacteria 4384
227 Ga0207695_10059352 3300025913 Bacteria 3967
228 Ga0207695_10070209 3300025913 Bacteria 3582
229 Ga0207695_10244346 3300025913 Bacteria 1695
230 Ga0207671_10000238 3300025914 Bacteria 82806
231 Ga0207671_10021522 3300025914 Bacteria 4889
232 Ga0207671_10083537 3300025914 Bacteria 2397
233 Ga0207671_10208312 3300025914 Unclassified 1529
234 Ga0207693_10094815 3300025915 Unclassified 2339
235 Ga0207693_10398528 3300025915 Bacteria 1076
236 Ga0207663_10091672 3300025916 Bacteria 2018
237 Ga0207657_10016644 3300025919 Bacteria 7084
238 Ga0207657_10111521 3300025919 Bacteria 2258
239 Ga0207657_10148791 3300025919 Unclassified 1908
240 Ga0207649_10005989 3300025920 Bacteria 6600
241 Ga0207649_10010222 3300025920 Bacteria 5152
242 Ga0207649_10027404 3300025920 Bacteria 3342
243 Ga0207652_10093605 3300025921 Bacteria 2644
244 Ga0207652_10414776 3300025921 Unclassified 1214
245 Ga0207646_10531634 3300025922 Unclassified 1058
246 Ga0207646_10738136 3300025922 Bacteria 879
247 Ga0207694_10000089 3300025924 Bacteria 103520
248 Ga0207694_10010521 3300025924 Bacteria 6979
249 Ga0207694_10133418 3300025924 Bacteria 1992
250 Ga0207694_10408270 3300025924 Unclassified 1130
251 Ga0207650_10366431 3300025925 Unclassified 1188
252 Ga0207687_10049294 3300025927 Unclassified 2928
253 Ga0207687_10094432 3300025927 Bacteria 2189
254 Ga0207700_10007625 3300025928 Bacteria 6639
255 Ga0207700_11034987 3300025928 Bacteria 734
256 Ga0207664_10097944 3300025929 Bacteria 2417
257 Ga0207664_10207992 3300025929 Bacteria 1692
258 Ga0207644_10100681 3300025931 Bacteria 2170
259 Ga0207644_10555685 3300025931 Bacteria 950
260 Ga0207690_10080188 3300025932 Bacteria 2277
261 Ga0207690_10164842 3300025932 Bacteria 1655
262 Ga0207686_10172529 3300025934 Bacteria 1526
263 Ga0207709_10508780 3300025935 Unclassified 941
264 Ga0207665_10027767 3300025939 Bacteria 3739
265 Ga0207665_10177772 3300025939 Bacteria 1540
266 Ga0207665_10626344 3300025939 Bacteria 842
267 Ga0207711_10011350 3300025941 Bacteria 7401
268 Ga0207711_10276489 3300025941 Unclassified 1546
269 Ga0207711_10876909 3300025941 Unclassified 835
270 Ga0207689_10016215 3300025942 Bacteria 6310
271 Ga0207661_10420771 3300025944 Unclassified 1213
272 Ga0207661_10582042 3300025944 Bacteria 1027
273 Ga0207661_10762629 3300025944 Bacteria 891
274 Ga0207679_10117883 3300025945 Bacteria 2107
275 Ga0207667_10003663 3300025949 Bacteria 18947
276 Ga0207667_10015492 3300025949 Bacteria 8655
277 Ga0207667_10024692 3300025949 Bacteria 6593
278 Ga0207667_10268997 3300025949 Bacteria 1742
279 Ga0207667_10483402 3300025949 Unclassified 1257
280 Ga0207712_10149745 3300025961 Bacteria 1801
281 Ga0207640_10005029 3300025981 Bacteria 7193
282 Ga0207677_10117985 3300026023 Bacteria 1990
283 Ga0207703_10626090 3300026035 Unclassified 1019
284 Ga0207639_10000103 3300026041 Bacteria 70103
285 Ga0207639_10350905 3300026041 Bacteria 1318
286 Ga0207702_10000476 3300026078 Bacteria 45021
287 Ga0207702_10056874 3300026078 Bacteria 3322
288 Ga0207702_10082161 3300026078 Unclassified 2801
289 Ga0207702_10162907 3300026078 Bacteria 2038
290 Ga0207702_10217070 3300026078 Bacteria 1781
291 Ga0207641_10043481 3300026088 Bacteria 3773
292 Ga0207641_10189111 3300026088 Unclassified 1891
293 Ga0207641_10532668 3300026088 Bacteria 1144
294 Ga0207641_10966959 3300026088 Unclassified 847
295 Ga0207648_10195419 3300026089 Bacteria 1794
296 Ga0207674_10033118 3300026116 Bacteria 5411
297 Ga0207674_10257727 3300026116 Bacteria 1691
298 Ga0207683_11264264 3300026121 Unclassified 684
299 Ga0207698_10000384 3300026142 Bacteria 25551
300 Ga0207698_10000478 3300026142 Bacteria 23262
301 Ga0207698_10701802 3300026142 Bacteria 1007
302 Ga0207698_10705369 3300026142 Bacteria 1004
303 Ga0207698_10934886 3300026142 Bacteria 875
304 Ga0268266_10005700 3300028379 Bacteria 11547
305 Ga0268266_10009337 3300028379 Bacteria 8645
306 Ga0268266_10104666 3300028379 Unclassified 2499
307 Ga0268266_10422850 3300028379 Bacteria 1263
308 Ga0268265_10060108 3300028380 Bacteria 2911
309 Ga0268264_10002796 3300028381 Bacteria 15247
310 Ga0268264_10366970 3300028381 Bacteria 1375
311 Ga0265338_10005935 3300028800 Bacteria 15731
312 Ga0265330_10003108 3300031235 Bacteria 8790
313 Ga0265325_10014967 3300031241 Bacteria 4372
314 Ga0265340_10013862 3300031247 Bacteria 4224
315 Ga0265340_10033712 3300031247 Unclassified 2548
316 Ga0265339_10000115 3300031249 Bacteria 65607
317 Ga0265316_10000483 3300031344 Bacteria 45211
318 Ga0265316_10011046 3300031344 Bacteria 8183
319 Ga0265313_10014671 3300031595 Bacteria 4615
320 Ga0265314_10005286 3300031711 Bacteria 11686
321 Ga0265342_10003593 3300031712 Bacteria 12653
322 Ga0373934_0029018 3300035086 Bacteria 2159
323 Ga0373936_0287543 3300035113 Unclassified 740
324 Ga0373954_0002366 3300035118 Bacteria 7883
325 Ga0373937_0018848 3300036401 Bacteria 6170
326 Ga0373937_0131977 3300036401 Unclassified 2333
327 Ga0373937_0203395 3300036401 Unclassified 1862
328 Ga0373925_0509378 3300037068 Bacteria 988
329 Ga0395900_0988160 3300037418 Unclassified 762
330 Ga0395905_1033671 3300037471 Bacteria 725
331 Ga0436364_0431530 3300037853 Bacteria 1340
332 Ga0436364_0652936 3300037853 Bacteria 2313
333 Ga0436364_0664343 3300037853 Bacteria 1302
334 Ga0436364_0689426 3300037853 Unclassified 1623
335 Ga0436364_1409782 3300037853 Bacteria 1389
336 Ga0395901_0479660 3300038443 Bacteria 1269
337 Ga0436365_0840158 3300039437 Unclassified 1022
338 Ga0436365_1012460 3300039437 Bacteria 3299
339 Ga0436363_0548304 3300039450 Unclassified 2246
340 Ga0436363_0616505 3300039450 Bacteria 1041
341 Ga0436363_0928621 3300039450 Bacteria 1243
342 Ga0436363_1669288 3300039450 Bacteria 3169
343 Ga0436362_0502258 3300039453 Bacteria 1557
344 Ga0466969_0010407 3300044656 Bacteria 4931
345 Ga0466961_0073960 3300044693 Bacteria 2161
346 Ga0466961_0346133 3300044693 Unclassified 905
347 Ga0466959_0105907 3300045049 Unclassified 2011
348 Ga0466959_0112983 3300045049 Bacteria 1937
349 Ga0466959_0246305 3300045049 Bacteria 1233
350 Ga0466959_0288680 3300045049 Unclassified 1125
351 Ga0466967_0088177 3300045976 Bacteria 2815
352 Ga0466967_0794303 3300045976 Unclassified 940
353 Ga0466967_1003725 3300045976 Bacteria 831
354 Ga0495580_0148865 3300046472 Bacteria 1622
355 Ga0495580_0307649 3300046472 Bacteria 1078
356 Ga0495582_0168196 3300046473 Unclassified 1248
357 Ga0495664_0092329 3300046477 Bacteria 1821
358 Ga0495583_0015467 3300046506 Bacteria 4148
359 Ga0495630_0229486 3300046517 Bacteria 1418
360 Ga0495587_0087732 3300046536 Unclassified 1800
361 Ga0495645_0159360 3300046543 Unclassified 1561
362 Ga0495659_0190159 3300046664 Bacteria 839
363 Ga0495623_0146466 3300046679 Unclassified 1400
364 Ga0495669_0238500 3300046684 Bacteria 873
365 Ga0495649_0034599 3300046694 Bacteria 2780
366 Ga0495674_0210794 3300047319 Bacteria 1609
367 Ga0495680_0055464 3300047322 Unclassified 3074
368 Ga0495675_0067335 3300047444 Unclassified 2263
369 Ga0495602_0179302 3300048088 Bacteria 1636
370 Ga0496107_1002715 3300048910 Unclassified 606
371 Ga0496109_0639478 3300048912 Unclassified 1001
372 Ga0496112_0030904 3300048915 Bacteria 5189
373 Ga0496112_0129860 3300048915 Bacteria 2491
374 Ga0496112_0794540 3300048915 Unclassified 871
375 Ga0496113_0551288 3300048916 Unclassified 925
376 Ga0496115_0341216 3300048918 Bacteria 1223
377 Ga0501031_0069011 3300049568 Bacteria 2302
378 Ga0501032_0005694 3300049569 Bacteria 9227
379 Ga0501033_0016470 3300049570 Bacteria 5599
380 Ga0501034_0032539 3300049571 Bacteria 5294
381 Ga0501034_0107538 3300049571 Bacteria 2781
382 Ga0501036_0002362 3300049572 Bacteria 14758
383 Ga0501037_0098611 3300049573 Bacteria 2110
384 Ga0501037_0531684 3300049573 Unclassified 795
385 Ga0501038_0001714 3300049574 Bacteria 20367
386 Ga0501039_0026679 3300049575 Bacteria 4440
387 Ga0501043_0001558 3300049579 Bacteria 19956
388 Ga0501046_0017839 3300049580 Bacteria 5918
389 Ga0501046_0139341 3300049580 Bacteria 1837
390 Ga0501046_0556477 3300049580 Unclassified 817
391 Ga0501047_0030142 3300049581 Bacteria 5231
392 Ga0501047_0038439 3300049581 Bacteria 4630
393 Ga0501047_0073647 3300049581 Unclassified 3288
394 Ga0501048_0032174 3300049582 Bacteria 3792
395 Ga0501067_0003293 3300049583 Bacteria 8885
396 Ga0501068_0003742 3300049584 Bacteria 8229
397 Ga0501069_0001370 3300049585 Bacteria 11959
398 Ga0501070_0006167 3300049586 Bacteria 10216
399 Ga0501070_0065249 3300049586 Unclassified 3014
400 Ga0501070_0247561 3300049586 Unclassified 1458
401 Ga0501072_0437121 3300049588 Unclassified 1036
402 Ga0501073_0014857 3300049589 Bacteria 5650
403 Ga0501074_0016298 3300049590 Bacteria 5395
404 Ga0501076_0075402 3300049592 Bacteria 2703
405 Ga0501077_0038685 3300049593 Bacteria 3038
406 Ga0501079_0039504 3300049741 Bacteria 3639
407 Ga0501080_0002238 3300049742 Bacteria 16814
408 Ga0501083_0037014 3300049744 Bacteria 3325
409 Ga0501035_0093966 3300049822 Bacteria 2637
410 Ga0501044_0001033 3300049823 Bacteria 33524
411 Ga0501044_0015346 3300049823 Bacteria 8249
412 Ga0501044_0187134 3300049823 Bacteria 2035
413 nmdc:mga05p37_312819_c1 3300050507 Bacteria 1861
414 nmdc:mga08y16_1562744_c1 3300050511 Unclassified 618
415 nmdc:mga0n895_420573_c1 3300050512 Unclassified 1351
416 nmdc:mga0n895_994206_c1 3300050512 Bacteria 820
417 nmdc:mga08x19_37414_c1 3300050514 Bacteria 3079
418 nmdc:mga08x19_498157_c1 3300050514 Unclassified 860
419 Ga0495619_0222029 3300053085 Bacteria 1309
420 Ga0501082_0003190 3300060353 Bacteria 14302

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005547 Ga0070693_100694033 Ga0070693_1006940331 185
2 3300044693 Ga0466961_0073960 Ga0466961_0073960_1441_2001 186
3 3300045049 Ga0466959_0112983 Ga0466959_0112983_796_1356 186
4 3300045976 Ga0466967_1003725 Ga0466967_1003725_190_750 186
5 3300048915 Ga0496112_0129860 Ga0496112_0129860_170_730 186
6 3300005336 Ga0070680_100974639 Ga0070680_1009746391 187
7 3300005355 Ga0070671_100678828 Ga0070671_1006788281 187
8 3300005535 Ga0070684_100215271 Ga0070684_1002152712 187
9 3300005564 Ga0070664_100284363 Ga0070664_1002843632 187
10 3300048916 Ga0496113_0551288 Ga0496113_0551288_84_647 187
11 3300005329 Ga0070683_100547380 Ga0070683_1005473802 188
12 3300005435 Ga0070714_100076876 Ga0070714_1000768763 188
13 3300005435 Ga0070714_101102382 Ga0070714_1011023821 188
14 3300005436 Ga0070713_101156305 Ga0070713_1011563051 188
15 3300005445 Ga0070708_100215575 Ga0070708_1002155752 188
16 3300005458 Ga0070681_10064516 Ga0070681_100645164 188
17 3300005518 Ga0070699_100840006 Ga0070699_1008400062 188
18 3300005530 Ga0070679_100171689 Ga0070679_1001716893 188
19 3300005536 Ga0070697_100598272 Ga0070697_1005982721 188
20 3300005563 Ga0068855_100201727 Ga0068855_1002017273 188
21 3300006173 Ga0070716_100310498 Ga0070716_1003104981 188
22 3300007076 Ga0075435_100690501 Ga0075435_1006905011 188
23 3300009093 Ga0105240_10029267 Ga0105240_100292674 188
24 3300009177 Ga0105248_10390656 Ga0105248_103906561 188
25 3300009177 Ga0105248_10582158 Ga0105248_105821582 188
26 3300009551 Ga0105238_10348521 Ga0105238_103485213 188
27 3300013105 Ga0157369_10853526 Ga0157369_108535262 188
28 3300013296 Ga0157374_10708799 Ga0157374_107087992 188
29 3300014968 Ga0157379_10788960 Ga0157379_107889601 188
30 3300025912 Ga0207707_10079823 Ga0207707_100798232 188
31 3300025913 Ga0207695_10027625 Ga0207695_100276255 188
32 3300025913 Ga0207695_10244346 Ga0207695_102443462 188
33 3300025915 Ga0207693_10398528 Ga0207693_103985282 188
34 3300025916 Ga0207663_10091672 Ga0207663_100916724 188
35 3300025919 Ga0207657_10148791 Ga0207657_101487912 188
36 3300025921 Ga0207652_10414776 Ga0207652_104147762 188
37 3300025922 Ga0207646_10738136 Ga0207646_107381361 188
38 3300025929 Ga0207664_10207992 Ga0207664_102079921 188
39 3300025939 Ga0207665_10027767 Ga0207665_100277673 188
40 3300025939 Ga0207665_10626344 Ga0207665_106263442 188
41 3300025944 Ga0207661_10582042 Ga0207661_105820422 188
42 3300025949 Ga0207667_10268997 Ga0207667_102689972 188
43 3300026088 Ga0207641_10532668 Ga0207641_105326681 188
44 3300028381 Ga0268264_10366970 Ga0268264_103669701 188
45 3300035113 Ga0373936_0287543 Ga0373936_0287543_25_711 188
46 3300037853 Ga0436364_0431530 Ga0436364_0431530_234_800 188
47 3300037853 Ga0436364_1409782 Ga0436364_1409782_694_1260 188
48 3300039450 Ga0436363_0548304 Ga0436363_0548304_1617_2183 188
49 3300039450 Ga0436363_0616505 Ga0436363_0616505_405_1010 188
50 3300039450 Ga0436363_0928621 Ga0436363_0928621_150_716 188
51 3300045049 Ga0466959_0288680 Ga0466959_0288680_484_1086 188
52 3300046472 Ga0495580_0148865 Ga0495580_0148865_587_1336 188
53 3300048915 Ga0496112_0794540 Ga0496112_0794540_41_607 188
54 3300050512 nmdc:mga0n895_994206_c1 nmdc:mga0n895_994206_c1_230_796 188
55 3300053085 Ga0495619_0222029 Ga0495619_0222029_484_1050 188
56 3300003322 rootL2_10372676 rootL2_103726762 189
57 3300003323 rootH1_10230584 rootH1_102305841 189
58 3300005327 Ga0070658_10102300 Ga0070658_101023001 189
59 3300005327 Ga0070658_10477940 Ga0070658_104779402 189
60 3300005329 Ga0070683_100267385 Ga0070683_1002673852 189
61 3300005330 Ga0070690_100463539 Ga0070690_1004635392 189
62 3300005331 Ga0070670_100063387 Ga0070670_1000633871 189
63 3300005331 Ga0070670_100417759 Ga0070670_1004177592 189
64 3300005334 Ga0068869_100027562 Ga0068869_1000275623 189
65 3300005335 Ga0070666_10126123 Ga0070666_101261231 189
66 3300005336 Ga0070680_100200931 Ga0070680_1002009312 189
67 3300005337 Ga0070682_100195483 Ga0070682_1001954832 189
68 3300005338 Ga0068868_100110678 Ga0068868_1001106782 189
69 3300005339 Ga0070660_100011747 Ga0070660_1000117474 189
70 3300005339 Ga0070660_100098024 Ga0070660_1000980241 189
71 3300005341 Ga0070691_10180858 Ga0070691_101808581 189
72 3300005344 Ga0070661_100001452 Ga0070661_1000014525 189
73 3300005344 Ga0070661_100007067 Ga0070661_1000070679 189
74 3300005344 Ga0070661_100031221 Ga0070661_1000312212 189
75 3300005354 Ga0070675_100115119 Ga0070675_1001151192 189
76 3300005355 Ga0070671_100243679 Ga0070671_1002436792 189
77 3300005355 Ga0070671_100244734 Ga0070671_1002447342 189
78 3300005366 Ga0070659_100077391 Ga0070659_1000773912 189
79 3300005367 Ga0070667_100338386 Ga0070667_1003383862 189
80 3300005435 Ga0070714_100614023 Ga0070714_1006140232 189
81 3300005436 Ga0070713_100002052 Ga0070713_1000020528 189
82 3300005436 Ga0070713_100434259 Ga0070713_1004342592 189
83 3300005436 Ga0070713_100789638 Ga0070713_1007896381 189
84 3300005439 Ga0070711_100500610 Ga0070711_1005006101 189
85 3300005441 Ga0070700_100652652 Ga0070700_1006526521 189
86 3300005445 Ga0070708_100083727 Ga0070708_1000837274 189
87 3300005445 Ga0070708_100302324 Ga0070708_1003023241 189
88 3300005459 Ga0068867_100275629 Ga0068867_1002756292 189
89 3300005466 Ga0070685_10053453 Ga0070685_100534533 189
90 3300005467 Ga0070706_100058608 Ga0070706_1000586087 189
91 3300005468 Ga0070707_100463142 Ga0070707_1004631422 189
92 3300005518 Ga0070699_100036989 Ga0070699_1000369893 189
93 3300005530 Ga0070679_100460766 Ga0070679_1004607662 189
94 3300005535 Ga0070684_100112059 Ga0070684_1001120592 189
95 3300005535 Ga0070684_100884676 Ga0070684_1008846762 189
96 3300005536 Ga0070697_100290803 Ga0070697_1002908032 189
97 3300005539 Ga0068853_100000389 Ga0068853_10000038914 189
98 3300005539 Ga0068853_100123756 Ga0068853_1001237562 189
99 3300005543 Ga0070672_100041991 Ga0070672_1000419914 189
100 3300005546 Ga0070696_100400970 Ga0070696_1004009702 189
101 3300005547 Ga0070693_100123100 Ga0070693_1001231001 189
102 3300005548 Ga0070665_100004179 Ga0070665_1000041795 189
103 3300005548 Ga0070665_100067997 Ga0070665_1000679975 189
104 3300005549 Ga0070704_100527562 Ga0070704_1005275622 189
105 3300005563 Ga0068855_100008696 Ga0068855_1000086961 189
106 3300005563 Ga0068855_100015423 Ga0068855_1000154234 189
107 3300005563 Ga0068855_100017682 Ga0068855_1000176826 189
108 3300005563 Ga0068855_100030773 Ga0068855_1000307734 189
109 3300005563 Ga0068855_100060922 Ga0068855_1000609222 189
110 3300005563 Ga0068855_100829487 Ga0068855_1008294872 189
111 3300005563 Ga0068855_100990574 Ga0068855_1009905741 189
112 3300005564 Ga0070664_100036094 Ga0070664_1000360947 189
113 3300005564 Ga0070664_100083092 Ga0070664_1000830922 189
114 3300005577 Ga0068857_100407776 Ga0068857_1004077762 189
115 3300005577 Ga0068857_100719916 Ga0068857_1007199162 189
116 3300005578 Ga0068854_100045088 Ga0068854_1000450883 189
117 3300005614 Ga0068856_100002276 Ga0068856_1000022762 189
118 3300005614 Ga0068856_100016784 Ga0068856_1000167844 189
119 3300005614 Ga0068856_100076325 Ga0068856_1000763254 189
120 3300005614 Ga0068856_100308673 Ga0068856_1003086732 189
121 3300005614 Ga0068856_100376043 Ga0068856_1003760431 189
122 3300005616 Ga0068852_100000028 Ga0068852_10000002873 189
123 3300005616 Ga0068852_100002690 Ga0068852_10000269011 189
124 3300005617 Ga0068859_100177817 Ga0068859_1001778173 189
125 3300005618 Ga0068864_100022314 Ga0068864_1000223143 189
126 3300005834 Ga0068851_10117162 Ga0068851_101171622 189
127 3300005841 Ga0068863_100010471 Ga0068863_1000104718 189
128 3300005841 Ga0068863_100056887 Ga0068863_1000568873 189
129 3300005842 Ga0068858_100099497 Ga0068858_1000994973 189
130 3300005843 Ga0068860_100019612 Ga0068860_1000196125 189
131 3300005844 Ga0068862_100022170 Ga0068862_1000221705 189
132 3300005937 Ga0081455_10340684 Ga0081455_103406841 189
133 3300006028 Ga0070717_10007402 Ga0070717_100074022 189
134 3300006028 Ga0070717_10012466 Ga0070717_100124663 189
135 3300006028 Ga0070717_10664374 Ga0070717_106643741 189
136 3300006028 Ga0070717_10706193 Ga0070717_107061932 189
137 3300006237 Ga0097621_100002055 Ga0097621_1000020552 189
138 3300006237 Ga0097621_100092902 Ga0097621_1000929022 189
139 3300006237 Ga0097621_100971546 Ga0097621_1009715461 189
140 3300006358 Ga0068871_100036502 Ga0068871_1000365023 189
141 3300006358 Ga0068871_100050640 Ga0068871_1000506404 189
142 3300006358 Ga0068871_100088809 Ga0068871_1000888094 189
143 3300006358 Ga0068871_100306399 Ga0068871_1003063992 189
144 3300006358 Ga0068871_100316701 Ga0068871_1003167012 189
145 3300006871 Ga0075434_100150743 Ga0075434_1001507433 189
146 3300006914 Ga0075436_100140545 Ga0075436_1001405453 189
147 3300006931 Ga0097620_100177829 Ga0097620_1001778293 189
148 3300007265 Ga0099794_10134064 Ga0099794_101340642 189
149 3300009093 Ga0105240_10000499 Ga0105240_1000049950 189
150 3300009093 Ga0105240_10011560 Ga0105240_100115601 189
151 3300009093 Ga0105240_10025804 Ga0105240_100258044 189
152 3300009093 Ga0105240_10042942 Ga0105240_100429424 189
153 3300009093 Ga0105240_10065554 Ga0105240_100655545 189
154 3300009093 Ga0105240_10075115 Ga0105240_100751153 189
155 3300009093 Ga0105240_10302234 Ga0105240_103022342 189
156 3300009093 Ga0105240_10347954 Ga0105240_103479541 189
157 3300009093 Ga0105240_10743068 Ga0105240_107430681 189
158 3300009093 Ga0105240_10996396 Ga0105240_109963961 189
159 3300009094 Ga0111539_11473703 Ga0111539_114737031 189
160 3300009098 Ga0105245_10008733 Ga0105245_100087335 189
161 3300009147 Ga0114129_10357215 Ga0114129_103572153 189
162 3300009174 Ga0105241_10000162 Ga0105241_1000016245 189
163 3300009174 Ga0105241_10007698 Ga0105241_100076988 189
164 3300009174 Ga0105241_10011464 Ga0105241_100114644 189
165 3300009174 Ga0105241_10174639 Ga0105241_101746391 189
166 3300009174 Ga0105241_10589132 Ga0105241_105891321 189
167 3300009176 Ga0105242_10033515 Ga0105242_100335156 189
168 3300009176 Ga0105242_10034813 Ga0105242_100348132 189
169 3300009176 Ga0105242_10071063 Ga0105242_100710634 189
170 3300009177 Ga0105248_10002940 Ga0105248_100029401 189
171 3300009177 Ga0105248_10017141 Ga0105248_100171414 189
172 3300009177 Ga0105248_10624089 Ga0105248_106240892 189
173 3300009545 Ga0105237_10001188 Ga0105237_1000118834 189
174 3300009545 Ga0105237_10005789 Ga0105237_100057899 189
175 3300009545 Ga0105237_10139281 Ga0105237_101392813 189
176 3300009551 Ga0105238_10000373 Ga0105238_100003737 189
177 3300009551 Ga0105238_10004314 Ga0105238_1000431411 189
178 3300009551 Ga0105238_10007350 Ga0105238_100073507 189
179 3300009551 Ga0105238_10042073 Ga0105238_100420734 189
180 3300009551 Ga0105238_10268114 Ga0105238_102681141 189
181 3300009551 Ga0105238_10396355 Ga0105238_103963552 189
182 3300009551 Ga0105238_10561251 Ga0105238_105612511 189
183 3300009553 Ga0105249_10039288 Ga0105249_100392883 189
184 3300009553 Ga0105249_10088514 Ga0105249_100885142 189
185 3300009553 Ga0105249_10171754 Ga0105249_101717541 189
186 3300010159 Ga0099796_10279381 Ga0099796_102793812 189
187 3300010375 Ga0105239_10000774 Ga0105239_1000077440 189
188 3300010375 Ga0105239_10002768 Ga0105239_1000276816 189
189 3300010375 Ga0105239_10370773 Ga0105239_103707733 189
190 3300010375 Ga0105239_10643758 Ga0105239_106437582 189
191 3300011119 Ga0105246_10003461 Ga0105246_100034611 189
192 3300013100 Ga0157373_10082873 Ga0157373_100828732 189
193 3300013100 Ga0157373_10204846 Ga0157373_102048461 189
194 3300013100 Ga0157373_10593866 Ga0157373_105938661 189
195 3300013100 Ga0157373_10712214 Ga0157373_107122142 189
196 3300013104 Ga0157370_10000551 Ga0157370_100005511 189
197 3300013104 Ga0157370_10064231 Ga0157370_100642313 189
198 3300013104 Ga0157370_10766484 Ga0157370_107664842 189
199 3300013105 Ga0157369_10003839 Ga0157369_100038397 189
200 3300013105 Ga0157369_10007839 Ga0157369_100078391 189
201 3300013105 Ga0157369_10015425 Ga0157369_100154256 189
202 3300013105 Ga0157369_10030078 Ga0157369_100300782 189
203 3300013105 Ga0157369_10044951 Ga0157369_100449514 189
204 3300013105 Ga0157369_10108506 Ga0157369_101085062 189
205 3300013105 Ga0157369_10418142 Ga0157369_104181422 189
206 3300013296 Ga0157374_10016347 Ga0157374_100163477 189
207 3300013296 Ga0157374_10023970 Ga0157374_100239703 189
208 3300013296 Ga0157374_10074553 Ga0157374_100745531 189
209 3300013296 Ga0157374_10116240 Ga0157374_101162402 189
210 3300013297 Ga0157378_10016783 Ga0157378_100167832 189
211 3300013297 Ga0157378_10032514 Ga0157378_100325144 189
212 3300013297 Ga0157378_10379873 Ga0157378_103798732 189
213 3300013306 Ga0163162_10024673 Ga0163162_100246733 189
214 3300013306 Ga0163162_10058550 Ga0163162_100585503 189
215 3300013306 Ga0163162_10141803 Ga0163162_101418033 189
216 3300013306 Ga0163162_10259429 Ga0163162_102594293 189
217 3300013307 Ga0157372_10005803 Ga0157372_100058036 189
218 3300013307 Ga0157372_10006668 Ga0157372_100066681 189
219 3300013307 Ga0157372_10010703 Ga0157372_100107039 189
220 3300013307 Ga0157372_10014027 Ga0157372_100140273 189
221 3300013307 Ga0157372_10047024 Ga0157372_100470242 189
222 3300013307 Ga0157372_10063009 Ga0157372_100630092 189
223 3300013307 Ga0157372_10116382 Ga0157372_101163823 189
224 3300013307 Ga0157372_10415637 Ga0157372_104156371 189
225 3300013308 Ga0157375_10214497 Ga0157375_102144973 189
226 3300013308 Ga0157375_10285207 Ga0157375_102852073 189
227 3300014325 Ga0163163_10017078 Ga0163163_100170783 189
228 3300014325 Ga0163163_10032735 Ga0163163_100327353 189
229 3300014326 Ga0157380_10810029 Ga0157380_108100291 189
230 3300014745 Ga0157377_10033415 Ga0157377_100334153 189
231 3300014968 Ga0157379_10163555 Ga0157379_101635553 189
232 3300014968 Ga0157379_11327067 Ga0157379_113270671 189
233 3300014969 Ga0157376_10045790 Ga0157376_100457903 189
234 3300021377 Ga0213874_10038429 Ga0213874_100384292 189
235 3300021384 Ga0213876_10100797 Ga0213876_101007973 189
236 3300025898 Ga0207692_10385213 Ga0207692_103852132 189
237 3300025900 Ga0207710_10540326 Ga0207710_105403261 189
238 3300025903 Ga0207680_10368433 Ga0207680_103684331 189
239 3300025903 Ga0207680_10733382 Ga0207680_107333821 189
240 3300025904 Ga0207647_10102334 Ga0207647_101023342 189
241 3300025906 Ga0207699_10279718 Ga0207699_102797182 189
242 3300025909 Ga0207705_10137292 Ga0207705_101372922 189
243 3300025910 Ga0207684_10170016 Ga0207684_101700162 189
244 3300025911 Ga0207654_10000199 Ga0207654_100001995 189
245 3300025911 Ga0207654_10000895 Ga0207654_1000089518 189
246 3300025911 Ga0207654_10068570 Ga0207654_100685703 189
247 3300025911 Ga0207654_10382050 Ga0207654_103820501 189
248 3300025911 Ga0207654_10757775 Ga0207654_107577751 189
249 3300025912 Ga0207707_10028131 Ga0207707_100281313 189
250 3300025913 Ga0207695_10000140 Ga0207695_10000140136 189
251 3300025913 Ga0207695_10000598 Ga0207695_1000059848 189
252 3300025913 Ga0207695_10003747 Ga0207695_100037475 189
253 3300025913 Ga0207695_10006234 Ga0207695_1000623410 189
254 3300025913 Ga0207695_10009144 Ga0207695_100091441 189
255 3300025913 Ga0207695_10050325 Ga0207695_100503253 189
256 3300025913 Ga0207695_10059352 Ga0207695_100593522 189
257 3300025913 Ga0207695_10070209 Ga0207695_100702092 189
258 3300025914 Ga0207671_10000238 Ga0207671_1000023841 189
259 3300025914 Ga0207671_10021522 Ga0207671_100215224 189
260 3300025914 Ga0207671_10083537 Ga0207671_100835372 189
261 3300025914 Ga0207671_10208312 Ga0207671_102083122 189
262 3300025915 Ga0207693_10094815 Ga0207693_100948152 189
263 3300025919 Ga0207657_10016644 Ga0207657_100166446 189
264 3300025919 Ga0207657_10111521 Ga0207657_101115211 189
265 3300025920 Ga0207649_10005989 Ga0207649_100059896 189
266 3300025920 Ga0207649_10010222 Ga0207649_100102223 189
267 3300025920 Ga0207649_10027404 Ga0207649_100274042 189
268 3300025921 Ga0207652_10093605 Ga0207652_100936052 189
269 3300025922 Ga0207646_10531634 Ga0207646_105316342 189
270 3300025924 Ga0207694_10000089 Ga0207694_1000008953 189
271 3300025924 Ga0207694_10010521 Ga0207694_100105213 189
272 3300025924 Ga0207694_10133418 Ga0207694_101334184 189
273 3300025924 Ga0207694_10408270 Ga0207694_104082701 189
274 3300025925 Ga0207650_10366431 Ga0207650_103664313 189
275 3300025927 Ga0207687_10049294 Ga0207687_100492943 189
276 3300025927 Ga0207687_10094432 Ga0207687_100944324 189
277 3300025928 Ga0207700_10007625 Ga0207700_100076254 189
278 3300025928 Ga0207700_11034987 Ga0207700_110349871 189
279 3300025929 Ga0207664_10097944 Ga0207664_100979443 189
280 3300025931 Ga0207644_10100681 Ga0207644_101006812 189
281 3300025931 Ga0207644_10555685 Ga0207644_105556852 189
282 3300025932 Ga0207690_10080188 Ga0207690_100801883 189
283 3300025932 Ga0207690_10164842 Ga0207690_101648422 189
284 3300025934 Ga0207686_10172529 Ga0207686_101725292 189
285 3300025935 Ga0207709_10508780 Ga0207709_105087802 189
286 3300025939 Ga0207665_10177772 Ga0207665_101777721 189
287 3300025941 Ga0207711_10011350 Ga0207711_100113505 189
288 3300025941 Ga0207711_10276489 Ga0207711_102764893 189
289 3300025941 Ga0207711_10876909 Ga0207711_108769091 189
290 3300025942 Ga0207689_10016215 Ga0207689_100162154 189
291 3300025944 Ga0207661_10420771 Ga0207661_104207711 189
292 3300025944 Ga0207661_10762629 Ga0207661_107626292 189
293 3300025945 Ga0207679_10117883 Ga0207679_101178832 189
294 3300025949 Ga0207667_10003663 Ga0207667_1000366314 189
295 3300025949 Ga0207667_10015492 Ga0207667_100154926 189
296 3300025949 Ga0207667_10024692 Ga0207667_100246926 189
297 3300025949 Ga0207667_10483402 Ga0207667_104834022 189
298 3300025961 Ga0207712_10149745 Ga0207712_101497452 189
299 3300025981 Ga0207640_10005029 Ga0207640_100050296 189
300 3300026023 Ga0207677_10117985 Ga0207677_101179853 189
301 3300026035 Ga0207703_10626090 Ga0207703_106260901 189
302 3300026041 Ga0207639_10000103 Ga0207639_1000010350 189
303 3300026041 Ga0207639_10350905 Ga0207639_103509052 189
304 3300026078 Ga0207702_10000476 Ga0207702_1000047641 189
305 3300026078 Ga0207702_10056874 Ga0207702_100568742 189
306 3300026078 Ga0207702_10082161 Ga0207702_100821612 189
307 3300026078 Ga0207702_10162907 Ga0207702_101629072 189
308 3300026078 Ga0207702_10217070 Ga0207702_102170703 189
309 3300026088 Ga0207641_10043481 Ga0207641_100434813 189
310 3300026088 Ga0207641_10189111 Ga0207641_101891113 189
311 3300026088 Ga0207641_10966959 Ga0207641_109669591 189
312 3300026089 Ga0207648_10195419 Ga0207648_101954193 189
313 3300026116 Ga0207674_10033118 Ga0207674_100331185 189
314 3300026116 Ga0207674_10257727 Ga0207674_102577272 189
315 3300026121 Ga0207683_11264264 Ga0207683_112642641 189
316 3300026142 Ga0207698_10000384 Ga0207698_1000038424 189
317 3300026142 Ga0207698_10000478 Ga0207698_1000047819 189
318 3300026142 Ga0207698_10701802 Ga0207698_107018022 189
319 3300026142 Ga0207698_10705369 Ga0207698_107053692 189
320 3300026142 Ga0207698_10934886 Ga0207698_109348862 189
321 3300028379 Ga0268266_10005700 Ga0268266_100057004 189
322 3300028379 Ga0268266_10009337 Ga0268266_100093379 189
323 3300028379 Ga0268266_10104666 Ga0268266_101046662 189
324 3300028379 Ga0268266_10422850 Ga0268266_104228502 189
325 3300028380 Ga0268265_10060108 Ga0268265_100601081 189
326 3300028381 Ga0268264_10002796 Ga0268264_100027962 189
327 3300028800 Ga0265338_10005935 Ga0265338_1000593511 189
328 3300031235 Ga0265330_10003108 Ga0265330_100031084 189
329 3300031241 Ga0265325_10014967 Ga0265325_100149671 189
330 3300031247 Ga0265340_10013862 Ga0265340_100138623 189
331 3300031247 Ga0265340_10033712 Ga0265340_100337123 189
332 3300031249 Ga0265339_10000115 Ga0265339_1000011516 189
333 3300031344 Ga0265316_10000483 Ga0265316_1000048331 189
334 3300031344 Ga0265316_10011046 Ga0265316_100110466 189
335 3300031595 Ga0265313_10014671 Ga0265313_100146713 189
336 3300031711 Ga0265314_10005286 Ga0265314_1000528610 189
337 3300031712 Ga0265342_10003593 Ga0265342_100035935 189
338 3300035086 Ga0373934_0029018 Ga0373934_0029018_1120_1791 189
339 3300035118 Ga0373954_0002366 Ga0373954_0002366_4611_5282 189
340 3300036401 Ga0373937_0018848 Ga0373937_0018848_81_752 189
341 3300036401 Ga0373937_0131977 Ga0373937_0131977_1239_1808 189
342 3300036401 Ga0373937_0203395 Ga0373937_0203395_1013_1681 189
343 3300037068 Ga0373925_0509378 Ga0373925_0509378_201_770 189
344 3300037418 Ga0395900_0988160 Ga0395900_0988160_113_682 189
345 3300037471 Ga0395905_1033671 Ga0395905_1033671_24_695 189
346 3300037853 Ga0436364_0652936 Ga0436364_0652936_1083_1652 189
347 3300037853 Ga0436364_0664343 Ga0436364_0664343_185_883 189
348 3300037853 Ga0436364_0689426 Ga0436364_0689426_519_1088 189
349 3300038443 Ga0395901_0479660 Ga0395901_0479660_41_610 189
350 3300039437 Ga0436365_0840158 Ga0436365_0840158_176_745 189
351 3300039437 Ga0436365_1012460 Ga0436365_1012460_2063_2632 189
352 3300039450 Ga0436363_1669288 Ga0436363_1669288_2465_3043 189
353 3300039453 Ga0436362_0502258 Ga0436362_0502258_787_1389 189
354 3300044656 Ga0466969_0010407 Ga0466969_0010407_4254_4865 189
355 3300044693 Ga0466961_0346133 Ga0466961_0346133_50_619 189
356 3300045049 Ga0466959_0105907 Ga0466959_0105907_506_1081 189
357 3300045049 Ga0466959_0246305 Ga0466959_0246305_392_964 189
358 3300045976 Ga0466967_0088177 Ga0466967_0088177_2146_2718 189
359 3300045976 Ga0466967_0794303 Ga0466967_0794303_31_600 189
360 3300046472 Ga0495580_0307649 Ga0495580_0307649_259_930 189
361 3300046473 Ga0495582_0168196 Ga0495582_0168196_143_748 189
362 3300046477 Ga0495664_0092329 Ga0495664_0092329_20_691 189
363 3300046506 Ga0495583_0015467 Ga0495583_0015467_2542_3111 189
364 3300046517 Ga0495630_0229486 Ga0495630_0229486_45_650 189
365 3300046536 Ga0495587_0087732 Ga0495587_0087732_336_905 189
366 3300046543 Ga0495645_0159360 Ga0495645_0159360_364_933 189
367 3300046664 Ga0495659_0190159 Ga0495659_0190159_45_716 189
368 3300046679 Ga0495623_0146466 Ga0495623_0146466_168_839 189
369 3300046684 Ga0495669_0238500 Ga0495669_0238500_222_848 189
370 3300046694 Ga0495649_0034599 Ga0495649_0034599_1984_2553 189
371 3300047319 Ga0495674_0210794 Ga0495674_0210794_970_1539 189
372 3300047322 Ga0495680_0055464 Ga0495680_0055464_1396_1965 189
373 3300047444 Ga0495675_0067335 Ga0495675_0067335_783_1454 189
374 3300048088 Ga0495602_0179302 Ga0495602_0179302_376_1047 189
375 3300048910 Ga0496107_1002715 Ga0496107_1002715_14_583 189
376 3300048912 Ga0496109_0639478 Ga0496109_0639478_332_901 189
377 3300048915 Ga0496112_0030904 Ga0496112_0030904_1832_2440 189
378 3300048918 Ga0496115_0341216 Ga0496115_0341216_246_908 189
379 3300049568 Ga0501031_0069011 Ga0501031_0069011_1542_2111 189
380 3300049569 Ga0501032_0005694 Ga0501032_0005694_6046_6615 189
381 3300049570 Ga0501033_0016470 Ga0501033_0016470_1517_2086 189
382 3300049571 Ga0501034_0032539 Ga0501034_0032539_1548_2117 189
383 3300049571 Ga0501034_0107538 Ga0501034_0107538_724_1293 189
384 3300049572 Ga0501036_0002362 Ga0501036_0002362_4763_5332 189
385 3300049573 Ga0501037_0098611 Ga0501037_0098611_1383_1952 189
386 3300049573 Ga0501037_0531684 Ga0501037_0531684_208_777 189
387 3300049574 Ga0501038_0001714 Ga0501038_0001714_11641_12210 189
388 3300049575 Ga0501039_0026679 Ga0501039_0026679_1605_2174 189
389 3300049579 Ga0501043_0001558 Ga0501043_0001558_16210_16779 189
390 3300049580 Ga0501046_0017839 Ga0501046_0017839_1648_2217 189
391 3300049580 Ga0501046_0139341 Ga0501046_0139341_1078_1647 189
392 3300049580 Ga0501046_0556477 Ga0501046_0556477_144_713 189
393 3300049581 Ga0501047_0030142 Ga0501047_0030142_721_1326 189
394 3300049581 Ga0501047_0038439 Ga0501047_0038439_1486_2055 189
395 3300049581 Ga0501047_0073647 Ga0501047_0073647_91_660 189
396 3300049582 Ga0501048_0032174 Ga0501048_0032174_1599_2168 189
397 3300049583 Ga0501067_0003293 Ga0501067_0003293_6173_6742 189
398 3300049584 Ga0501068_0003742 Ga0501068_0003742_4120_4689 189
399 3300049585 Ga0501069_0001370 Ga0501069_0001370_9017_9586 189
400 3300049586 Ga0501070_0006167 Ga0501070_0006167_5364_5933 189
401 3300049586 Ga0501070_0065249 Ga0501070_0065249_163_732 189
402 3300049586 Ga0501070_0247561 Ga0501070_0247561_797_1402 189
403 3300049588 Ga0501072_0437121 Ga0501072_0437121_181_750 189
404 3300049589 Ga0501073_0014857 Ga0501073_0014857_181_750 189
405 3300049590 Ga0501074_0016298 Ga0501074_0016298_3571_4140 189
406 3300049592 Ga0501076_0075402 Ga0501076_0075402_825_1394 189
407 3300049593 Ga0501077_0038685 Ga0501077_0038685_856_1425 189
408 3300049741 Ga0501079_0039504 Ga0501079_0039504_181_750 189
409 3300049742 Ga0501080_0002238 Ga0501080_0002238_2144_2713 189
410 3300049744 Ga0501083_0037014 Ga0501083_0037014_2576_3145 189
411 3300049822 Ga0501035_0093966 Ga0501035_0093966_287_856 189
412 3300049823 Ga0501044_0001033 Ga0501044_0001033_28466_29071 189
413 3300049823 Ga0501044_0015346 Ga0501044_0015346_3178_3747 189
414 3300049823 Ga0501044_0187134 Ga0501044_0187134_1047_1673 189
415 3300050507 nmdc:mga05p37_312819_c1 nmdc:mga05p37_312819_c1_1034_1603 189
416 3300050511 nmdc:mga08y16_1562744_c1 nmdc:mga08y16_1562744_c1_33_602 189
417 3300050512 nmdc:mga0n895_420573_c1 nmdc:mga0n895_420573_c1_699_1268 189
418 3300050514 nmdc:mga08x19_37414_c1 nmdc:mga08x19_37414_c1_2263_2961 189
419 3300050514 nmdc:mga08x19_498157_c1 nmdc:mga08x19_498157_c1_187_756 189
420 3300060353 Ga0501082_0003190 Ga0501082_0003190_8375_8944 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

49

145

0.97

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

161

220

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.5915 3 109
3s0h-assembly1.cif.gz_A the crystal structure of the periplasmic domain of helicobacter pylori motb (residues 90-256). 0.5825 44 65
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5687 10 114
3ckg-assembly1.cif.gz_A the crystal structure of ospa deletion mutant 0.5592 25 94
6kwu-assembly1.cif.gz_O a crystal structure of ospa mutant 0.5558 25 94
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9702 9 106 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8299 9 106 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6924 10 114 3.90.1150.30
3swgA02 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.6808 13 43 3.65.10.10
1dq3A02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6706 12 43 3.30.160.90
ID Description Score Start End GO Terms
AF-A0A3D3JG60-F1-model_v4 YdhG-like domain-containing protein 0.9887 9 119
AF-A0A316DEU9-F1-model_v4 Uncharacterized protein DUF1801 0.9887 7 101
AF-A0A7V9ZMH7-F1-model_v4 DUF1801 domain-containing protein 0.9846 6 119
AF-Q4A027-F1-model_v4 Uncharacterized protein 0.9842 125 186
AF-A0A5C7FL00-F1-model_v4 deleted 0.9822 23 108

Feature Viewer

pLDDT pTM Quality
90.25 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map