F439776
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 420 | 212 | 420 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0287543|Ga0373936_0287543_25_711 |
| Length | 228 |
| Sequence | LPTPPLAGHQWSKVLYCEASLLYFLAELNEFNNLGKGPGTMKVPYAKKWQKETDKLRQIALDGDLTEELKWGKPCFTFLKKNVAIVIPLKESCAFSFFKGALLKDPKHILQKIGQAQAGRWIKFTSPREIAAVQSTLKDYLYEAIALEKSGRRVVLKKPSDYPIPEELQRKLDDNAVLRSAFQTLTPGRRKSYIFHVSSAKQAKTRAARAEKCVPMILSGRGFNELPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 139 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 140 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 156 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 157 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 181 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.67 |
| Rhizosphere | 94.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10372676 | 3300003322 | Bacteria | 1059 |
| 2 | rootH1_10230584 | 3300003323 | Bacteria | 2410 |
| 3 | Ga0070658_10102300 | 3300005327 | Bacteria | 2369 |
| 4 | Ga0070658_10477940 | 3300005327 | Bacteria | 1075 |
| 5 | Ga0070683_100267385 | 3300005329 | Unclassified | 1626 |
| 6 | Ga0070683_100547380 | 3300005329 | Bacteria | 1106 |
| 7 | Ga0070690_100463539 | 3300005330 | Unclassified | 942 |
| 8 | Ga0070670_100063387 | 3300005331 | Bacteria | 3172 |
| 9 | Ga0070670_100417759 | 3300005331 | Unclassified | 1185 |
| 10 | Ga0068869_100027562 | 3300005334 | Bacteria | 3962 |
| 11 | Ga0070666_10126123 | 3300005335 | Unclassified | 1777 |
| 12 | Ga0070680_100200931 | 3300005336 | Bacteria | 1681 |
| 13 | Ga0070680_100974639 | 3300005336 | Bacteria | 732 |
| 14 | Ga0070682_100195483 | 3300005337 | Bacteria | 1423 |
| 15 | Ga0068868_100110678 | 3300005338 | Bacteria | 2231 |
| 16 | Ga0070660_100011747 | 3300005339 | Bacteria | 6235 |
| 17 | Ga0070660_100098024 | 3300005339 | Bacteria | 2320 |
| 18 | Ga0070691_10180858 | 3300005341 | Bacteria | 1098 |
| 19 | Ga0070661_100001452 | 3300005344 | Bacteria | 16450 |
| 20 | Ga0070661_100007067 | 3300005344 | Bacteria | 7744 |
| 21 | Ga0070661_100031221 | 3300005344 | Unclassified | 3851 |
| 22 | Ga0070675_100115119 | 3300005354 | Unclassified | 2279 |
| 23 | Ga0070671_100243679 | 3300005355 | Bacteria | 1526 |
| 24 | Ga0070671_100244734 | 3300005355 | Bacteria | 1523 |
| 25 | Ga0070671_100678828 | 3300005355 | Bacteria | 893 |
| 26 | Ga0070659_100077391 | 3300005366 | Bacteria | 2653 |
| 27 | Ga0070667_100338386 | 3300005367 | Unclassified | 1360 |
| 28 | Ga0070714_100076876 | 3300005435 | Bacteria | 2899 |
| 29 | Ga0070714_100614023 | 3300005435 | Bacteria | 1045 |
| 30 | Ga0070714_101102382 | 3300005435 | Bacteria | 773 |
| 31 | Ga0070713_100002052 | 3300005436 | Bacteria | 13018 |
| 32 | Ga0070713_100434259 | 3300005436 | Bacteria | 1231 |
| 33 | Ga0070713_100789638 | 3300005436 | Bacteria | 910 |
| 34 | Ga0070713_101156305 | 3300005436 | Unclassified | 749 |
| 35 | Ga0070711_100500610 | 3300005439 | Unclassified | 1001 |
| 36 | Ga0070700_100652652 | 3300005441 | Unclassified | 831 |
| 37 | Ga0070708_100083727 | 3300005445 | Bacteria | 2892 |
| 38 | Ga0070708_100215575 | 3300005445 | Unclassified | 1799 |
| 39 | Ga0070708_100302324 | 3300005445 | Unclassified | 1506 |
| 40 | Ga0070681_10064516 | 3300005458 | Bacteria | 3632 |
| 41 | Ga0068867_100275629 | 3300005459 | Unclassified | 1377 |
| 42 | Ga0070685_10053453 | 3300005466 | Unclassified | 2340 |
| 43 | Ga0070706_100058608 | 3300005467 | Bacteria | 3553 |
| 44 | Ga0070707_100463142 | 3300005468 | Bacteria | 1229 |
| 45 | Ga0070699_100036989 | 3300005518 | Bacteria | 4223 |
| 46 | Ga0070699_100840006 | 3300005518 | Bacteria | 841 |
| 47 | Ga0070679_100171689 | 3300005530 | Bacteria | 2141 |
| 48 | Ga0070679_100460766 | 3300005530 | Bacteria | 1216 |
| 49 | Ga0070684_100112059 | 3300005535 | Bacteria | 2447 |
| 50 | Ga0070684_100215271 | 3300005535 | Unclassified | 1752 |
| 51 | Ga0070684_100884676 | 3300005535 | Bacteria | 836 |
| 52 | Ga0070697_100290803 | 3300005536 | Bacteria | 1403 |
| 53 | Ga0070697_100598272 | 3300005536 | Bacteria | 969 |
| 54 | Ga0068853_100000389 | 3300005539 | Bacteria | 30055 |
| 55 | Ga0068853_100123756 | 3300005539 | Bacteria | 2309 |
| 56 | Ga0070672_100041991 | 3300005543 | Bacteria | 3519 |
| 57 | Ga0070696_100400970 | 3300005546 | Bacteria | 1073 |
| 58 | Ga0070693_100123100 | 3300005547 | Bacteria | 1611 |
| 59 | Ga0070693_100694033 | 3300005547 | Unclassified | 744 |
| 60 | Ga0070665_100004179 | 3300005548 | Bacteria | 15183 |
| 61 | Ga0070665_100067997 | 3300005548 | Unclassified | 3572 |
| 62 | Ga0070704_100527562 | 3300005549 | Unclassified | 1029 |
| 63 | Ga0068855_100008696 | 3300005563 | Bacteria | 12274 |
| 64 | Ga0068855_100015423 | 3300005563 | Bacteria | 9198 |
| 65 | Ga0068855_100017682 | 3300005563 | Bacteria | 8574 |
| 66 | Ga0068855_100030773 | 3300005563 | Bacteria | 6417 |
| 67 | Ga0068855_100060922 | 3300005563 | Bacteria | 4410 |
| 68 | Ga0068855_100201727 | 3300005563 | Bacteria | 2239 |
| 69 | Ga0068855_100829487 | 3300005563 | Unclassified | 981 |
| 70 | Ga0068855_100990574 | 3300005563 | Unclassified | 884 |
| 71 | Ga0070664_100036094 | 3300005564 | Bacteria | 4152 |
| 72 | Ga0070664_100083092 | 3300005564 | Bacteria | 2763 |
| 73 | Ga0070664_100284363 | 3300005564 | Unclassified | 1492 |
| 74 | Ga0068857_100407776 | 3300005577 | Bacteria | 1265 |
| 75 | Ga0068857_100719916 | 3300005577 | Bacteria | 949 |
| 76 | Ga0068854_100045088 | 3300005578 | Bacteria | 3134 |
| 77 | Ga0068856_100002276 | 3300005614 | Bacteria | 19807 |
| 78 | Ga0068856_100016784 | 3300005614 | Bacteria | 7095 |
| 79 | Ga0068856_100076325 | 3300005614 | Bacteria | 3320 |
| 80 | Ga0068856_100308673 | 3300005614 | Bacteria | 1599 |
| 81 | Ga0068856_100376043 | 3300005614 | Bacteria | 1439 |
| 82 | Ga0068852_100000028 | 3300005616 | Bacteria | 113383 |
| 83 | Ga0068852_100002690 | 3300005616 | Bacteria | 12278 |
| 84 | Ga0068859_100177817 | 3300005617 | Unclassified | 2210 |
| 85 | Ga0068864_100022314 | 3300005618 | Bacteria | 5307 |
| 86 | Ga0068851_10117162 | 3300005834 | Bacteria | 1428 |
| 87 | Ga0068863_100010471 | 3300005841 | Bacteria | 9014 |
| 88 | Ga0068863_100056887 | 3300005841 | Bacteria | 3702 |
| 89 | Ga0068858_100099497 | 3300005842 | Bacteria | 2711 |
| 90 | Ga0068860_100019612 | 3300005843 | Bacteria | 6558 |
| 91 | Ga0068862_100022170 | 3300005844 | Bacteria | 5314 |
| 92 | Ga0081455_10340684 | 3300005937 | Unclassified | 1061 |
| 93 | Ga0070717_10007402 | 3300006028 | Bacteria | 8151 |
| 94 | Ga0070717_10012466 | 3300006028 | Bacteria | 6483 |
| 95 | Ga0070717_10664374 | 3300006028 | Bacteria | 946 |
| 96 | Ga0070717_10706193 | 3300006028 | Unclassified | 916 |
| 97 | Ga0070716_100310498 | 3300006173 | Bacteria | 1101 |
| 98 | Ga0097621_100002055 | 3300006237 | Bacteria | 13767 |
| 99 | Ga0097621_100092902 | 3300006237 | Unclassified | 2528 |
| 100 | Ga0097621_100971546 | 3300006237 | Bacteria | 794 |
| 101 | Ga0068871_100036502 | 3300006358 | Unclassified | 3913 |
| 102 | Ga0068871_100050640 | 3300006358 | Bacteria | 3360 |
| 103 | Ga0068871_100088809 | 3300006358 | Bacteria | 2572 |
| 104 | Ga0068871_100306399 | 3300006358 | Unclassified | 1395 |
| 105 | Ga0068871_100316701 | 3300006358 | Unclassified | 1373 |
| 106 | Ga0075434_100150743 | 3300006871 | Bacteria | 2346 |
| 107 | Ga0075436_100140545 | 3300006914 | Bacteria | 1697 |
| 108 | Ga0097620_100177829 | 3300006931 | Unclassified | 2210 |
| 109 | Ga0075435_100690501 | 3300007076 | Bacteria | 887 |
| 110 | Ga0099794_10134064 | 3300007265 | Bacteria | 1252 |
| 111 | Ga0105240_10000499 | 3300009093 | Bacteria | 72315 |
| 112 | Ga0105240_10011560 | 3300009093 | Bacteria | 12284 |
| 113 | Ga0105240_10025804 | 3300009093 | Bacteria | 7717 |
| 114 | Ga0105240_10029267 | 3300009093 | Bacteria | 7180 |
| 115 | Ga0105240_10042942 | 3300009093 | Bacteria | 5759 |
| 116 | Ga0105240_10065554 | 3300009093 | Bacteria | 4508 |
| 117 | Ga0105240_10075115 | 3300009093 | Bacteria | 4169 |
| 118 | Ga0105240_10302234 | 3300009093 | Bacteria | 1830 |
| 119 | Ga0105240_10347954 | 3300009093 | Bacteria | 1682 |
| 120 | Ga0105240_10743068 | 3300009093 | Unclassified | 1067 |
| 121 | Ga0105240_10996396 | 3300009093 | Unclassified | 896 |
| 122 | Ga0111539_11473703 | 3300009094 | Bacteria | 789 |
| 123 | Ga0105245_10008733 | 3300009098 | Bacteria | 8837 |
| 124 | Ga0114129_10357215 | 3300009147 | Bacteria | 1934 |
| 125 | Ga0105241_10000162 | 3300009174 | Bacteria | 48662 |
| 126 | Ga0105241_10007698 | 3300009174 | Bacteria | 7920 |
| 127 | Ga0105241_10011464 | 3300009174 | Bacteria | 6498 |
| 128 | Ga0105241_10174639 | 3300009174 | Unclassified | 1777 |
| 129 | Ga0105241_10589132 | 3300009174 | Unclassified | 1003 |
| 130 | Ga0105242_10033515 | 3300009176 | Bacteria | 4112 |
| 131 | Ga0105242_10034813 | 3300009176 | Bacteria | 4038 |
| 132 | Ga0105242_10071063 | 3300009176 | Unclassified | 2887 |
| 133 | Ga0105248_10002940 | 3300009177 | Bacteria | 18909 |
| 134 | Ga0105248_10017141 | 3300009177 | Bacteria | 7980 |
| 135 | Ga0105248_10390656 | 3300009177 | Bacteria | 1566 |
| 136 | Ga0105248_10582158 | 3300009177 | Unclassified | 1263 |
| 137 | Ga0105248_10624089 | 3300009177 | Unclassified | 1216 |
| 138 | Ga0105237_10001188 | 3300009545 | Bacteria | 34842 |
| 139 | Ga0105237_10005789 | 3300009545 | Bacteria | 13875 |
| 140 | Ga0105237_10139281 | 3300009545 | Bacteria | 2421 |
| 141 | Ga0105238_10000373 | 3300009551 | Bacteria | 48142 |
| 142 | Ga0105238_10004314 | 3300009551 | Bacteria | 14106 |
| 143 | Ga0105238_10007350 | 3300009551 | Bacteria | 11029 |
| 144 | Ga0105238_10042073 | 3300009551 | Bacteria | 4626 |
| 145 | Ga0105238_10268114 | 3300009551 | Unclassified | 1688 |
| 146 | Ga0105238_10348521 | 3300009551 | Bacteria | 1470 |
| 147 | Ga0105238_10396355 | 3300009551 | Bacteria | 1373 |
| 148 | Ga0105238_10561251 | 3300009551 | Bacteria | 1147 |
| 149 | Ga0105249_10039288 | 3300009553 | Bacteria | 4296 |
| 150 | Ga0105249_10088514 | 3300009553 | Bacteria | 2892 |
| 151 | Ga0105249_10171754 | 3300009553 | Bacteria | 2103 |
| 152 | Ga0099796_10279381 | 3300010159 | Unclassified | 702 |
| 153 | Ga0105239_10000774 | 3300010375 | Bacteria | 45307 |
| 154 | Ga0105239_10002768 | 3300010375 | Bacteria | 21990 |
| 155 | Ga0105239_10370773 | 3300010375 | Bacteria | 1618 |
| 156 | Ga0105239_10643758 | 3300010375 | Bacteria | 1210 |
| 157 | Ga0105246_10003461 | 3300011119 | Bacteria | 9569 |
| 158 | Ga0157373_10082873 | 3300013100 | Bacteria | 2260 |
| 159 | Ga0157373_10204846 | 3300013100 | Bacteria | 1391 |
| 160 | Ga0157373_10593866 | 3300013100 | Bacteria | 806 |
| 161 | Ga0157373_10712214 | 3300013100 | Bacteria | 736 |
| 162 | Ga0157370_10000551 | 3300013104 | Bacteria | 46757 |
| 163 | Ga0157370_10064231 | 3300013104 | Unclassified | 3476 |
| 164 | Ga0157370_10766484 | 3300013104 | Unclassified | 879 |
| 165 | Ga0157369_10003839 | 3300013105 | Bacteria | 17854 |
| 166 | Ga0157369_10007839 | 3300013105 | Bacteria | 12284 |
| 167 | Ga0157369_10015425 | 3300013105 | Bacteria | 8611 |
| 168 | Ga0157369_10030078 | 3300013105 | Bacteria | 5993 |
| 169 | Ga0157369_10044951 | 3300013105 | Unclassified | 4805 |
| 170 | Ga0157369_10108506 | 3300013105 | Bacteria | 2952 |
| 171 | Ga0157369_10418142 | 3300013105 | Bacteria | 1390 |
| 172 | Ga0157369_10853526 | 3300013105 | Unclassified | 935 |
| 173 | Ga0157374_10016347 | 3300013296 | Bacteria | 6518 |
| 174 | Ga0157374_10023970 | 3300013296 | Bacteria | 5465 |
| 175 | Ga0157374_10074553 | 3300013296 | Bacteria | 3205 |
| 176 | Ga0157374_10116240 | 3300013296 | Unclassified | 2577 |
| 177 | Ga0157374_10708799 | 3300013296 | Unclassified | 1020 |
| 178 | Ga0157378_10016783 | 3300013297 | Bacteria | 6416 |
| 179 | Ga0157378_10032514 | 3300013297 | Unclassified | 4609 |
| 180 | Ga0157378_10379873 | 3300013297 | Bacteria | 1387 |
| 181 | Ga0163162_10024673 | 3300013306 | Bacteria | 5938 |
| 182 | Ga0163162_10058550 | 3300013306 | Unclassified | 3882 |
| 183 | Ga0163162_10141803 | 3300013306 | Bacteria | 2517 |
| 184 | Ga0163162_10259429 | 3300013306 | Bacteria | 1870 |
| 185 | Ga0157372_10005803 | 3300013307 | Bacteria | 13149 |
| 186 | Ga0157372_10006668 | 3300013307 | Bacteria | 12284 |
| 187 | Ga0157372_10010703 | 3300013307 | Bacteria | 9761 |
| 188 | Ga0157372_10014027 | 3300013307 | Bacteria | 8562 |
| 189 | Ga0157372_10047024 | 3300013307 | Bacteria | 4792 |
| 190 | Ga0157372_10063009 | 3300013307 | Bacteria | 4156 |
| 191 | Ga0157372_10116382 | 3300013307 | Unclassified | 3065 |
| 192 | Ga0157372_10415637 | 3300013307 | Bacteria | 1567 |
| 193 | Ga0157375_10214497 | 3300013308 | Bacteria | 2083 |
| 194 | Ga0157375_10285207 | 3300013308 | Unclassified | 1814 |
| 195 | Ga0163163_10017078 | 3300014325 | Bacteria | 6760 |
| 196 | Ga0163163_10032735 | 3300014325 | Bacteria | 5023 |
| 197 | Ga0157380_10810029 | 3300014326 | Unclassified | 954 |
| 198 | Ga0157377_10033415 | 3300014745 | Bacteria | 2808 |
| 199 | Ga0157379_10163555 | 3300014968 | Bacteria | 2009 |
| 200 | Ga0157379_10788960 | 3300014968 | Bacteria | 896 |
| 201 | Ga0157379_11327067 | 3300014968 | Unclassified | 695 |
| 202 | Ga0157376_10045790 | 3300014969 | Unclassified | 3604 |
| 203 | Ga0213874_10038429 | 3300021377 | Bacteria | 1421 |
| 204 | Ga0213876_10100797 | 3300021384 | Bacteria | 1531 |
| 205 | Ga0207692_10385213 | 3300025898 | Bacteria | 871 |
| 206 | Ga0207710_10540326 | 3300025900 | Bacteria | 607 |
| 207 | Ga0207680_10368433 | 3300025903 | Bacteria | 1011 |
| 208 | Ga0207680_10733382 | 3300025903 | Unclassified | 708 |
| 209 | Ga0207647_10102334 | 3300025904 | Bacteria | 1699 |
| 210 | Ga0207699_10279718 | 3300025906 | Unclassified | 1159 |
| 211 | Ga0207705_10137292 | 3300025909 | Bacteria | 1824 |
| 212 | Ga0207684_10170016 | 3300025910 | Bacteria | 1879 |
| 213 | Ga0207654_10000199 | 3300025911 | Bacteria | 37066 |
| 214 | Ga0207654_10000895 | 3300025911 | Bacteria | 16506 |
| 215 | Ga0207654_10068570 | 3300025911 | Unclassified | 2099 |
| 216 | Ga0207654_10382050 | 3300025911 | Unclassified | 976 |
| 217 | Ga0207654_10757775 | 3300025911 | Unclassified | 700 |
| 218 | Ga0207707_10028131 | 3300025912 | Bacteria | 4914 |
| 219 | Ga0207707_10079823 | 3300025912 | Bacteria | 2857 |
| 220 | Ga0207695_10000140 | 3300025913 | Bacteria | 216271 |
| 221 | Ga0207695_10000598 | 3300025913 | Bacteria | 72240 |
| 222 | Ga0207695_10003747 | 3300025913 | Bacteria | 21137 |
| 223 | Ga0207695_10006234 | 3300025913 | Bacteria | 15533 |
| 224 | Ga0207695_10009144 | 3300025913 | Bacteria | 12296 |
| 225 | Ga0207695_10027625 | 3300025913 | Bacteria | 6314 |
| 226 | Ga0207695_10050325 | 3300025913 | Bacteria | 4384 |
| 227 | Ga0207695_10059352 | 3300025913 | Bacteria | 3967 |
| 228 | Ga0207695_10070209 | 3300025913 | Bacteria | 3582 |
| 229 | Ga0207695_10244346 | 3300025913 | Bacteria | 1695 |
| 230 | Ga0207671_10000238 | 3300025914 | Bacteria | 82806 |
| 231 | Ga0207671_10021522 | 3300025914 | Bacteria | 4889 |
| 232 | Ga0207671_10083537 | 3300025914 | Bacteria | 2397 |
| 233 | Ga0207671_10208312 | 3300025914 | Unclassified | 1529 |
| 234 | Ga0207693_10094815 | 3300025915 | Unclassified | 2339 |
| 235 | Ga0207693_10398528 | 3300025915 | Bacteria | 1076 |
| 236 | Ga0207663_10091672 | 3300025916 | Bacteria | 2018 |
| 237 | Ga0207657_10016644 | 3300025919 | Bacteria | 7084 |
| 238 | Ga0207657_10111521 | 3300025919 | Bacteria | 2258 |
| 239 | Ga0207657_10148791 | 3300025919 | Unclassified | 1908 |
| 240 | Ga0207649_10005989 | 3300025920 | Bacteria | 6600 |
| 241 | Ga0207649_10010222 | 3300025920 | Bacteria | 5152 |
| 242 | Ga0207649_10027404 | 3300025920 | Bacteria | 3342 |
| 243 | Ga0207652_10093605 | 3300025921 | Bacteria | 2644 |
| 244 | Ga0207652_10414776 | 3300025921 | Unclassified | 1214 |
| 245 | Ga0207646_10531634 | 3300025922 | Unclassified | 1058 |
| 246 | Ga0207646_10738136 | 3300025922 | Bacteria | 879 |
| 247 | Ga0207694_10000089 | 3300025924 | Bacteria | 103520 |
| 248 | Ga0207694_10010521 | 3300025924 | Bacteria | 6979 |
| 249 | Ga0207694_10133418 | 3300025924 | Bacteria | 1992 |
| 250 | Ga0207694_10408270 | 3300025924 | Unclassified | 1130 |
| 251 | Ga0207650_10366431 | 3300025925 | Unclassified | 1188 |
| 252 | Ga0207687_10049294 | 3300025927 | Unclassified | 2928 |
| 253 | Ga0207687_10094432 | 3300025927 | Bacteria | 2189 |
| 254 | Ga0207700_10007625 | 3300025928 | Bacteria | 6639 |
| 255 | Ga0207700_11034987 | 3300025928 | Bacteria | 734 |
| 256 | Ga0207664_10097944 | 3300025929 | Bacteria | 2417 |
| 257 | Ga0207664_10207992 | 3300025929 | Bacteria | 1692 |
| 258 | Ga0207644_10100681 | 3300025931 | Bacteria | 2170 |
| 259 | Ga0207644_10555685 | 3300025931 | Bacteria | 950 |
| 260 | Ga0207690_10080188 | 3300025932 | Bacteria | 2277 |
| 261 | Ga0207690_10164842 | 3300025932 | Bacteria | 1655 |
| 262 | Ga0207686_10172529 | 3300025934 | Bacteria | 1526 |
| 263 | Ga0207709_10508780 | 3300025935 | Unclassified | 941 |
| 264 | Ga0207665_10027767 | 3300025939 | Bacteria | 3739 |
| 265 | Ga0207665_10177772 | 3300025939 | Bacteria | 1540 |
| 266 | Ga0207665_10626344 | 3300025939 | Bacteria | 842 |
| 267 | Ga0207711_10011350 | 3300025941 | Bacteria | 7401 |
| 268 | Ga0207711_10276489 | 3300025941 | Unclassified | 1546 |
| 269 | Ga0207711_10876909 | 3300025941 | Unclassified | 835 |
| 270 | Ga0207689_10016215 | 3300025942 | Bacteria | 6310 |
| 271 | Ga0207661_10420771 | 3300025944 | Unclassified | 1213 |
| 272 | Ga0207661_10582042 | 3300025944 | Bacteria | 1027 |
| 273 | Ga0207661_10762629 | 3300025944 | Bacteria | 891 |
| 274 | Ga0207679_10117883 | 3300025945 | Bacteria | 2107 |
| 275 | Ga0207667_10003663 | 3300025949 | Bacteria | 18947 |
| 276 | Ga0207667_10015492 | 3300025949 | Bacteria | 8655 |
| 277 | Ga0207667_10024692 | 3300025949 | Bacteria | 6593 |
| 278 | Ga0207667_10268997 | 3300025949 | Bacteria | 1742 |
| 279 | Ga0207667_10483402 | 3300025949 | Unclassified | 1257 |
| 280 | Ga0207712_10149745 | 3300025961 | Bacteria | 1801 |
| 281 | Ga0207640_10005029 | 3300025981 | Bacteria | 7193 |
| 282 | Ga0207677_10117985 | 3300026023 | Bacteria | 1990 |
| 283 | Ga0207703_10626090 | 3300026035 | Unclassified | 1019 |
| 284 | Ga0207639_10000103 | 3300026041 | Bacteria | 70103 |
| 285 | Ga0207639_10350905 | 3300026041 | Bacteria | 1318 |
| 286 | Ga0207702_10000476 | 3300026078 | Bacteria | 45021 |
| 287 | Ga0207702_10056874 | 3300026078 | Bacteria | 3322 |
| 288 | Ga0207702_10082161 | 3300026078 | Unclassified | 2801 |
| 289 | Ga0207702_10162907 | 3300026078 | Bacteria | 2038 |
| 290 | Ga0207702_10217070 | 3300026078 | Bacteria | 1781 |
| 291 | Ga0207641_10043481 | 3300026088 | Bacteria | 3773 |
| 292 | Ga0207641_10189111 | 3300026088 | Unclassified | 1891 |
| 293 | Ga0207641_10532668 | 3300026088 | Bacteria | 1144 |
| 294 | Ga0207641_10966959 | 3300026088 | Unclassified | 847 |
| 295 | Ga0207648_10195419 | 3300026089 | Bacteria | 1794 |
| 296 | Ga0207674_10033118 | 3300026116 | Bacteria | 5411 |
| 297 | Ga0207674_10257727 | 3300026116 | Bacteria | 1691 |
| 298 | Ga0207683_11264264 | 3300026121 | Unclassified | 684 |
| 299 | Ga0207698_10000384 | 3300026142 | Bacteria | 25551 |
| 300 | Ga0207698_10000478 | 3300026142 | Bacteria | 23262 |
| 301 | Ga0207698_10701802 | 3300026142 | Bacteria | 1007 |
| 302 | Ga0207698_10705369 | 3300026142 | Bacteria | 1004 |
| 303 | Ga0207698_10934886 | 3300026142 | Bacteria | 875 |
| 304 | Ga0268266_10005700 | 3300028379 | Bacteria | 11547 |
| 305 | Ga0268266_10009337 | 3300028379 | Bacteria | 8645 |
| 306 | Ga0268266_10104666 | 3300028379 | Unclassified | 2499 |
| 307 | Ga0268266_10422850 | 3300028379 | Bacteria | 1263 |
| 308 | Ga0268265_10060108 | 3300028380 | Bacteria | 2911 |
| 309 | Ga0268264_10002796 | 3300028381 | Bacteria | 15247 |
| 310 | Ga0268264_10366970 | 3300028381 | Bacteria | 1375 |
| 311 | Ga0265338_10005935 | 3300028800 | Bacteria | 15731 |
| 312 | Ga0265330_10003108 | 3300031235 | Bacteria | 8790 |
| 313 | Ga0265325_10014967 | 3300031241 | Bacteria | 4372 |
| 314 | Ga0265340_10013862 | 3300031247 | Bacteria | 4224 |
| 315 | Ga0265340_10033712 | 3300031247 | Unclassified | 2548 |
| 316 | Ga0265339_10000115 | 3300031249 | Bacteria | 65607 |
| 317 | Ga0265316_10000483 | 3300031344 | Bacteria | 45211 |
| 318 | Ga0265316_10011046 | 3300031344 | Bacteria | 8183 |
| 319 | Ga0265313_10014671 | 3300031595 | Bacteria | 4615 |
| 320 | Ga0265314_10005286 | 3300031711 | Bacteria | 11686 |
| 321 | Ga0265342_10003593 | 3300031712 | Bacteria | 12653 |
| 322 | Ga0373934_0029018 | 3300035086 | Bacteria | 2159 |
| 323 | Ga0373936_0287543 | 3300035113 | Unclassified | 740 |
| 324 | Ga0373954_0002366 | 3300035118 | Bacteria | 7883 |
| 325 | Ga0373937_0018848 | 3300036401 | Bacteria | 6170 |
| 326 | Ga0373937_0131977 | 3300036401 | Unclassified | 2333 |
| 327 | Ga0373937_0203395 | 3300036401 | Unclassified | 1862 |
| 328 | Ga0373925_0509378 | 3300037068 | Bacteria | 988 |
| 329 | Ga0395900_0988160 | 3300037418 | Unclassified | 762 |
| 330 | Ga0395905_1033671 | 3300037471 | Bacteria | 725 |
| 331 | Ga0436364_0431530 | 3300037853 | Bacteria | 1340 |
| 332 | Ga0436364_0652936 | 3300037853 | Bacteria | 2313 |
| 333 | Ga0436364_0664343 | 3300037853 | Bacteria | 1302 |
| 334 | Ga0436364_0689426 | 3300037853 | Unclassified | 1623 |
| 335 | Ga0436364_1409782 | 3300037853 | Bacteria | 1389 |
| 336 | Ga0395901_0479660 | 3300038443 | Bacteria | 1269 |
| 337 | Ga0436365_0840158 | 3300039437 | Unclassified | 1022 |
| 338 | Ga0436365_1012460 | 3300039437 | Bacteria | 3299 |
| 339 | Ga0436363_0548304 | 3300039450 | Unclassified | 2246 |
| 340 | Ga0436363_0616505 | 3300039450 | Bacteria | 1041 |
| 341 | Ga0436363_0928621 | 3300039450 | Bacteria | 1243 |
| 342 | Ga0436363_1669288 | 3300039450 | Bacteria | 3169 |
| 343 | Ga0436362_0502258 | 3300039453 | Bacteria | 1557 |
| 344 | Ga0466969_0010407 | 3300044656 | Bacteria | 4931 |
| 345 | Ga0466961_0073960 | 3300044693 | Bacteria | 2161 |
| 346 | Ga0466961_0346133 | 3300044693 | Unclassified | 905 |
| 347 | Ga0466959_0105907 | 3300045049 | Unclassified | 2011 |
| 348 | Ga0466959_0112983 | 3300045049 | Bacteria | 1937 |
| 349 | Ga0466959_0246305 | 3300045049 | Bacteria | 1233 |
| 350 | Ga0466959_0288680 | 3300045049 | Unclassified | 1125 |
| 351 | Ga0466967_0088177 | 3300045976 | Bacteria | 2815 |
| 352 | Ga0466967_0794303 | 3300045976 | Unclassified | 940 |
| 353 | Ga0466967_1003725 | 3300045976 | Bacteria | 831 |
| 354 | Ga0495580_0148865 | 3300046472 | Bacteria | 1622 |
| 355 | Ga0495580_0307649 | 3300046472 | Bacteria | 1078 |
| 356 | Ga0495582_0168196 | 3300046473 | Unclassified | 1248 |
| 357 | Ga0495664_0092329 | 3300046477 | Bacteria | 1821 |
| 358 | Ga0495583_0015467 | 3300046506 | Bacteria | 4148 |
| 359 | Ga0495630_0229486 | 3300046517 | Bacteria | 1418 |
| 360 | Ga0495587_0087732 | 3300046536 | Unclassified | 1800 |
| 361 | Ga0495645_0159360 | 3300046543 | Unclassified | 1561 |
| 362 | Ga0495659_0190159 | 3300046664 | Bacteria | 839 |
| 363 | Ga0495623_0146466 | 3300046679 | Unclassified | 1400 |
| 364 | Ga0495669_0238500 | 3300046684 | Bacteria | 873 |
| 365 | Ga0495649_0034599 | 3300046694 | Bacteria | 2780 |
| 366 | Ga0495674_0210794 | 3300047319 | Bacteria | 1609 |
| 367 | Ga0495680_0055464 | 3300047322 | Unclassified | 3074 |
| 368 | Ga0495675_0067335 | 3300047444 | Unclassified | 2263 |
| 369 | Ga0495602_0179302 | 3300048088 | Bacteria | 1636 |
| 370 | Ga0496107_1002715 | 3300048910 | Unclassified | 606 |
| 371 | Ga0496109_0639478 | 3300048912 | Unclassified | 1001 |
| 372 | Ga0496112_0030904 | 3300048915 | Bacteria | 5189 |
| 373 | Ga0496112_0129860 | 3300048915 | Bacteria | 2491 |
| 374 | Ga0496112_0794540 | 3300048915 | Unclassified | 871 |
| 375 | Ga0496113_0551288 | 3300048916 | Unclassified | 925 |
| 376 | Ga0496115_0341216 | 3300048918 | Bacteria | 1223 |
| 377 | Ga0501031_0069011 | 3300049568 | Bacteria | 2302 |
| 378 | Ga0501032_0005694 | 3300049569 | Bacteria | 9227 |
| 379 | Ga0501033_0016470 | 3300049570 | Bacteria | 5599 |
| 380 | Ga0501034_0032539 | 3300049571 | Bacteria | 5294 |
| 381 | Ga0501034_0107538 | 3300049571 | Bacteria | 2781 |
| 382 | Ga0501036_0002362 | 3300049572 | Bacteria | 14758 |
| 383 | Ga0501037_0098611 | 3300049573 | Bacteria | 2110 |
| 384 | Ga0501037_0531684 | 3300049573 | Unclassified | 795 |
| 385 | Ga0501038_0001714 | 3300049574 | Bacteria | 20367 |
| 386 | Ga0501039_0026679 | 3300049575 | Bacteria | 4440 |
| 387 | Ga0501043_0001558 | 3300049579 | Bacteria | 19956 |
| 388 | Ga0501046_0017839 | 3300049580 | Bacteria | 5918 |
| 389 | Ga0501046_0139341 | 3300049580 | Bacteria | 1837 |
| 390 | Ga0501046_0556477 | 3300049580 | Unclassified | 817 |
| 391 | Ga0501047_0030142 | 3300049581 | Bacteria | 5231 |
| 392 | Ga0501047_0038439 | 3300049581 | Bacteria | 4630 |
| 393 | Ga0501047_0073647 | 3300049581 | Unclassified | 3288 |
| 394 | Ga0501048_0032174 | 3300049582 | Bacteria | 3792 |
| 395 | Ga0501067_0003293 | 3300049583 | Bacteria | 8885 |
| 396 | Ga0501068_0003742 | 3300049584 | Bacteria | 8229 |
| 397 | Ga0501069_0001370 | 3300049585 | Bacteria | 11959 |
| 398 | Ga0501070_0006167 | 3300049586 | Bacteria | 10216 |
| 399 | Ga0501070_0065249 | 3300049586 | Unclassified | 3014 |
| 400 | Ga0501070_0247561 | 3300049586 | Unclassified | 1458 |
| 401 | Ga0501072_0437121 | 3300049588 | Unclassified | 1036 |
| 402 | Ga0501073_0014857 | 3300049589 | Bacteria | 5650 |
| 403 | Ga0501074_0016298 | 3300049590 | Bacteria | 5395 |
| 404 | Ga0501076_0075402 | 3300049592 | Bacteria | 2703 |
| 405 | Ga0501077_0038685 | 3300049593 | Bacteria | 3038 |
| 406 | Ga0501079_0039504 | 3300049741 | Bacteria | 3639 |
| 407 | Ga0501080_0002238 | 3300049742 | Bacteria | 16814 |
| 408 | Ga0501083_0037014 | 3300049744 | Bacteria | 3325 |
| 409 | Ga0501035_0093966 | 3300049822 | Bacteria | 2637 |
| 410 | Ga0501044_0001033 | 3300049823 | Bacteria | 33524 |
| 411 | Ga0501044_0015346 | 3300049823 | Bacteria | 8249 |
| 412 | Ga0501044_0187134 | 3300049823 | Bacteria | 2035 |
| 413 | nmdc:mga05p37_312819_c1 | 3300050507 | Bacteria | 1861 |
| 414 | nmdc:mga08y16_1562744_c1 | 3300050511 | Unclassified | 618 |
| 415 | nmdc:mga0n895_420573_c1 | 3300050512 | Unclassified | 1351 |
| 416 | nmdc:mga0n895_994206_c1 | 3300050512 | Bacteria | 820 |
| 417 | nmdc:mga08x19_37414_c1 | 3300050514 | Bacteria | 3079 |
| 418 | nmdc:mga08x19_498157_c1 | 3300050514 | Unclassified | 860 |
| 419 | Ga0495619_0222029 | 3300053085 | Bacteria | 1309 |
| 420 | Ga0501082_0003190 | 3300060353 | Bacteria | 14302 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005547 | Ga0070693_100694033 | Ga0070693_1006940331 | 185 |
| 2 | 3300044693 | Ga0466961_0073960 | Ga0466961_0073960_1441_2001 | 186 |
| 3 | 3300045049 | Ga0466959_0112983 | Ga0466959_0112983_796_1356 | 186 |
| 4 | 3300045976 | Ga0466967_1003725 | Ga0466967_1003725_190_750 | 186 |
| 5 | 3300048915 | Ga0496112_0129860 | Ga0496112_0129860_170_730 | 186 |
| 6 | 3300005336 | Ga0070680_100974639 | Ga0070680_1009746391 | 187 |
| 7 | 3300005355 | Ga0070671_100678828 | Ga0070671_1006788281 | 187 |
| 8 | 3300005535 | Ga0070684_100215271 | Ga0070684_1002152712 | 187 |
| 9 | 3300005564 | Ga0070664_100284363 | Ga0070664_1002843632 | 187 |
| 10 | 3300048916 | Ga0496113_0551288 | Ga0496113_0551288_84_647 | 187 |
| 11 | 3300005329 | Ga0070683_100547380 | Ga0070683_1005473802 | 188 |
| 12 | 3300005435 | Ga0070714_100076876 | Ga0070714_1000768763 | 188 |
| 13 | 3300005435 | Ga0070714_101102382 | Ga0070714_1011023821 | 188 |
| 14 | 3300005436 | Ga0070713_101156305 | Ga0070713_1011563051 | 188 |
| 15 | 3300005445 | Ga0070708_100215575 | Ga0070708_1002155752 | 188 |
| 16 | 3300005458 | Ga0070681_10064516 | Ga0070681_100645164 | 188 |
| 17 | 3300005518 | Ga0070699_100840006 | Ga0070699_1008400062 | 188 |
| 18 | 3300005530 | Ga0070679_100171689 | Ga0070679_1001716893 | 188 |
| 19 | 3300005536 | Ga0070697_100598272 | Ga0070697_1005982721 | 188 |
| 20 | 3300005563 | Ga0068855_100201727 | Ga0068855_1002017273 | 188 |
| 21 | 3300006173 | Ga0070716_100310498 | Ga0070716_1003104981 | 188 |
| 22 | 3300007076 | Ga0075435_100690501 | Ga0075435_1006905011 | 188 |
| 23 | 3300009093 | Ga0105240_10029267 | Ga0105240_100292674 | 188 |
| 24 | 3300009177 | Ga0105248_10390656 | Ga0105248_103906561 | 188 |
| 25 | 3300009177 | Ga0105248_10582158 | Ga0105248_105821582 | 188 |
| 26 | 3300009551 | Ga0105238_10348521 | Ga0105238_103485213 | 188 |
| 27 | 3300013105 | Ga0157369_10853526 | Ga0157369_108535262 | 188 |
| 28 | 3300013296 | Ga0157374_10708799 | Ga0157374_107087992 | 188 |
| 29 | 3300014968 | Ga0157379_10788960 | Ga0157379_107889601 | 188 |
| 30 | 3300025912 | Ga0207707_10079823 | Ga0207707_100798232 | 188 |
| 31 | 3300025913 | Ga0207695_10027625 | Ga0207695_100276255 | 188 |
| 32 | 3300025913 | Ga0207695_10244346 | Ga0207695_102443462 | 188 |
| 33 | 3300025915 | Ga0207693_10398528 | Ga0207693_103985282 | 188 |
| 34 | 3300025916 | Ga0207663_10091672 | Ga0207663_100916724 | 188 |
| 35 | 3300025919 | Ga0207657_10148791 | Ga0207657_101487912 | 188 |
| 36 | 3300025921 | Ga0207652_10414776 | Ga0207652_104147762 | 188 |
| 37 | 3300025922 | Ga0207646_10738136 | Ga0207646_107381361 | 188 |
| 38 | 3300025929 | Ga0207664_10207992 | Ga0207664_102079921 | 188 |
| 39 | 3300025939 | Ga0207665_10027767 | Ga0207665_100277673 | 188 |
| 40 | 3300025939 | Ga0207665_10626344 | Ga0207665_106263442 | 188 |
| 41 | 3300025944 | Ga0207661_10582042 | Ga0207661_105820422 | 188 |
| 42 | 3300025949 | Ga0207667_10268997 | Ga0207667_102689972 | 188 |
| 43 | 3300026088 | Ga0207641_10532668 | Ga0207641_105326681 | 188 |
| 44 | 3300028381 | Ga0268264_10366970 | Ga0268264_103669701 | 188 |
| 45 | 3300035113 | Ga0373936_0287543 | Ga0373936_0287543_25_711 | 188 |
| 46 | 3300037853 | Ga0436364_0431530 | Ga0436364_0431530_234_800 | 188 |
| 47 | 3300037853 | Ga0436364_1409782 | Ga0436364_1409782_694_1260 | 188 |
| 48 | 3300039450 | Ga0436363_0548304 | Ga0436363_0548304_1617_2183 | 188 |
| 49 | 3300039450 | Ga0436363_0616505 | Ga0436363_0616505_405_1010 | 188 |
| 50 | 3300039450 | Ga0436363_0928621 | Ga0436363_0928621_150_716 | 188 |
| 51 | 3300045049 | Ga0466959_0288680 | Ga0466959_0288680_484_1086 | 188 |
| 52 | 3300046472 | Ga0495580_0148865 | Ga0495580_0148865_587_1336 | 188 |
| 53 | 3300048915 | Ga0496112_0794540 | Ga0496112_0794540_41_607 | 188 |
| 54 | 3300050512 | nmdc:mga0n895_994206_c1 | nmdc:mga0n895_994206_c1_230_796 | 188 |
| 55 | 3300053085 | Ga0495619_0222029 | Ga0495619_0222029_484_1050 | 188 |
| 56 | 3300003322 | rootL2_10372676 | rootL2_103726762 | 189 |
| 57 | 3300003323 | rootH1_10230584 | rootH1_102305841 | 189 |
| 58 | 3300005327 | Ga0070658_10102300 | Ga0070658_101023001 | 189 |
| 59 | 3300005327 | Ga0070658_10477940 | Ga0070658_104779402 | 189 |
| 60 | 3300005329 | Ga0070683_100267385 | Ga0070683_1002673852 | 189 |
| 61 | 3300005330 | Ga0070690_100463539 | Ga0070690_1004635392 | 189 |
| 62 | 3300005331 | Ga0070670_100063387 | Ga0070670_1000633871 | 189 |
| 63 | 3300005331 | Ga0070670_100417759 | Ga0070670_1004177592 | 189 |
| 64 | 3300005334 | Ga0068869_100027562 | Ga0068869_1000275623 | 189 |
| 65 | 3300005335 | Ga0070666_10126123 | Ga0070666_101261231 | 189 |
| 66 | 3300005336 | Ga0070680_100200931 | Ga0070680_1002009312 | 189 |
| 67 | 3300005337 | Ga0070682_100195483 | Ga0070682_1001954832 | 189 |
| 68 | 3300005338 | Ga0068868_100110678 | Ga0068868_1001106782 | 189 |
| 69 | 3300005339 | Ga0070660_100011747 | Ga0070660_1000117474 | 189 |
| 70 | 3300005339 | Ga0070660_100098024 | Ga0070660_1000980241 | 189 |
| 71 | 3300005341 | Ga0070691_10180858 | Ga0070691_101808581 | 189 |
| 72 | 3300005344 | Ga0070661_100001452 | Ga0070661_1000014525 | 189 |
| 73 | 3300005344 | Ga0070661_100007067 | Ga0070661_1000070679 | 189 |
| 74 | 3300005344 | Ga0070661_100031221 | Ga0070661_1000312212 | 189 |
| 75 | 3300005354 | Ga0070675_100115119 | Ga0070675_1001151192 | 189 |
| 76 | 3300005355 | Ga0070671_100243679 | Ga0070671_1002436792 | 189 |
| 77 | 3300005355 | Ga0070671_100244734 | Ga0070671_1002447342 | 189 |
| 78 | 3300005366 | Ga0070659_100077391 | Ga0070659_1000773912 | 189 |
| 79 | 3300005367 | Ga0070667_100338386 | Ga0070667_1003383862 | 189 |
| 80 | 3300005435 | Ga0070714_100614023 | Ga0070714_1006140232 | 189 |
| 81 | 3300005436 | Ga0070713_100002052 | Ga0070713_1000020528 | 189 |
| 82 | 3300005436 | Ga0070713_100434259 | Ga0070713_1004342592 | 189 |
| 83 | 3300005436 | Ga0070713_100789638 | Ga0070713_1007896381 | 189 |
| 84 | 3300005439 | Ga0070711_100500610 | Ga0070711_1005006101 | 189 |
| 85 | 3300005441 | Ga0070700_100652652 | Ga0070700_1006526521 | 189 |
| 86 | 3300005445 | Ga0070708_100083727 | Ga0070708_1000837274 | 189 |
| 87 | 3300005445 | Ga0070708_100302324 | Ga0070708_1003023241 | 189 |
| 88 | 3300005459 | Ga0068867_100275629 | Ga0068867_1002756292 | 189 |
| 89 | 3300005466 | Ga0070685_10053453 | Ga0070685_100534533 | 189 |
| 90 | 3300005467 | Ga0070706_100058608 | Ga0070706_1000586087 | 189 |
| 91 | 3300005468 | Ga0070707_100463142 | Ga0070707_1004631422 | 189 |
| 92 | 3300005518 | Ga0070699_100036989 | Ga0070699_1000369893 | 189 |
| 93 | 3300005530 | Ga0070679_100460766 | Ga0070679_1004607662 | 189 |
| 94 | 3300005535 | Ga0070684_100112059 | Ga0070684_1001120592 | 189 |
| 95 | 3300005535 | Ga0070684_100884676 | Ga0070684_1008846762 | 189 |
| 96 | 3300005536 | Ga0070697_100290803 | Ga0070697_1002908032 | 189 |
| 97 | 3300005539 | Ga0068853_100000389 | Ga0068853_10000038914 | 189 |
| 98 | 3300005539 | Ga0068853_100123756 | Ga0068853_1001237562 | 189 |
| 99 | 3300005543 | Ga0070672_100041991 | Ga0070672_1000419914 | 189 |
| 100 | 3300005546 | Ga0070696_100400970 | Ga0070696_1004009702 | 189 |
| 101 | 3300005547 | Ga0070693_100123100 | Ga0070693_1001231001 | 189 |
| 102 | 3300005548 | Ga0070665_100004179 | Ga0070665_1000041795 | 189 |
| 103 | 3300005548 | Ga0070665_100067997 | Ga0070665_1000679975 | 189 |
| 104 | 3300005549 | Ga0070704_100527562 | Ga0070704_1005275622 | 189 |
| 105 | 3300005563 | Ga0068855_100008696 | Ga0068855_1000086961 | 189 |
| 106 | 3300005563 | Ga0068855_100015423 | Ga0068855_1000154234 | 189 |
| 107 | 3300005563 | Ga0068855_100017682 | Ga0068855_1000176826 | 189 |
| 108 | 3300005563 | Ga0068855_100030773 | Ga0068855_1000307734 | 189 |
| 109 | 3300005563 | Ga0068855_100060922 | Ga0068855_1000609222 | 189 |
| 110 | 3300005563 | Ga0068855_100829487 | Ga0068855_1008294872 | 189 |
| 111 | 3300005563 | Ga0068855_100990574 | Ga0068855_1009905741 | 189 |
| 112 | 3300005564 | Ga0070664_100036094 | Ga0070664_1000360947 | 189 |
| 113 | 3300005564 | Ga0070664_100083092 | Ga0070664_1000830922 | 189 |
| 114 | 3300005577 | Ga0068857_100407776 | Ga0068857_1004077762 | 189 |
| 115 | 3300005577 | Ga0068857_100719916 | Ga0068857_1007199162 | 189 |
| 116 | 3300005578 | Ga0068854_100045088 | Ga0068854_1000450883 | 189 |
| 117 | 3300005614 | Ga0068856_100002276 | Ga0068856_1000022762 | 189 |
| 118 | 3300005614 | Ga0068856_100016784 | Ga0068856_1000167844 | 189 |
| 119 | 3300005614 | Ga0068856_100076325 | Ga0068856_1000763254 | 189 |
| 120 | 3300005614 | Ga0068856_100308673 | Ga0068856_1003086732 | 189 |
| 121 | 3300005614 | Ga0068856_100376043 | Ga0068856_1003760431 | 189 |
| 122 | 3300005616 | Ga0068852_100000028 | Ga0068852_10000002873 | 189 |
| 123 | 3300005616 | Ga0068852_100002690 | Ga0068852_10000269011 | 189 |
| 124 | 3300005617 | Ga0068859_100177817 | Ga0068859_1001778173 | 189 |
| 125 | 3300005618 | Ga0068864_100022314 | Ga0068864_1000223143 | 189 |
| 126 | 3300005834 | Ga0068851_10117162 | Ga0068851_101171622 | 189 |
| 127 | 3300005841 | Ga0068863_100010471 | Ga0068863_1000104718 | 189 |
| 128 | 3300005841 | Ga0068863_100056887 | Ga0068863_1000568873 | 189 |
| 129 | 3300005842 | Ga0068858_100099497 | Ga0068858_1000994973 | 189 |
| 130 | 3300005843 | Ga0068860_100019612 | Ga0068860_1000196125 | 189 |
| 131 | 3300005844 | Ga0068862_100022170 | Ga0068862_1000221705 | 189 |
| 132 | 3300005937 | Ga0081455_10340684 | Ga0081455_103406841 | 189 |
| 133 | 3300006028 | Ga0070717_10007402 | Ga0070717_100074022 | 189 |
| 134 | 3300006028 | Ga0070717_10012466 | Ga0070717_100124663 | 189 |
| 135 | 3300006028 | Ga0070717_10664374 | Ga0070717_106643741 | 189 |
| 136 | 3300006028 | Ga0070717_10706193 | Ga0070717_107061932 | 189 |
| 137 | 3300006237 | Ga0097621_100002055 | Ga0097621_1000020552 | 189 |
| 138 | 3300006237 | Ga0097621_100092902 | Ga0097621_1000929022 | 189 |
| 139 | 3300006237 | Ga0097621_100971546 | Ga0097621_1009715461 | 189 |
| 140 | 3300006358 | Ga0068871_100036502 | Ga0068871_1000365023 | 189 |
| 141 | 3300006358 | Ga0068871_100050640 | Ga0068871_1000506404 | 189 |
| 142 | 3300006358 | Ga0068871_100088809 | Ga0068871_1000888094 | 189 |
| 143 | 3300006358 | Ga0068871_100306399 | Ga0068871_1003063992 | 189 |
| 144 | 3300006358 | Ga0068871_100316701 | Ga0068871_1003167012 | 189 |
| 145 | 3300006871 | Ga0075434_100150743 | Ga0075434_1001507433 | 189 |
| 146 | 3300006914 | Ga0075436_100140545 | Ga0075436_1001405453 | 189 |
| 147 | 3300006931 | Ga0097620_100177829 | Ga0097620_1001778293 | 189 |
| 148 | 3300007265 | Ga0099794_10134064 | Ga0099794_101340642 | 189 |
| 149 | 3300009093 | Ga0105240_10000499 | Ga0105240_1000049950 | 189 |
| 150 | 3300009093 | Ga0105240_10011560 | Ga0105240_100115601 | 189 |
| 151 | 3300009093 | Ga0105240_10025804 | Ga0105240_100258044 | 189 |
| 152 | 3300009093 | Ga0105240_10042942 | Ga0105240_100429424 | 189 |
| 153 | 3300009093 | Ga0105240_10065554 | Ga0105240_100655545 | 189 |
| 154 | 3300009093 | Ga0105240_10075115 | Ga0105240_100751153 | 189 |
| 155 | 3300009093 | Ga0105240_10302234 | Ga0105240_103022342 | 189 |
| 156 | 3300009093 | Ga0105240_10347954 | Ga0105240_103479541 | 189 |
| 157 | 3300009093 | Ga0105240_10743068 | Ga0105240_107430681 | 189 |
| 158 | 3300009093 | Ga0105240_10996396 | Ga0105240_109963961 | 189 |
| 159 | 3300009094 | Ga0111539_11473703 | Ga0111539_114737031 | 189 |
| 160 | 3300009098 | Ga0105245_10008733 | Ga0105245_100087335 | 189 |
| 161 | 3300009147 | Ga0114129_10357215 | Ga0114129_103572153 | 189 |
| 162 | 3300009174 | Ga0105241_10000162 | Ga0105241_1000016245 | 189 |
| 163 | 3300009174 | Ga0105241_10007698 | Ga0105241_100076988 | 189 |
| 164 | 3300009174 | Ga0105241_10011464 | Ga0105241_100114644 | 189 |
| 165 | 3300009174 | Ga0105241_10174639 | Ga0105241_101746391 | 189 |
| 166 | 3300009174 | Ga0105241_10589132 | Ga0105241_105891321 | 189 |
| 167 | 3300009176 | Ga0105242_10033515 | Ga0105242_100335156 | 189 |
| 168 | 3300009176 | Ga0105242_10034813 | Ga0105242_100348132 | 189 |
| 169 | 3300009176 | Ga0105242_10071063 | Ga0105242_100710634 | 189 |
| 170 | 3300009177 | Ga0105248_10002940 | Ga0105248_100029401 | 189 |
| 171 | 3300009177 | Ga0105248_10017141 | Ga0105248_100171414 | 189 |
| 172 | 3300009177 | Ga0105248_10624089 | Ga0105248_106240892 | 189 |
| 173 | 3300009545 | Ga0105237_10001188 | Ga0105237_1000118834 | 189 |
| 174 | 3300009545 | Ga0105237_10005789 | Ga0105237_100057899 | 189 |
| 175 | 3300009545 | Ga0105237_10139281 | Ga0105237_101392813 | 189 |
| 176 | 3300009551 | Ga0105238_10000373 | Ga0105238_100003737 | 189 |
| 177 | 3300009551 | Ga0105238_10004314 | Ga0105238_1000431411 | 189 |
| 178 | 3300009551 | Ga0105238_10007350 | Ga0105238_100073507 | 189 |
| 179 | 3300009551 | Ga0105238_10042073 | Ga0105238_100420734 | 189 |
| 180 | 3300009551 | Ga0105238_10268114 | Ga0105238_102681141 | 189 |
| 181 | 3300009551 | Ga0105238_10396355 | Ga0105238_103963552 | 189 |
| 182 | 3300009551 | Ga0105238_10561251 | Ga0105238_105612511 | 189 |
| 183 | 3300009553 | Ga0105249_10039288 | Ga0105249_100392883 | 189 |
| 184 | 3300009553 | Ga0105249_10088514 | Ga0105249_100885142 | 189 |
| 185 | 3300009553 | Ga0105249_10171754 | Ga0105249_101717541 | 189 |
| 186 | 3300010159 | Ga0099796_10279381 | Ga0099796_102793812 | 189 |
| 187 | 3300010375 | Ga0105239_10000774 | Ga0105239_1000077440 | 189 |
| 188 | 3300010375 | Ga0105239_10002768 | Ga0105239_1000276816 | 189 |
| 189 | 3300010375 | Ga0105239_10370773 | Ga0105239_103707733 | 189 |
| 190 | 3300010375 | Ga0105239_10643758 | Ga0105239_106437582 | 189 |
| 191 | 3300011119 | Ga0105246_10003461 | Ga0105246_100034611 | 189 |
| 192 | 3300013100 | Ga0157373_10082873 | Ga0157373_100828732 | 189 |
| 193 | 3300013100 | Ga0157373_10204846 | Ga0157373_102048461 | 189 |
| 194 | 3300013100 | Ga0157373_10593866 | Ga0157373_105938661 | 189 |
| 195 | 3300013100 | Ga0157373_10712214 | Ga0157373_107122142 | 189 |
| 196 | 3300013104 | Ga0157370_10000551 | Ga0157370_100005511 | 189 |
| 197 | 3300013104 | Ga0157370_10064231 | Ga0157370_100642313 | 189 |
| 198 | 3300013104 | Ga0157370_10766484 | Ga0157370_107664842 | 189 |
| 199 | 3300013105 | Ga0157369_10003839 | Ga0157369_100038397 | 189 |
| 200 | 3300013105 | Ga0157369_10007839 | Ga0157369_100078391 | 189 |
| 201 | 3300013105 | Ga0157369_10015425 | Ga0157369_100154256 | 189 |
| 202 | 3300013105 | Ga0157369_10030078 | Ga0157369_100300782 | 189 |
| 203 | 3300013105 | Ga0157369_10044951 | Ga0157369_100449514 | 189 |
| 204 | 3300013105 | Ga0157369_10108506 | Ga0157369_101085062 | 189 |
| 205 | 3300013105 | Ga0157369_10418142 | Ga0157369_104181422 | 189 |
| 206 | 3300013296 | Ga0157374_10016347 | Ga0157374_100163477 | 189 |
| 207 | 3300013296 | Ga0157374_10023970 | Ga0157374_100239703 | 189 |
| 208 | 3300013296 | Ga0157374_10074553 | Ga0157374_100745531 | 189 |
| 209 | 3300013296 | Ga0157374_10116240 | Ga0157374_101162402 | 189 |
| 210 | 3300013297 | Ga0157378_10016783 | Ga0157378_100167832 | 189 |
| 211 | 3300013297 | Ga0157378_10032514 | Ga0157378_100325144 | 189 |
| 212 | 3300013297 | Ga0157378_10379873 | Ga0157378_103798732 | 189 |
| 213 | 3300013306 | Ga0163162_10024673 | Ga0163162_100246733 | 189 |
| 214 | 3300013306 | Ga0163162_10058550 | Ga0163162_100585503 | 189 |
| 215 | 3300013306 | Ga0163162_10141803 | Ga0163162_101418033 | 189 |
| 216 | 3300013306 | Ga0163162_10259429 | Ga0163162_102594293 | 189 |
| 217 | 3300013307 | Ga0157372_10005803 | Ga0157372_100058036 | 189 |
| 218 | 3300013307 | Ga0157372_10006668 | Ga0157372_100066681 | 189 |
| 219 | 3300013307 | Ga0157372_10010703 | Ga0157372_100107039 | 189 |
| 220 | 3300013307 | Ga0157372_10014027 | Ga0157372_100140273 | 189 |
| 221 | 3300013307 | Ga0157372_10047024 | Ga0157372_100470242 | 189 |
| 222 | 3300013307 | Ga0157372_10063009 | Ga0157372_100630092 | 189 |
| 223 | 3300013307 | Ga0157372_10116382 | Ga0157372_101163823 | 189 |
| 224 | 3300013307 | Ga0157372_10415637 | Ga0157372_104156371 | 189 |
| 225 | 3300013308 | Ga0157375_10214497 | Ga0157375_102144973 | 189 |
| 226 | 3300013308 | Ga0157375_10285207 | Ga0157375_102852073 | 189 |
| 227 | 3300014325 | Ga0163163_10017078 | Ga0163163_100170783 | 189 |
| 228 | 3300014325 | Ga0163163_10032735 | Ga0163163_100327353 | 189 |
| 229 | 3300014326 | Ga0157380_10810029 | Ga0157380_108100291 | 189 |
| 230 | 3300014745 | Ga0157377_10033415 | Ga0157377_100334153 | 189 |
| 231 | 3300014968 | Ga0157379_10163555 | Ga0157379_101635553 | 189 |
| 232 | 3300014968 | Ga0157379_11327067 | Ga0157379_113270671 | 189 |
| 233 | 3300014969 | Ga0157376_10045790 | Ga0157376_100457903 | 189 |
| 234 | 3300021377 | Ga0213874_10038429 | Ga0213874_100384292 | 189 |
| 235 | 3300021384 | Ga0213876_10100797 | Ga0213876_101007973 | 189 |
| 236 | 3300025898 | Ga0207692_10385213 | Ga0207692_103852132 | 189 |
| 237 | 3300025900 | Ga0207710_10540326 | Ga0207710_105403261 | 189 |
| 238 | 3300025903 | Ga0207680_10368433 | Ga0207680_103684331 | 189 |
| 239 | 3300025903 | Ga0207680_10733382 | Ga0207680_107333821 | 189 |
| 240 | 3300025904 | Ga0207647_10102334 | Ga0207647_101023342 | 189 |
| 241 | 3300025906 | Ga0207699_10279718 | Ga0207699_102797182 | 189 |
| 242 | 3300025909 | Ga0207705_10137292 | Ga0207705_101372922 | 189 |
| 243 | 3300025910 | Ga0207684_10170016 | Ga0207684_101700162 | 189 |
| 244 | 3300025911 | Ga0207654_10000199 | Ga0207654_100001995 | 189 |
| 245 | 3300025911 | Ga0207654_10000895 | Ga0207654_1000089518 | 189 |
| 246 | 3300025911 | Ga0207654_10068570 | Ga0207654_100685703 | 189 |
| 247 | 3300025911 | Ga0207654_10382050 | Ga0207654_103820501 | 189 |
| 248 | 3300025911 | Ga0207654_10757775 | Ga0207654_107577751 | 189 |
| 249 | 3300025912 | Ga0207707_10028131 | Ga0207707_100281313 | 189 |
| 250 | 3300025913 | Ga0207695_10000140 | Ga0207695_10000140136 | 189 |
| 251 | 3300025913 | Ga0207695_10000598 | Ga0207695_1000059848 | 189 |
| 252 | 3300025913 | Ga0207695_10003747 | Ga0207695_100037475 | 189 |
| 253 | 3300025913 | Ga0207695_10006234 | Ga0207695_1000623410 | 189 |
| 254 | 3300025913 | Ga0207695_10009144 | Ga0207695_100091441 | 189 |
| 255 | 3300025913 | Ga0207695_10050325 | Ga0207695_100503253 | 189 |
| 256 | 3300025913 | Ga0207695_10059352 | Ga0207695_100593522 | 189 |
| 257 | 3300025913 | Ga0207695_10070209 | Ga0207695_100702092 | 189 |
| 258 | 3300025914 | Ga0207671_10000238 | Ga0207671_1000023841 | 189 |
| 259 | 3300025914 | Ga0207671_10021522 | Ga0207671_100215224 | 189 |
| 260 | 3300025914 | Ga0207671_10083537 | Ga0207671_100835372 | 189 |
| 261 | 3300025914 | Ga0207671_10208312 | Ga0207671_102083122 | 189 |
| 262 | 3300025915 | Ga0207693_10094815 | Ga0207693_100948152 | 189 |
| 263 | 3300025919 | Ga0207657_10016644 | Ga0207657_100166446 | 189 |
| 264 | 3300025919 | Ga0207657_10111521 | Ga0207657_101115211 | 189 |
| 265 | 3300025920 | Ga0207649_10005989 | Ga0207649_100059896 | 189 |
| 266 | 3300025920 | Ga0207649_10010222 | Ga0207649_100102223 | 189 |
| 267 | 3300025920 | Ga0207649_10027404 | Ga0207649_100274042 | 189 |
| 268 | 3300025921 | Ga0207652_10093605 | Ga0207652_100936052 | 189 |
| 269 | 3300025922 | Ga0207646_10531634 | Ga0207646_105316342 | 189 |
| 270 | 3300025924 | Ga0207694_10000089 | Ga0207694_1000008953 | 189 |
| 271 | 3300025924 | Ga0207694_10010521 | Ga0207694_100105213 | 189 |
| 272 | 3300025924 | Ga0207694_10133418 | Ga0207694_101334184 | 189 |
| 273 | 3300025924 | Ga0207694_10408270 | Ga0207694_104082701 | 189 |
| 274 | 3300025925 | Ga0207650_10366431 | Ga0207650_103664313 | 189 |
| 275 | 3300025927 | Ga0207687_10049294 | Ga0207687_100492943 | 189 |
| 276 | 3300025927 | Ga0207687_10094432 | Ga0207687_100944324 | 189 |
| 277 | 3300025928 | Ga0207700_10007625 | Ga0207700_100076254 | 189 |
| 278 | 3300025928 | Ga0207700_11034987 | Ga0207700_110349871 | 189 |
| 279 | 3300025929 | Ga0207664_10097944 | Ga0207664_100979443 | 189 |
| 280 | 3300025931 | Ga0207644_10100681 | Ga0207644_101006812 | 189 |
| 281 | 3300025931 | Ga0207644_10555685 | Ga0207644_105556852 | 189 |
| 282 | 3300025932 | Ga0207690_10080188 | Ga0207690_100801883 | 189 |
| 283 | 3300025932 | Ga0207690_10164842 | Ga0207690_101648422 | 189 |
| 284 | 3300025934 | Ga0207686_10172529 | Ga0207686_101725292 | 189 |
| 285 | 3300025935 | Ga0207709_10508780 | Ga0207709_105087802 | 189 |
| 286 | 3300025939 | Ga0207665_10177772 | Ga0207665_101777721 | 189 |
| 287 | 3300025941 | Ga0207711_10011350 | Ga0207711_100113505 | 189 |
| 288 | 3300025941 | Ga0207711_10276489 | Ga0207711_102764893 | 189 |
| 289 | 3300025941 | Ga0207711_10876909 | Ga0207711_108769091 | 189 |
| 290 | 3300025942 | Ga0207689_10016215 | Ga0207689_100162154 | 189 |
| 291 | 3300025944 | Ga0207661_10420771 | Ga0207661_104207711 | 189 |
| 292 | 3300025944 | Ga0207661_10762629 | Ga0207661_107626292 | 189 |
| 293 | 3300025945 | Ga0207679_10117883 | Ga0207679_101178832 | 189 |
| 294 | 3300025949 | Ga0207667_10003663 | Ga0207667_1000366314 | 189 |
| 295 | 3300025949 | Ga0207667_10015492 | Ga0207667_100154926 | 189 |
| 296 | 3300025949 | Ga0207667_10024692 | Ga0207667_100246926 | 189 |
| 297 | 3300025949 | Ga0207667_10483402 | Ga0207667_104834022 | 189 |
| 298 | 3300025961 | Ga0207712_10149745 | Ga0207712_101497452 | 189 |
| 299 | 3300025981 | Ga0207640_10005029 | Ga0207640_100050296 | 189 |
| 300 | 3300026023 | Ga0207677_10117985 | Ga0207677_101179853 | 189 |
| 301 | 3300026035 | Ga0207703_10626090 | Ga0207703_106260901 | 189 |
| 302 | 3300026041 | Ga0207639_10000103 | Ga0207639_1000010350 | 189 |
| 303 | 3300026041 | Ga0207639_10350905 | Ga0207639_103509052 | 189 |
| 304 | 3300026078 | Ga0207702_10000476 | Ga0207702_1000047641 | 189 |
| 305 | 3300026078 | Ga0207702_10056874 | Ga0207702_100568742 | 189 |
| 306 | 3300026078 | Ga0207702_10082161 | Ga0207702_100821612 | 189 |
| 307 | 3300026078 | Ga0207702_10162907 | Ga0207702_101629072 | 189 |
| 308 | 3300026078 | Ga0207702_10217070 | Ga0207702_102170703 | 189 |
| 309 | 3300026088 | Ga0207641_10043481 | Ga0207641_100434813 | 189 |
| 310 | 3300026088 | Ga0207641_10189111 | Ga0207641_101891113 | 189 |
| 311 | 3300026088 | Ga0207641_10966959 | Ga0207641_109669591 | 189 |
| 312 | 3300026089 | Ga0207648_10195419 | Ga0207648_101954193 | 189 |
| 313 | 3300026116 | Ga0207674_10033118 | Ga0207674_100331185 | 189 |
| 314 | 3300026116 | Ga0207674_10257727 | Ga0207674_102577272 | 189 |
| 315 | 3300026121 | Ga0207683_11264264 | Ga0207683_112642641 | 189 |
| 316 | 3300026142 | Ga0207698_10000384 | Ga0207698_1000038424 | 189 |
| 317 | 3300026142 | Ga0207698_10000478 | Ga0207698_1000047819 | 189 |
| 318 | 3300026142 | Ga0207698_10701802 | Ga0207698_107018022 | 189 |
| 319 | 3300026142 | Ga0207698_10705369 | Ga0207698_107053692 | 189 |
| 320 | 3300026142 | Ga0207698_10934886 | Ga0207698_109348862 | 189 |
| 321 | 3300028379 | Ga0268266_10005700 | Ga0268266_100057004 | 189 |
| 322 | 3300028379 | Ga0268266_10009337 | Ga0268266_100093379 | 189 |
| 323 | 3300028379 | Ga0268266_10104666 | Ga0268266_101046662 | 189 |
| 324 | 3300028379 | Ga0268266_10422850 | Ga0268266_104228502 | 189 |
| 325 | 3300028380 | Ga0268265_10060108 | Ga0268265_100601081 | 189 |
| 326 | 3300028381 | Ga0268264_10002796 | Ga0268264_100027962 | 189 |
| 327 | 3300028800 | Ga0265338_10005935 | Ga0265338_1000593511 | 189 |
| 328 | 3300031235 | Ga0265330_10003108 | Ga0265330_100031084 | 189 |
| 329 | 3300031241 | Ga0265325_10014967 | Ga0265325_100149671 | 189 |
| 330 | 3300031247 | Ga0265340_10013862 | Ga0265340_100138623 | 189 |
| 331 | 3300031247 | Ga0265340_10033712 | Ga0265340_100337123 | 189 |
| 332 | 3300031249 | Ga0265339_10000115 | Ga0265339_1000011516 | 189 |
| 333 | 3300031344 | Ga0265316_10000483 | Ga0265316_1000048331 | 189 |
| 334 | 3300031344 | Ga0265316_10011046 | Ga0265316_100110466 | 189 |
| 335 | 3300031595 | Ga0265313_10014671 | Ga0265313_100146713 | 189 |
| 336 | 3300031711 | Ga0265314_10005286 | Ga0265314_1000528610 | 189 |
| 337 | 3300031712 | Ga0265342_10003593 | Ga0265342_100035935 | 189 |
| 338 | 3300035086 | Ga0373934_0029018 | Ga0373934_0029018_1120_1791 | 189 |
| 339 | 3300035118 | Ga0373954_0002366 | Ga0373954_0002366_4611_5282 | 189 |
| 340 | 3300036401 | Ga0373937_0018848 | Ga0373937_0018848_81_752 | 189 |
| 341 | 3300036401 | Ga0373937_0131977 | Ga0373937_0131977_1239_1808 | 189 |
| 342 | 3300036401 | Ga0373937_0203395 | Ga0373937_0203395_1013_1681 | 189 |
| 343 | 3300037068 | Ga0373925_0509378 | Ga0373925_0509378_201_770 | 189 |
| 344 | 3300037418 | Ga0395900_0988160 | Ga0395900_0988160_113_682 | 189 |
| 345 | 3300037471 | Ga0395905_1033671 | Ga0395905_1033671_24_695 | 189 |
| 346 | 3300037853 | Ga0436364_0652936 | Ga0436364_0652936_1083_1652 | 189 |
| 347 | 3300037853 | Ga0436364_0664343 | Ga0436364_0664343_185_883 | 189 |
| 348 | 3300037853 | Ga0436364_0689426 | Ga0436364_0689426_519_1088 | 189 |
| 349 | 3300038443 | Ga0395901_0479660 | Ga0395901_0479660_41_610 | 189 |
| 350 | 3300039437 | Ga0436365_0840158 | Ga0436365_0840158_176_745 | 189 |
| 351 | 3300039437 | Ga0436365_1012460 | Ga0436365_1012460_2063_2632 | 189 |
| 352 | 3300039450 | Ga0436363_1669288 | Ga0436363_1669288_2465_3043 | 189 |
| 353 | 3300039453 | Ga0436362_0502258 | Ga0436362_0502258_787_1389 | 189 |
| 354 | 3300044656 | Ga0466969_0010407 | Ga0466969_0010407_4254_4865 | 189 |
| 355 | 3300044693 | Ga0466961_0346133 | Ga0466961_0346133_50_619 | 189 |
| 356 | 3300045049 | Ga0466959_0105907 | Ga0466959_0105907_506_1081 | 189 |
| 357 | 3300045049 | Ga0466959_0246305 | Ga0466959_0246305_392_964 | 189 |
| 358 | 3300045976 | Ga0466967_0088177 | Ga0466967_0088177_2146_2718 | 189 |
| 359 | 3300045976 | Ga0466967_0794303 | Ga0466967_0794303_31_600 | 189 |
| 360 | 3300046472 | Ga0495580_0307649 | Ga0495580_0307649_259_930 | 189 |
| 361 | 3300046473 | Ga0495582_0168196 | Ga0495582_0168196_143_748 | 189 |
| 362 | 3300046477 | Ga0495664_0092329 | Ga0495664_0092329_20_691 | 189 |
| 363 | 3300046506 | Ga0495583_0015467 | Ga0495583_0015467_2542_3111 | 189 |
| 364 | 3300046517 | Ga0495630_0229486 | Ga0495630_0229486_45_650 | 189 |
| 365 | 3300046536 | Ga0495587_0087732 | Ga0495587_0087732_336_905 | 189 |
| 366 | 3300046543 | Ga0495645_0159360 | Ga0495645_0159360_364_933 | 189 |
| 367 | 3300046664 | Ga0495659_0190159 | Ga0495659_0190159_45_716 | 189 |
| 368 | 3300046679 | Ga0495623_0146466 | Ga0495623_0146466_168_839 | 189 |
| 369 | 3300046684 | Ga0495669_0238500 | Ga0495669_0238500_222_848 | 189 |
| 370 | 3300046694 | Ga0495649_0034599 | Ga0495649_0034599_1984_2553 | 189 |
| 371 | 3300047319 | Ga0495674_0210794 | Ga0495674_0210794_970_1539 | 189 |
| 372 | 3300047322 | Ga0495680_0055464 | Ga0495680_0055464_1396_1965 | 189 |
| 373 | 3300047444 | Ga0495675_0067335 | Ga0495675_0067335_783_1454 | 189 |
| 374 | 3300048088 | Ga0495602_0179302 | Ga0495602_0179302_376_1047 | 189 |
| 375 | 3300048910 | Ga0496107_1002715 | Ga0496107_1002715_14_583 | 189 |
| 376 | 3300048912 | Ga0496109_0639478 | Ga0496109_0639478_332_901 | 189 |
| 377 | 3300048915 | Ga0496112_0030904 | Ga0496112_0030904_1832_2440 | 189 |
| 378 | 3300048918 | Ga0496115_0341216 | Ga0496115_0341216_246_908 | 189 |
| 379 | 3300049568 | Ga0501031_0069011 | Ga0501031_0069011_1542_2111 | 189 |
| 380 | 3300049569 | Ga0501032_0005694 | Ga0501032_0005694_6046_6615 | 189 |
| 381 | 3300049570 | Ga0501033_0016470 | Ga0501033_0016470_1517_2086 | 189 |
| 382 | 3300049571 | Ga0501034_0032539 | Ga0501034_0032539_1548_2117 | 189 |
| 383 | 3300049571 | Ga0501034_0107538 | Ga0501034_0107538_724_1293 | 189 |
| 384 | 3300049572 | Ga0501036_0002362 | Ga0501036_0002362_4763_5332 | 189 |
| 385 | 3300049573 | Ga0501037_0098611 | Ga0501037_0098611_1383_1952 | 189 |
| 386 | 3300049573 | Ga0501037_0531684 | Ga0501037_0531684_208_777 | 189 |
| 387 | 3300049574 | Ga0501038_0001714 | Ga0501038_0001714_11641_12210 | 189 |
| 388 | 3300049575 | Ga0501039_0026679 | Ga0501039_0026679_1605_2174 | 189 |
| 389 | 3300049579 | Ga0501043_0001558 | Ga0501043_0001558_16210_16779 | 189 |
| 390 | 3300049580 | Ga0501046_0017839 | Ga0501046_0017839_1648_2217 | 189 |
| 391 | 3300049580 | Ga0501046_0139341 | Ga0501046_0139341_1078_1647 | 189 |
| 392 | 3300049580 | Ga0501046_0556477 | Ga0501046_0556477_144_713 | 189 |
| 393 | 3300049581 | Ga0501047_0030142 | Ga0501047_0030142_721_1326 | 189 |
| 394 | 3300049581 | Ga0501047_0038439 | Ga0501047_0038439_1486_2055 | 189 |
| 395 | 3300049581 | Ga0501047_0073647 | Ga0501047_0073647_91_660 | 189 |
| 396 | 3300049582 | Ga0501048_0032174 | Ga0501048_0032174_1599_2168 | 189 |
| 397 | 3300049583 | Ga0501067_0003293 | Ga0501067_0003293_6173_6742 | 189 |
| 398 | 3300049584 | Ga0501068_0003742 | Ga0501068_0003742_4120_4689 | 189 |
| 399 | 3300049585 | Ga0501069_0001370 | Ga0501069_0001370_9017_9586 | 189 |
| 400 | 3300049586 | Ga0501070_0006167 | Ga0501070_0006167_5364_5933 | 189 |
| 401 | 3300049586 | Ga0501070_0065249 | Ga0501070_0065249_163_732 | 189 |
| 402 | 3300049586 | Ga0501070_0247561 | Ga0501070_0247561_797_1402 | 189 |
| 403 | 3300049588 | Ga0501072_0437121 | Ga0501072_0437121_181_750 | 189 |
| 404 | 3300049589 | Ga0501073_0014857 | Ga0501073_0014857_181_750 | 189 |
| 405 | 3300049590 | Ga0501074_0016298 | Ga0501074_0016298_3571_4140 | 189 |
| 406 | 3300049592 | Ga0501076_0075402 | Ga0501076_0075402_825_1394 | 189 |
| 407 | 3300049593 | Ga0501077_0038685 | Ga0501077_0038685_856_1425 | 189 |
| 408 | 3300049741 | Ga0501079_0039504 | Ga0501079_0039504_181_750 | 189 |
| 409 | 3300049742 | Ga0501080_0002238 | Ga0501080_0002238_2144_2713 | 189 |
| 410 | 3300049744 | Ga0501083_0037014 | Ga0501083_0037014_2576_3145 | 189 |
| 411 | 3300049822 | Ga0501035_0093966 | Ga0501035_0093966_287_856 | 189 |
| 412 | 3300049823 | Ga0501044_0001033 | Ga0501044_0001033_28466_29071 | 189 |
| 413 | 3300049823 | Ga0501044_0015346 | Ga0501044_0015346_3178_3747 | 189 |
| 414 | 3300049823 | Ga0501044_0187134 | Ga0501044_0187134_1047_1673 | 189 |
| 415 | 3300050507 | nmdc:mga05p37_312819_c1 | nmdc:mga05p37_312819_c1_1034_1603 | 189 |
| 416 | 3300050511 | nmdc:mga08y16_1562744_c1 | nmdc:mga08y16_1562744_c1_33_602 | 189 |
| 417 | 3300050512 | nmdc:mga0n895_420573_c1 | nmdc:mga0n895_420573_c1_699_1268 | 189 |
| 418 | 3300050514 | nmdc:mga08x19_37414_c1 | nmdc:mga08x19_37414_c1_2263_2961 | 189 |
| 419 | 3300050514 | nmdc:mga08x19_498157_c1 | nmdc:mga08x19_498157_c1_187_756 | 189 |
| 420 | 3300060353 | Ga0501082_0003190 | Ga0501082_0003190_8375_8944 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2kl4-assembly1.cif.gz_A | nmr structure of the protein nb7804a | 0.5915 | 3 | 109 |
| 3s0h-assembly1.cif.gz_A | the crystal structure of the periplasmic domain of helicobacter pylori motb (residues 90-256). | 0.5825 | 44 | 65 |
| 2oc6-assembly2.cif.gz_B | crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution | 0.5687 | 10 | 114 |
| 3ckg-assembly1.cif.gz_A | the crystal structure of ospa deletion mutant | 0.5592 | 25 | 94 |
| 6kwu-assembly1.cif.gz_O | a crystal structure of ospa mutant | 0.5558 | 25 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.9702 | 9 | 106 | 3.90.1150.200 |
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.8299 | 9 | 106 | 3.90.1150.200 |
| af_P0AAT2_2_121_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.6924 | 10 | 114 | 3.90.1150.30 |
| 3swgA02 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.6808 | 13 | 43 | 3.65.10.10 |
| 1dq3A02 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.6706 | 12 | 43 | 3.30.160.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3JG60-F1-model_v4 | YdhG-like domain-containing protein | 0.9887 | 9 | 119 |
|
| AF-A0A316DEU9-F1-model_v4 | Uncharacterized protein DUF1801 | 0.9887 | 7 | 101 |
|
| AF-A0A7V9ZMH7-F1-model_v4 | DUF1801 domain-containing protein | 0.9846 | 6 | 119 |
|
| AF-Q4A027-F1-model_v4 | Uncharacterized protein | 0.9842 | 125 | 186 |
|
| AF-A0A5C7FL00-F1-model_v4 | deleted | 0.9822 | 23 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar