F439779

General Info

Members Datasets Scaffolds Average Seq Length
420 226 420 166

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0009571|Ga0373935_0009571_2094_2657
Length 187
Sequence MGGDRANSWLEPAFIGPHKEIKKMSEPFIAEIKIISWNFPPKGWTFCNGQLLPINQNQALFSILGTTYGGDGRTTFGLPNLQGRMPVHVGNGIVLGELGGETAHTLNISELPAHAHTPRANHTAPTLSVAAGNVWADNPSQYNSTSNTAMSPTCIAATGGNQPHENMSPYLVLNFIIALQGIFPSQN

Samples

Sample ID Description Type Environment
1 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
74 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
75 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.19
Metatranscriptomes 8.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.52
Rhizosphere 93.57
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24030J14995_100774 3300001426 Bacteria 1073
2 JGI24748J21848_1000038 3300002074 Bacteria 69882
3 JGI24034J26672_10000041 3300002239 Bacteria 69886
4 JGI25406J46586_10017123 3300003203 Bacteria 3003
5 JGI25406J46586_10049873 3300003203 Bacteria 1409
6 rootH1_10131938 3300003316 Bacteria 1275
7 rootL2_10286159 3300003322 Bacteria 1939
8 Ga0058863_10009159 3300004799 Bacteria 2870
9 Ga0058863_10014517 3300004799 Bacteria 1910
10 Ga0058863_11888212 3300004799 Bacteria 1386
11 Ga0058861_10042818 3300004800 Bacteria 2267
12 Ga0058861_11607165 3300004800 Bacteria 1057
13 Ga0058862_10106663 3300004803 Bacteria 1665
14 Ga0058862_10114140 3300004803 Bacteria 1814
15 Ga0058862_10130740 3300004803 Bacteria 1331
16 Ga0058862_12485591 3300004803 Bacteria 1651
17 Ga0058862_12787001 3300004803 Bacteria 3034
18 Ga0070658_10088529 3300005327 Bacteria 2549
19 Ga0070683_100038919 3300005329 Bacteria 4362
20 Ga0070683_100938186 3300005329 Bacteria 830
21 Ga0070670_100829687 3300005331 Bacteria 836
22 Ga0070680_100013475 3300005336 Bacteria 6368
23 Ga0070680_100672798 3300005336 Bacteria 890
24 Ga0070682_100501785 3300005337 Bacteria 940
25 Ga0068868_100161512 3300005338 Bacteria 1850
26 Ga0068868_101001430 3300005338 Unclassified 764
27 Ga0070689_100965517 3300005340 Bacteria 757
28 Ga0070661_100138957 3300005344 Bacteria 1830
29 Ga0070692_10111401 3300005345 Bacteria 1514
30 Ga0070669_100495666 3300005353 Viruses 1013
31 Ga0070675_100145194 3300005354 Bacteria 2031
32 Ga0070671_100023908 3300005355 Bacteria 5000
33 Ga0070673_100543280 3300005364 Bacteria 1055
34 Ga0070709_10018088 3300005434 Bacteria 4052
35 Ga0070714_100027525 3300005435 Bacteria 4708
36 Ga0070714_100039174 3300005435 Bacteria 3988
37 Ga0070714_100053321 3300005435 Bacteria 3451
38 Ga0070714_100061879 3300005435 Bacteria 3216
39 Ga0070714_100348473 3300005435 Bacteria 1390
40 Ga0070714_100575576 3300005435 Bacteria 1080
41 Ga0070714_100590714 3300005435 Bacteria 1066
42 Ga0070714_101249931 3300005435 Bacteria 725
43 Ga0070713_100036604 3300005436 Bacteria 3961
44 Ga0070713_100051515 3300005436 Bacteria 3404
45 Ga0070713_100110295 3300005436 Bacteria 2398
46 Ga0070713_100192056 3300005436 Bacteria 1840
47 Ga0070713_100390886 3300005436 Bacteria 1297
48 Ga0070713_101143076 3300005436 Bacteria 753
49 Ga0070710_10064779 3300005437 Bacteria 2091
50 Ga0070711_100179662 3300005439 Bacteria 1619
51 Ga0070711_100512373 3300005439 Bacteria 990
52 Ga0070711_100518807 3300005439 Bacteria 984
53 Ga0070662_101099685 3300005457 Unclassified 682
54 Ga0070681_10018975 3300005458 Bacteria 6883
55 Ga0070681_10097841 3300005458 Bacteria 2881
56 Ga0070681_10113224 3300005458 Bacteria 2652
57 Ga0070681_10154542 3300005458 Bacteria 2220
58 Ga0070681_10294776 3300005458 Bacteria 1532
59 Ga0070681_10960458 3300005458 Bacteria 774
60 Ga0070681_11869709 3300005458 Bacteria 528
61 Ga0070685_10081036 3300005466 Bacteria 1946
62 Ga0070707_100037936 3300005468 Bacteria 4601
63 Ga0070707_100067922 3300005468 Bacteria 3430
64 Ga0070698_100207864 3300005471 Bacteria 1893
65 Ga0070698_100214030 3300005471 Bacteria 1861
66 Ga0070699_100656824 3300005518 Bacteria 957
67 Ga0070699_101589940 3300005518 Bacteria 599
68 Ga0070679_100012341 3300005530 Bacteria 8161
69 Ga0070679_100365368 3300005530 Bacteria 1390
70 Ga0070679_100538586 3300005530 Unclassified 1111
71 Ga0070679_101127983 3300005530 Bacteria 729
72 Ga0070684_100137573 3300005535 Bacteria 2207
73 Ga0070684_100143749 3300005535 Bacteria 2159
74 Ga0070684_100461193 3300005535 Bacteria 1175
75 Ga0070697_100039041 3300005536 Bacteria 3838
76 Ga0070697_100170735 3300005536 Viruses 1841
77 Ga0070697_100174919 3300005536 Bacteria 1818
78 Ga0070697_100382450 3300005536 Bacteria 1219
79 Ga0068853_100015315 3300005539 Bacteria 6301
80 Ga0068853_100147038 3300005539 Bacteria 2119
81 Ga0068853_100198681 3300005539 Bacteria 1824
82 Ga0070695_100229163 3300005545 Viruses 1342
83 Ga0070695_101071650 3300005545 Bacteria 658
84 Ga0070693_100016289 3300005547 Bacteria 3845
85 Ga0068855_100075091 3300005563 Bacteria 3925
86 Ga0068855_100110933 3300005563 Bacteria 3149
87 Ga0068857_100180893 3300005577 Bacteria 1919
88 Ga0068854_100224777 3300005578 Bacteria 1487
89 Ga0068854_100487129 3300005578 Bacteria 1036
90 Ga0068856_100088364 3300005614 Unclassified 3081
91 Ga0068856_100392218 3300005614 Bacteria 1408
92 Ga0068852_100053723 3300005616 Bacteria 3469
93 Ga0068852_100070707 3300005616 Bacteria 3062
94 Ga0068859_100121710 3300005617 Bacteria 2676
95 Ga0068859_100271510 3300005617 Bacteria 1788
96 Ga0068864_100097166 3300005618 Bacteria 2607
97 Ga0068864_100426477 3300005618 Bacteria 1264
98 Ga0068866_10126493 3300005718 Unclassified 1447
99 Ga0068861_100028043 3300005719 Viruses 4106
100 Ga0068861_100920001 3300005719 Bacteria 830
101 Ga0068863_100391089 3300005841 Bacteria 1359
102 Ga0068863_101403663 3300005841 Bacteria 706
103 Ga0068858_100000443 3300005842 Bacteria 43345
104 Ga0068858_100130665 3300005842 Bacteria 2354
105 Ga0068860_100362691 3300005843 Bacteria 1428
106 Ga0068860_101420879 3300005843 Bacteria 715
107 Ga0081539_10008539 3300005985 Bacteria 8872
108 Ga0081539_10059063 3300005985 Bacteria 2113
109 Ga0070717_10187793 3300006028 Bacteria 1804
110 Ga0070717_10195576 3300006028 Bacteria 1769
111 Ga0070717_10323943 3300006028 Bacteria 1373
112 Ga0070717_10335333 3300006028 Bacteria 1350
113 Ga0070717_10519860 3300006028 Bacteria 1077
114 Ga0070717_10664244 3300006028 Unclassified 946
115 Ga0070715_10156900 3300006163 Bacteria 1121
116 Ga0070716_100000020 3300006173 Bacteria 79851
117 Ga0070716_100060387 3300006173 Bacteria 2189
118 Ga0070716_100097115 3300006173 Bacteria 1797
119 Ga0070716_100137428 3300006173 Bacteria 1553
120 Ga0070716_100272237 3300006173 Bacteria 1164
121 Ga0070712_100118577 3300006175 Bacteria 1988
122 Ga0097621_100390981 3300006237 Bacteria 1244
123 Ga0097621_101425337 3300006237 Bacteria 656
124 Ga0075434_100530352 3300006871 Bacteria 1198
125 Ga0075429_100344934 3300006880 Bacteria 1304
126 Ga0075436_100161103 3300006914 Bacteria 1582
127 Ga0097620_100121715 3300006931 Bacteria 2676
128 Ga0097620_100271497 3300006931 Bacteria 1788
129 Ga0099794_10208396 3300007265 Bacteria 1002
130 Ga0105240_10021475 3300009093 Bacteria 8585
131 Ga0105240_10063602 3300009093 Bacteria 4589
132 Ga0105240_10290809 3300009093 Bacteria 1873
133 Ga0105240_10452608 3300009093 Viruses 1436
134 Ga0105245_10055620 3300009098 Bacteria 3555
135 Ga0105245_10059086 3300009098 Bacteria 3452
136 Ga0105245_10078279 3300009098 Unclassified 3017
137 Ga0105245_10229668 3300009098 Bacteria 1794
138 Ga0105245_10790276 3300009098 Bacteria 987
139 Ga0105247_10000142 3300009101 Bacteria 69945
140 Ga0105247_10027397 3300009101 Bacteria 3446
141 Ga0114129_10017606 3300009147 Bacteria 10171
142 Ga0114129_10453026 3300009147 Bacteria 1682
143 Ga0114129_10723077 3300009147 Bacteria 1277
144 Ga0114129_11902271 3300009147 Bacteria 721
145 Ga0105243_10041102 3300009148 Bacteria 3616
146 Ga0105241_10042300 3300009174 Viruses 3446
147 Ga0105241_10440412 3300009174 Bacteria 1151
148 Ga0105242_10077459 3300009176 Bacteria 2774
149 Ga0105237_10122735 3300009545 Bacteria 2592
150 Ga0105237_10367559 3300009545 Bacteria 1443
151 Ga0105237_10850395 3300009545 Bacteria 919
152 Ga0105238_10054798 3300009551 Bacteria 4003
153 Ga0105238_10059886 3300009551 Bacteria 3814
154 Ga0105238_10124492 3300009551 Viruses 2557
155 Ga0105238_10131900 3300009551 Bacteria 2477
156 Ga0105238_10138702 3300009551 Bacteria 2409
157 Ga0105249_10204490 3300009553 Unclassified 1934
158 Ga0130087_1080617 3300009828 Bacteria 1223
159 Ga0130084_1086005 3300009835 Bacteria 1223
160 Ga0130085_1110429 3300009850 Bacteria 1223
161 Ga0105239_10142773 3300010375 Bacteria 2669
162 Ga0105239_10158746 3300010375 Bacteria 2526
163 Ga0105239_10203623 3300010375 Bacteria 2217
164 Ga0105239_10212584 3300010375 Bacteria 2168
165 Ga0105239_10794017 3300010375 Bacteria 1084
166 Ga0105246_10146409 3300011119 Bacteria 1783
167 Ga0105246_10547078 3300011119 Bacteria 991
168 Ga0157373_10211005 3300013100 Bacteria 1369
169 Ga0157371_10083293 3300013102 Bacteria 2265
170 Ga0157370_11274075 3300013104 Bacteria 662
171 Ga0157369_10083856 3300013105 Bacteria 3407
172 Ga0157369_10141790 3300013105 Bacteria 2543
173 Ga0157369_10469505 3300013105 Bacteria 1303
174 Ga0157369_10523041 3300013105 Unclassified 1227
175 Ga0157369_10910286 3300013105 Bacteria 902
176 Ga0157374_10000057 3300013296 Bacteria 117036
177 Ga0157374_10091147 3300013296 Bacteria 2906
178 Ga0157374_10130340 3300013296 Bacteria 2433
179 Ga0157374_10855991 3300013296 Bacteria 926
180 Ga0157374_11403319 3300013296 Bacteria 721
181 Ga0157378_10009411 3300013297 Bacteria 8512
182 Ga0157378_10042091 3300013297 Bacteria 4053
183 Ga0157378_10070160 3300013297 Bacteria 3145
184 Ga0157378_10257656 3300013297 Viruses 1672
185 Ga0163162_10022461 3300013306 Bacteria 6215
186 Ga0157372_10128180 3300013307 Bacteria 2918
187 Ga0157372_10748581 3300013307 Bacteria 1136
188 Ga0157372_10833420 3300013307 Unclassified 1071
189 Ga0157375_10413114 3300013308 Bacteria 1516
190 Ga0163163_10554391 3300014325 Bacteria 1212
191 Ga0163163_11719288 3300014325 Bacteria 688
192 Ga0157379_10010007 3300014968 Bacteria 8262
193 Ga0157376_10000581 3300014969 Bacteria 23586
194 Ga0163161_10407681 3300017792 Viruses 1091
195 Ga0206349_1402693 3300020075 Bacteria 1659
196 Ga0206349_1442471 3300020075 Bacteria 641
197 Ga0206355_1626827 3300020076 Bacteria 775
198 Ga0206351_10745108 3300020077 Bacteria 1815
199 Ga0206352_10867125 3300020078 Bacteria 1649
200 Ga0206350_11091030 3300020080 Bacteria 1379
201 Ga0206350_11545301 3300020080 Bacteria 1711
202 Ga0206353_10287839 3300020082 Bacteria 1105
203 Ga0206353_11977533 3300020082 Bacteria 1308
204 Ga0154015_1206444 3300020610 Bacteria 2254
205 Ga0213876_10000935 3300021384 Bacteria 19266
206 Ga0224712_10015526 3300022467 Bacteria 2480
207 Ga0207672_1000598 3300025223 Bacteria 4312
208 Ga0207692_10042396 3300025898 Bacteria 2258
209 Ga0207692_10202146 3300025898 Bacteria 1169
210 Ga0207642_10484864 3300025899 Bacteria 755
211 Ga0207710_10000001 3300025900 Bacteria 1797433
212 Ga0207688_10710067 3300025901 Unclassified 636
213 Ga0207699_10609297 3300025906 Bacteria 795
214 Ga0207699_10619660 3300025906 Bacteria 789
215 Ga0207645_10543469 3300025907 Bacteria 788
216 Ga0207705_10056642 3300025909 Bacteria 2827
217 Ga0207654_10018445 3300025911 Unclassified 3662
218 Ga0207707_10053555 3300025912 Bacteria 3512
219 Ga0207707_10070523 3300025912 Bacteria 3045
220 Ga0207707_10245798 3300025912 Bacteria 1555
221 Ga0207707_10251354 3300025912 Bacteria 1536
222 Ga0207707_10386455 3300025912 Bacteria 1203
223 Ga0207695_10046391 3300025913 Bacteria 4606
224 Ga0207695_10304135 3300025913 Bacteria 1486
225 Ga0207695_10474643 3300025913 Bacteria 1133
226 Ga0207695_10652926 3300025913 Viruses 933
227 Ga0207671_10230097 3300025914 Bacteria 1454
228 Ga0207693_10044388 3300025915 Bacteria 3494
229 Ga0207693_10052290 3300025915 Bacteria 3204
230 Ga0207693_10284243 3300025915 Bacteria 1296
231 Ga0207693_10388031 3300025915 Bacteria 1092
232 Ga0207663_10045613 3300025916 Bacteria 2697
233 Ga0207663_10977959 3300025916 Unclassified 678
234 Ga0207660_10039376 3300025917 Bacteria 3304
235 Ga0207660_10364456 3300025917 Bacteria 1160
236 Ga0207652_10040248 3300025921 Bacteria 3968
237 Ga0207652_10084114 3300025921 Bacteria 2787
238 Ga0207652_10219572 3300025921 Bacteria 1713
239 Ga0207652_10537311 3300025921 Bacteria 1051
240 Ga0207646_10244209 3300025922 Bacteria 1622
241 Ga0207681_10394272 3300025923 Viruses 1117
242 Ga0207694_10010839 3300025924 Bacteria 6881
243 Ga0207694_10194066 3300025924 Bacteria 1650
244 Ga0207694_10313566 3300025924 Bacteria 1293
245 Ga0207694_10418342 3300025924 Bacteria 1116
246 Ga0207694_10718021 3300025924 Bacteria 843
247 Ga0207687_10033159 3300025927 Bacteria 3501
248 Ga0207687_10061902 3300025927 Bacteria 2644
249 Ga0207700_10024041 3300025928 Bacteria 4212
250 Ga0207700_10181528 3300025928 Bacteria 1762
251 Ga0207700_10281318 3300025928 Bacteria 1431
252 Ga0207700_10282678 3300025928 Bacteria 1428
253 Ga0207700_10330193 3300025928 Bacteria 1324
254 Ga0207664_10009227 3300025929 Bacteria 6911
255 Ga0207664_10050398 3300025929 Bacteria 3283
256 Ga0207664_10214233 3300025929 Unclassified 1668
257 Ga0207664_10390372 3300025929 Bacteria 1237
258 Ga0207664_10419437 3300025929 Bacteria 1192
259 Ga0207664_10437088 3300025929 Bacteria 1167
260 Ga0207664_10612113 3300025929 Bacteria 978
261 Ga0207644_10002643 3300025931 Bacteria 11538
262 Ga0207686_10114083 3300025934 Bacteria 1828
263 Ga0207709_10043185 3300025935 Bacteria 2716
264 Ga0207665_10000045 3300025939 Bacteria 79809
265 Ga0207665_10004993 3300025939 Bacteria 8853
266 Ga0207665_10133736 3300025939 Bacteria 1763
267 Ga0207665_10175068 3300025939 Bacteria 1551
268 Ga0207665_10182802 3300025939 Bacteria 1519
269 Ga0207689_11031144 3300025942 Unclassified 694
270 Ga0207661_10076723 3300025944 Bacteria 2745
271 Ga0207661_10263634 3300025944 Bacteria 1536
272 Ga0207661_10277585 3300025944 Bacteria 1497
273 Ga0207661_10293168 3300025944 Bacteria 1456
274 Ga0207667_10017037 3300025949 Bacteria 8197
275 Ga0207667_10089435 3300025949 Bacteria 3183
276 Ga0207651_10234911 3300025960 Bacteria 1491
277 Ga0207640_10293547 3300025981 Bacteria 1283
278 Ga0207677_10147573 3300026023 Bacteria 1810
279 Ga0207703_10000818 3300026035 Bacteria 30635
280 Ga0207703_10628617 3300026035 Bacteria 1017
281 Ga0207639_10006234 3300026041 Bacteria 8103
282 Ga0207639_10145553 3300026041 Bacteria 1979
283 Ga0207639_10204415 3300026041 Bacteria 1696
284 Ga0207639_10269866 3300026041 Bacteria 1492
285 Ga0207702_10019229 3300026078 Bacteria 5650
286 Ga0207641_10117211 3300026088 Bacteria 2371
287 Ga0207676_10008732 3300026095 Bacteria 7207
288 Ga0207676_11046568 3300026095 Bacteria 805
289 Ga0207676_11137768 3300026095 Viruses 772
290 Ga0207674_10016690 3300026116 Bacteria 8025
291 Ga0207674_10505484 3300026116 Bacteria 1167
292 Ga0207675_100010289 3300026118 Bacteria 8763
293 Ga0207698_10061432 3300026142 Bacteria 2928
294 Ga0207698_10296865 3300026142 Bacteria 1502
295 Ga0209588_1026432 3300027671 Bacteria 1843
296 Ga0268264_11234707 3300028381 Bacteria 757
297 Ga0265320_10108765 3300031240 Bacteria 1271
298 Ga0265316_10838555 3300031344 Bacteria 644
299 Ga0307513_10431979 3300031456 Bacteria 1045
300 Ga0373926_0120841 3300035083 Bacteria 987
301 Ga0373932_0045218 3300035112 Bacteria 1287
302 Ga0373945_0002570 3300035116 Bacteria 5680
303 Ga0373956_0536145 3300035119 Bacteria 559
304 Ga0373957_0100386 3300035120 Bacteria 1158
305 Ga0373943_0044770 3300035170 Bacteria 2154
306 Ga0373946_0019647 3300035171 Bacteria 2604
307 Ga0373955_0000430 3300035172 Bacteria 17725
308 Ga0373924_0000790 3300035410 Bacteria 9864
309 Ga0373924_0063212 3300035410 Bacteria 1552
310 Ga0373924_0074524 3300035410 Bacteria 1436
311 Ga0373935_0009571 3300035692 Bacteria 5801
312 Ga0373935_0134835 3300035692 Bacteria 1662
313 Ga0373935_0737676 3300035692 Bacteria 725
314 Ga0373935_1157583 3300035692 Bacteria 576
315 Ga0373927_0307459 3300035695 Bacteria 1043
316 Ga0373927_0400805 3300035695 Bacteria 905
317 Ga0373947_0006211 3300035725 Bacteria 6948
318 Ga0373947_0024403 3300035725 Bacteria 3523
319 Ga0373937_0014490 3300036401 Bacteria 6963
320 Ga0373937_0166046 3300036401 Bacteria 2070
321 Ga0373937_0221186 3300036401 Bacteria 1782
322 Ga0373937_0276837 3300036401 Bacteria 1584
323 Ga0373937_1119977 3300036401 Bacteria 736
324 Ga0373925_0089845 3300037068 Bacteria 2347
325 Ga0373925_0211609 3300037068 Bacteria 1544
326 Ga0373925_0494805 3300037068 Bacteria 1003
327 Ga0395898_0590910 3300037466 Bacteria 1053
328 Ga0395898_1113410 3300037466 Bacteria 723
329 Ga0395905_0092273 3300037471 Bacteria 2840
330 Ga0436364_0361650 3300037853 Bacteria 764
331 Ga0436365_0231947 3300039437 Bacteria 692
332 Ga0436365_1526301 3300039437 Bacteria 136420
333 Ga0436365_1827113 3300039437 Unclassified 3952
334 Ga0436361_0456810 3300039447 Bacteria 1226
335 Ga0436362_0195829 3300039453 Bacteria 883
336 Ga0439443_001161 3300042003 Bacteria 2792
337 Ga0451577_0126127 3300042876 Unclassified 2294
338 Ga0451577_0530825 3300042876 Bacteria 1069
339 Ga0466963_0002995 3300044694 Bacteria 9555
340 Ga0466963_0141577 3300044694 Bacteria 1666
341 Ga0453684_0250050 3300044712 Bacteria 2036
342 Ga0453684_0290350 3300044712 Unclassified 1862
343 Ga0466957_0000161 3300044842 Bacteria 29452
344 Ga0466957_0528473 3300044842 Bacteria 820
345 Ga0451576_0015906 3300045051 Bacteria 8318
346 Ga0451576_0495546 3300045051 Bacteria 1283
347 Ga0466958_0053979 3300045836 Bacteria 2436
348 Ga0466967_0005761 3300045976 Bacteria 8654
349 Ga0495603_0712258 3300046455 Bacteria 574
350 Ga0495651_0077384 3300046462 Bacteria 2518
351 Ga0495651_0410415 3300046462 Bacteria 882
352 Ga0495582_0136647 3300046473 Bacteria 1387
353 Ga0495605_0008611 3300046474 Bacteria 5763
354 Ga0495639_0062195 3300046475 Bacteria 1712
355 Ga0495639_0222992 3300046475 Bacteria 927
356 Ga0495594_0528495 3300046499 Bacteria 670
357 Ga0495628_0062836 3300046516 Bacteria 2910
358 Ga0495630_0137873 3300046517 Bacteria 1854
359 Ga0495663_0154408 3300046525 Bacteria 785
360 Ga0495666_0144901 3300046526 Bacteria 1106
361 Ga0495665_0050350 3300046531 Bacteria 2208
362 Ga0495586_0069299 3300046535 Bacteria 1925
363 Ga0495598_0021997 3300046537 Bacteria 1702
364 Ga0495621_0059202 3300046539 Bacteria 1387
365 Ga0495633_0256070 3300046558 Bacteria 798
366 Ga0495667_0135622 3300046559 Bacteria 1587
367 Ga0495635_0276247 3300046663 Bacteria 1129
368 Ga0495659_0019682 3300046664 Bacteria 2259
369 Ga0495599_0555185 3300046678 Bacteria 672
370 Ga0495623_0024374 3300046679 Bacteria 3899
371 Ga0495669_0115522 3300046684 Bacteria 1256
372 Ga0495669_0364488 3300046684 Bacteria 699
373 Ga0495624_0150204 3300046690 Bacteria 1425
374 Ga0495670_0434886 3300046691 Bacteria 710
375 Ga0495581_0017964 3300047315 Bacteria 4110
376 Ga0495604_0061859 3300047317 Bacteria 2862
377 Ga0495604_0411001 3300047317 Bacteria 890
378 Ga0495680_0271033 3300047322 Bacteria 1199
379 Ga0495675_0216083 3300047444 Bacteria 1162
380 Ga0495684_0279397 3300047471 Bacteria 1205
381 Ga0495614_0081032 3300048089 Bacteria 1406
382 Ga0495615_0175006 3300048090 Bacteria 651
383 Ga0496101_0644677 3300048904 Bacteria 837
384 Ga0496102_0002198 3300048905 Bacteria 16755
385 Ga0496102_0091220 3300048905 Unclassified 2820
386 Ga0496103_0158610 3300048906 Bacteria 1451
387 Ga0496103_0167383 3300048906 Bacteria 1410
388 Ga0496104_0054009 3300048907 Bacteria 3797
389 Ga0496104_0108276 3300048907 Bacteria 2663
390 Ga0496104_0195602 3300048907 Unclassified 1934
391 Ga0496107_0595903 3300048910 Bacteria 817
392 Ga0496110_0194957 3300048913 Bacteria 1839
393 Ga0496110_0764593 3300048913 Viruses 870
394 Ga0496111_0002956 3300048914 Bacteria 10401
395 Ga0496112_0000254 3300048915 Bacteria 34068
396 Ga0496112_0199819 3300048915 Bacteria 1959
397 Ga0496112_0280264 3300048915 Bacteria 1614
398 Ga0496112_0946498 3300048915 Bacteria 782
399 Ga0496113_0002528 3300048916 Bacteria 10662
400 Ga0496113_0170555 3300048916 Bacteria 1723
401 Ga0496113_0458489 3300048916 Bacteria 1024
402 nmdc:mga05p37_1342_c1 3300050507 Bacteria 28603
403 nmdc:mga05p37_142968_c1 3300050507 Bacteria 2554
404 nmdc:mga05p37_292721_c1 3300050507 Bacteria 1937
405 nmdc:mga0n895_1290605_c1 3300050512 Unclassified 701
406 nmdc:mga0n895_456523_c1 3300050512 Bacteria 1290
407 nmdc:mga08x19_149428_c1 3300050514 Bacteria 1581
408 Ga0587066_043148 3300059490 Bacteria 858
409 Ga0587070_012929 3300059491 Viruses 1278
410 Ga0587077_003172 3300059493 Bacteria 2041
411 Ga0587091_004455 3300059511 Bacteria 1842
412 Ga0587092_001776 3300059512 Bacteria 2181
413 Ga0587068_023087 3300059641 Bacteria 1034
414 Ga0587069_003443 3300059642 Bacteria 1708
415 Ga0587072_012897 3300059643 Bacteria 1386
416 Ga0587076_000747 3300059645 Bacteria 2911
417 Ga0587079_009935 3300059647 Bacteria 1495
418 Ga0587079_018946 3300059647 Bacteria 1213
419 Ga0587119_005186 3300059658 Bacteria 1325
420 Ga0587060_001905 3300060243 Bacteria 1415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0074524 Ga0373924_0074524_1003_1419 136
2 3300009098 Ga0105245_10059086 Ga0105245_100590863 141
3 3300013296 Ga0157374_10855991 Ga0157374_108559912 141
4 3300013297 Ga0157378_10042091 Ga0157378_100420915 141
5 3300025927 Ga0207687_10061902 Ga0207687_100619023 141
6 3300037471 Ga0395905_0092273 Ga0395905_0092273_1553_2053 147
7 3300048906 Ga0496103_0167383 Ga0496103_0167383_234_734 147
8 3300005340 Ga0070689_100965517 Ga0070689_1009655172 151
9 3300006237 Ga0097621_100390981 Ga0097621_1003909812 151
10 3300026088 Ga0207641_10117211 Ga0207641_101172112 151
11 3300006028 Ga0070717_10664244 Ga0070717_106642442 152
12 3300044842 Ga0466957_0000161 Ga0466957_0000161_10115_10609 152
13 3300045836 Ga0466958_0053979 Ga0466958_0053979_1667_2161 152
14 3300005331 Ga0070670_100829687 Ga0070670_1008296871 154
15 3300005354 Ga0070675_100145194 Ga0070675_1001451942 154
16 3300005364 Ga0070673_100543280 Ga0070673_1005432801 154
17 3300005617 Ga0068859_100271510 Ga0068859_1002715102 154
18 3300005618 Ga0068864_100097166 Ga0068864_1000971664 154
19 3300005843 Ga0068860_100362691 Ga0068860_1003626913 154
20 3300006931 Ga0097620_100271497 Ga0097620_1002714972 154
21 3300009101 Ga0105247_10027397 Ga0105247_100273974 154
22 3300011119 Ga0105246_10547078 Ga0105246_105470782 154
23 3300025960 Ga0207651_10234911 Ga0207651_102349112 154
24 3300026095 Ga0207676_11046568 Ga0207676_110465682 154
25 3300028381 Ga0268264_11234707 Ga0268264_112347072 154
26 3300005578 Ga0068854_100487129 Ga0068854_1004871291 158
27 3300048905 Ga0496102_0002198 Ga0496102_0002198_778_1311 158
28 3300003203 JGI25406J46586_10017123 JGI25406J46586_100171232 159
29 3300003203 JGI25406J46586_10049873 JGI25406J46586_100498732 159
30 3300005985 Ga0081539_10008539 Ga0081539_100085398 159
31 3300005985 Ga0081539_10059063 Ga0081539_100590632 159
32 3300037466 Ga0395898_0590910 Ga0395898_0590910_100_591 159
33 3300046537 Ga0495598_0021997 Ga0495598_0021997_987_1481 159
34 3300046539 Ga0495621_0059202 Ga0495621_0059202_464_958 159
35 3300046558 Ga0495633_0256070 Ga0495633_0256070_143_637 159
36 3300046664 Ga0495659_0019682 Ga0495659_0019682_1165_1659 159
37 3300046684 Ga0495669_0115522 Ga0495669_0115522_580_1074 159
38 3300046691 Ga0495670_0434886 Ga0495670_0434886_137_631 159
39 3300005327 Ga0070658_10088529 Ga0070658_100885292 161
40 3300013102 Ga0157371_10083293 Ga0157371_100832931 161
41 3300013105 Ga0157369_10523041 Ga0157369_105230412 161
42 3300013307 Ga0157372_10833420 Ga0157372_108334202 161
43 3300025909 Ga0207705_10056642 Ga0207705_100566422 161
44 3300037466 Ga0395898_1113410 Ga0395898_1113410_94_585 161
45 3300005436 Ga0070713_101143076 Ga0070713_1011430761 162
46 3300005536 Ga0070697_100174919 Ga0070697_1001749192 162
47 3300006173 Ga0070716_100000020 Ga0070716_10000002068 162
48 3300009147 Ga0114129_11902271 Ga0114129_119022711 162
49 3300025939 Ga0207665_10000045 Ga0207665_100000454 162
50 3300027671 Ga0209588_1026432 Ga0209588_10264322 162
51 3300050507 nmdc:mga05p37_142968_c1 nmdc:mga05p37_142968_c1_2009_2503 162
52 3300050512 nmdc:mga0n895_1290605_c1 nmdc:mga0n895_1290605_c1_181_672 162
53 3300004799 Ga0058863_10014517 Ga0058863_100145173 163
54 3300004799 Ga0058863_11888212 Ga0058863_118882122 163
55 3300004803 Ga0058862_10114140 Ga0058862_101141402 163
56 3300005329 Ga0070683_100938186 Ga0070683_1009381862 163
57 3300005435 Ga0070714_100039174 Ga0070714_1000391743 163
58 3300005435 Ga0070714_100348473 Ga0070714_1003484732 163
59 3300005435 Ga0070714_100575576 Ga0070714_1005755762 163
60 3300005435 Ga0070714_101249931 Ga0070714_1012499311 163
61 3300005436 Ga0070713_100192056 Ga0070713_1001920562 163
62 3300005436 Ga0070713_100390886 Ga0070713_1003908862 163
63 3300005439 Ga0070711_100512373 Ga0070711_1005123731 163
64 3300005458 Ga0070681_10097841 Ga0070681_100978413 163
65 3300005530 Ga0070679_100538586 Ga0070679_1005385862 163
66 3300005530 Ga0070679_101127983 Ga0070679_1011279832 163
67 3300005563 Ga0068855_100075091 Ga0068855_1000750913 163
68 3300005841 Ga0068863_101403663 Ga0068863_1014036632 163
69 3300006028 Ga0070717_10323943 Ga0070717_103239433 163
70 3300009093 Ga0105240_10063602 Ga0105240_100636024 163
71 3300009098 Ga0105245_10055620 Ga0105245_100556202 163
72 3300009545 Ga0105237_10122735 Ga0105237_101227353 163
73 3300009551 Ga0105238_10059886 Ga0105238_100598863 163
74 3300009551 Ga0105238_10138702 Ga0105238_101387022 163
75 3300010375 Ga0105239_10158746 Ga0105239_101587463 163
76 3300010375 Ga0105239_10794017 Ga0105239_107940172 163
77 3300013104 Ga0157370_11274075 Ga0157370_112740751 163
78 3300013105 Ga0157369_10141790 Ga0157369_101417902 163
79 3300013307 Ga0157372_10128180 Ga0157372_101281804 163
80 3300014325 Ga0163163_10554391 Ga0163163_105543912 163
81 3300021384 Ga0213876_10000935 Ga0213876_1000093516 163
82 3300025906 Ga0207699_10619660 Ga0207699_106196601 163
83 3300025912 Ga0207707_10053555 Ga0207707_100535553 163
84 3300025913 Ga0207695_10046391 Ga0207695_100463914 163
85 3300025915 Ga0207693_10284243 Ga0207693_102842431 163
86 3300025917 Ga0207660_10364456 Ga0207660_103644562 163
87 3300025921 Ga0207652_10084114 Ga0207652_100841142 163
88 3300025921 Ga0207652_10219572 Ga0207652_102195723 163
89 3300025924 Ga0207694_10010839 Ga0207694_100108393 163
90 3300025927 Ga0207687_10033159 Ga0207687_100331592 163
91 3300025928 Ga0207700_10282678 Ga0207700_102826782 163
92 3300025928 Ga0207700_10330193 Ga0207700_103301932 163
93 3300025929 Ga0207664_10214233 Ga0207664_102142333 163
94 3300025929 Ga0207664_10419437 Ga0207664_104194372 163
95 3300025944 Ga0207661_10277585 Ga0207661_102775852 163
96 3300025949 Ga0207667_10017037 Ga0207667_100170373 163
97 3300035083 Ga0373926_0120841 Ga0373926_0120841_317_811 163
98 3300035116 Ga0373945_0002570 Ga0373945_0002570_3681_4175 163
99 3300035120 Ga0373957_0100386 Ga0373957_0100386_224_718 163
100 3300035170 Ga0373943_0044770 Ga0373943_0044770_594_1088 163
101 3300035171 Ga0373946_0019647 Ga0373946_0019647_1615_2109 163
102 3300035410 Ga0373924_0000790 Ga0373924_0000790_4231_4725 163
103 3300035692 Ga0373935_0009571 Ga0373935_0009571_2094_2657 163
104 3300035692 Ga0373935_0134835 Ga0373935_0134835_623_1117 163
105 3300035695 Ga0373927_0307459 Ga0373927_0307459_496_990 163
106 3300035725 Ga0373947_0006211 Ga0373947_0006211_1555_2118 163
107 3300035725 Ga0373947_0024403 Ga0373947_0024403_875_1369 163
108 3300036401 Ga0373937_0014490 Ga0373937_0014490_1023_1520 163
109 3300036401 Ga0373937_0276837 Ga0373937_0276837_717_1214 163
110 3300037068 Ga0373925_0211609 Ga0373925_0211609_997_1491 163
111 3300037068 Ga0373925_0494805 Ga0373925_0494805_20_514 163
112 3300037853 Ga0436364_0361650 Ga0436364_0361650_159_653 163
113 3300039437 Ga0436365_0231947 Ga0436365_0231947_92_625 163
114 3300039437 Ga0436365_1526301 Ga0436365_1526301_119134_119631 163
115 3300039453 Ga0436362_0195829 Ga0436362_0195829_326_823 163
116 3300042003 Ga0439443_001161 Ga0439443_001161_1416_1943 163
117 3300042876 Ga0451577_0530825 Ga0451577_0530825_475_969 163
118 3300044694 Ga0466963_0141577 Ga0466963_0141577_972_1466 163
119 3300044712 Ga0453684_0250050 Ga0453684_0250050_906_1400 163
120 3300044842 Ga0466957_0528473 Ga0466957_0528473_187_681 163
121 3300045051 Ga0451576_0015906 Ga0451576_0015906_7630_8124 163
122 3300046455 Ga0495603_0712258 Ga0495603_0712258_46_540 163
123 3300046473 Ga0495582_0136647 Ga0495582_0136647_123_617 163
124 3300046475 Ga0495639_0062195 Ga0495639_0062195_944_1438 163
125 3300046517 Ga0495630_0137873 Ga0495630_0137873_744_1238 163
126 3300046525 Ga0495663_0154408 Ga0495663_0154408_198_698 163
127 3300046526 Ga0495666_0144901 Ga0495666_0144901_232_726 163
128 3300046531 Ga0495665_0050350 Ga0495665_0050350_418_981 163
129 3300046535 Ga0495586_0069299 Ga0495586_0069299_1112_1606 163
130 3300046559 Ga0495667_0135622 Ga0495667_0135622_376_870 163
131 3300046663 Ga0495635_0276247 Ga0495635_0276247_296_790 163
132 3300046678 Ga0495599_0555185 Ga0495599_0555185_134_631 163
133 3300046679 Ga0495623_0024374 Ga0495623_0024374_288_785 163
134 3300046684 Ga0495669_0364488 Ga0495669_0364488_37_537 163
135 3300046690 Ga0495624_0150204 Ga0495624_0150204_458_952 163
136 3300047315 Ga0495581_0017964 Ga0495581_0017964_3370_3864 163
137 3300048089 Ga0495614_0081032 Ga0495614_0081032_338_832 163
138 3300048090 Ga0495615_0175006 Ga0495615_0175006_60_560 163
139 3300048907 Ga0496104_0054009 Ga0496104_0054009_1852_2346 163
140 3300048915 Ga0496112_0000254 Ga0496112_0000254_32131_32625 163
141 3300048916 Ga0496113_0002528 Ga0496113_0002528_6158_6652 163
142 3300001426 JGI24030J14995_100774 JGI24030J14995_1007742 164
143 3300002074 JGI24748J21848_1000038 JGI24748J21848_100003867 164
144 3300002239 JGI24034J26672_10000041 JGI24034J26672_1000004168 164
145 3300003316 rootH1_10131938 rootH1_101319381 164
146 3300003322 rootL2_10286159 rootL2_102861593 164
147 3300004799 Ga0058863_10009159 Ga0058863_100091593 164
148 3300004800 Ga0058861_10042818 Ga0058861_100428182 164
149 3300004800 Ga0058861_11607165 Ga0058861_116071652 164
150 3300004803 Ga0058862_10106663 Ga0058862_101066632 164
151 3300004803 Ga0058862_10130740 Ga0058862_101307402 164
152 3300004803 Ga0058862_12485591 Ga0058862_124855912 164
153 3300004803 Ga0058862_12787001 Ga0058862_127870013 164
154 3300005329 Ga0070683_100038919 Ga0070683_1000389192 164
155 3300005336 Ga0070680_100013475 Ga0070680_1000134753 164
156 3300005336 Ga0070680_100672798 Ga0070680_1006727981 164
157 3300005337 Ga0070682_100501785 Ga0070682_1005017852 164
158 3300005338 Ga0068868_100161512 Ga0068868_1001615122 164
159 3300005338 Ga0068868_101001430 Ga0068868_1010014302 164
160 3300005344 Ga0070661_100138957 Ga0070661_1001389572 164
161 3300005345 Ga0070692_10111401 Ga0070692_101114012 164
162 3300005353 Ga0070669_100495666 Ga0070669_1004956661 164
163 3300005355 Ga0070671_100023908 Ga0070671_1000239083 164
164 3300005434 Ga0070709_10018088 Ga0070709_100180883 164
165 3300005435 Ga0070714_100027525 Ga0070714_1000275255 164
166 3300005435 Ga0070714_100053321 Ga0070714_1000533213 164
167 3300005435 Ga0070714_100061879 Ga0070714_1000618793 164
168 3300005435 Ga0070714_100590714 Ga0070714_1005907142 164
169 3300005436 Ga0070713_100036604 Ga0070713_1000366043 164
170 3300005436 Ga0070713_100051515 Ga0070713_1000515154 164
171 3300005436 Ga0070713_100110295 Ga0070713_1001102953 164
172 3300005437 Ga0070710_10064779 Ga0070710_100647793 164
173 3300005439 Ga0070711_100179662 Ga0070711_1001796621 164
174 3300005439 Ga0070711_100518807 Ga0070711_1005188071 164
175 3300005457 Ga0070662_101099685 Ga0070662_1010996851 164
176 3300005458 Ga0070681_10018975 Ga0070681_100189754 164
177 3300005458 Ga0070681_10113224 Ga0070681_101132244 164
178 3300005458 Ga0070681_10154542 Ga0070681_101545423 164
179 3300005458 Ga0070681_10294776 Ga0070681_102947763 164
180 3300005458 Ga0070681_10960458 Ga0070681_109604581 164
181 3300005458 Ga0070681_11869709 Ga0070681_118697091 164
182 3300005466 Ga0070685_10081036 Ga0070685_100810361 164
183 3300005468 Ga0070707_100037936 Ga0070707_1000379367 164
184 3300005468 Ga0070707_100067922 Ga0070707_1000679221 164
185 3300005471 Ga0070698_100207864 Ga0070698_1002078642 164
186 3300005471 Ga0070698_100214030 Ga0070698_1002140302 164
187 3300005518 Ga0070699_100656824 Ga0070699_1006568241 164
188 3300005518 Ga0070699_101589940 Ga0070699_1015899401 164
189 3300005530 Ga0070679_100012341 Ga0070679_1000123413 164
190 3300005530 Ga0070679_100365368 Ga0070679_1003653683 164
191 3300005535 Ga0070684_100137573 Ga0070684_1001375732 164
192 3300005535 Ga0070684_100143749 Ga0070684_1001437493 164
193 3300005535 Ga0070684_100461193 Ga0070684_1004611932 164
194 3300005536 Ga0070697_100039041 Ga0070697_1000390415 164
195 3300005536 Ga0070697_100170735 Ga0070697_1001707352 164
196 3300005536 Ga0070697_100382450 Ga0070697_1003824501 164
197 3300005539 Ga0068853_100015315 Ga0068853_1000153153 164
198 3300005539 Ga0068853_100147038 Ga0068853_1001470382 164
199 3300005539 Ga0068853_100198681 Ga0068853_1001986813 164
200 3300005545 Ga0070695_100229163 Ga0070695_1002291631 164
201 3300005545 Ga0070695_101071650 Ga0070695_1010716501 164
202 3300005547 Ga0070693_100016289 Ga0070693_1000162893 164
203 3300005563 Ga0068855_100110933 Ga0068855_1001109332 164
204 3300005577 Ga0068857_100180893 Ga0068857_1001808933 164
205 3300005578 Ga0068854_100224777 Ga0068854_1002247772 164
206 3300005614 Ga0068856_100088364 Ga0068856_1000883643 164
207 3300005614 Ga0068856_100392218 Ga0068856_1003922182 164
208 3300005616 Ga0068852_100053723 Ga0068852_1000537233 164
209 3300005616 Ga0068852_100070707 Ga0068852_1000707072 164
210 3300005617 Ga0068859_100121710 Ga0068859_1001217102 164
211 3300005618 Ga0068864_100426477 Ga0068864_1004264772 164
212 3300005718 Ga0068866_10126493 Ga0068866_101264933 164
213 3300005719 Ga0068861_100028043 Ga0068861_1000280432 164
214 3300005719 Ga0068861_100920001 Ga0068861_1009200012 164
215 3300005841 Ga0068863_100391089 Ga0068863_1003910891 164
216 3300005842 Ga0068858_100000443 Ga0068858_10000044330 164
217 3300005842 Ga0068858_100130665 Ga0068858_1001306654 164
218 3300005843 Ga0068860_101420879 Ga0068860_1014208791 164
219 3300006028 Ga0070717_10187793 Ga0070717_101877932 164
220 3300006028 Ga0070717_10195576 Ga0070717_101955763 164
221 3300006028 Ga0070717_10335333 Ga0070717_103353333 164
222 3300006028 Ga0070717_10519860 Ga0070717_105198602 164
223 3300006163 Ga0070715_10156900 Ga0070715_101569001 164
224 3300006173 Ga0070716_100060387 Ga0070716_1000603873 164
225 3300006173 Ga0070716_100097115 Ga0070716_1000971152 164
226 3300006173 Ga0070716_100137428 Ga0070716_1001374282 164
227 3300006173 Ga0070716_100272237 Ga0070716_1002722372 164
228 3300006175 Ga0070712_100118577 Ga0070712_1001185772 164
229 3300006237 Ga0097621_101425337 Ga0097621_1014253372 164
230 3300006871 Ga0075434_100530352 Ga0075434_1005303522 164
231 3300006880 Ga0075429_100344934 Ga0075429_1003449343 164
232 3300006914 Ga0075436_100161103 Ga0075436_1001611033 164
233 3300006931 Ga0097620_100121715 Ga0097620_1001217152 164
234 3300007265 Ga0099794_10208396 Ga0099794_102083962 164
235 3300009093 Ga0105240_10021475 Ga0105240_1002147510 164
236 3300009093 Ga0105240_10290809 Ga0105240_102908092 164
237 3300009093 Ga0105240_10452608 Ga0105240_104526082 164
238 3300009098 Ga0105245_10078279 Ga0105245_100782793 164
239 3300009098 Ga0105245_10229668 Ga0105245_102296682 164
240 3300009098 Ga0105245_10790276 Ga0105245_107902762 164
241 3300009101 Ga0105247_10000142 Ga0105247_100001423 164
242 3300009147 Ga0114129_10017606 Ga0114129_1001760610 164
243 3300009147 Ga0114129_10453026 Ga0114129_104530263 164
244 3300009147 Ga0114129_10723077 Ga0114129_107230772 164
245 3300009148 Ga0105243_10041102 Ga0105243_100411024 164
246 3300009174 Ga0105241_10042300 Ga0105241_100423003 164
247 3300009174 Ga0105241_10440412 Ga0105241_104404122 164
248 3300009176 Ga0105242_10077459 Ga0105242_100774594 164
249 3300009545 Ga0105237_10367559 Ga0105237_103675593 164
250 3300009545 Ga0105237_10850395 Ga0105237_108503952 164
251 3300009551 Ga0105238_10054798 Ga0105238_100547982 164
252 3300009551 Ga0105238_10124492 Ga0105238_101244923 164
253 3300009551 Ga0105238_10131900 Ga0105238_101319002 164
254 3300009553 Ga0105249_10204490 Ga0105249_102044903 164
255 3300009828 Ga0130087_1080617 Ga0130087_10806172 164
256 3300009835 Ga0130084_1086005 Ga0130084_10860052 164
257 3300009850 Ga0130085_1110429 Ga0130085_11104292 164
258 3300010375 Ga0105239_10142773 Ga0105239_101427733 164
259 3300010375 Ga0105239_10203623 Ga0105239_102036233 164
260 3300010375 Ga0105239_10212584 Ga0105239_102125843 164
261 3300011119 Ga0105246_10146409 Ga0105246_101464092 164
262 3300013100 Ga0157373_10211005 Ga0157373_102110052 164
263 3300013105 Ga0157369_10083856 Ga0157369_100838563 164
264 3300013105 Ga0157369_10469505 Ga0157369_104695052 164
265 3300013105 Ga0157369_10910286 Ga0157369_109102862 164
266 3300013296 Ga0157374_10000057 Ga0157374_1000005755 164
267 3300013296 Ga0157374_10091147 Ga0157374_100911474 164
268 3300013296 Ga0157374_10130340 Ga0157374_101303403 164
269 3300013296 Ga0157374_11403319 Ga0157374_114033192 164
270 3300013297 Ga0157378_10009411 Ga0157378_100094113 164
271 3300013297 Ga0157378_10070160 Ga0157378_100701603 164
272 3300013297 Ga0157378_10257656 Ga0157378_102576562 164
273 3300013306 Ga0163162_10022461 Ga0163162_100224619 164
274 3300013307 Ga0157372_10748581 Ga0157372_107485812 164
275 3300013308 Ga0157375_10413114 Ga0157375_104131142 164
276 3300014325 Ga0163163_11719288 Ga0163163_117192882 164
277 3300014968 Ga0157379_10010007 Ga0157379_100100073 164
278 3300014969 Ga0157376_10000581 Ga0157376_100005816 164
279 3300017792 Ga0163161_10407681 Ga0163161_104076812 164
280 3300020075 Ga0206349_1402693 Ga0206349_14026932 164
281 3300020075 Ga0206349_1442471 Ga0206349_14424711 164
282 3300020076 Ga0206355_1626827 Ga0206355_16268272 164
283 3300020077 Ga0206351_10745108 Ga0206351_107451082 164
284 3300020078 Ga0206352_10867125 Ga0206352_108671252 164
285 3300020080 Ga0206350_11091030 Ga0206350_110910302 164
286 3300020080 Ga0206350_11545301 Ga0206350_115453012 164
287 3300020082 Ga0206353_10287839 Ga0206353_102878392 164
288 3300020082 Ga0206353_11977533 Ga0206353_119775331 164
289 3300020610 Ga0154015_1206444 Ga0154015_12064443 164
290 3300022467 Ga0224712_10015526 Ga0224712_100155262 164
291 3300025223 Ga0207672_1000598 Ga0207672_10005983 164
292 3300025898 Ga0207692_10042396 Ga0207692_100423963 164
293 3300025898 Ga0207692_10202146 Ga0207692_102021462 164
294 3300025899 Ga0207642_10484864 Ga0207642_104848642 164
295 3300025900 Ga0207710_10000001 Ga0207710_100000011309 164
296 3300025901 Ga0207688_10710067 Ga0207688_107100671 164
297 3300025906 Ga0207699_10609297 Ga0207699_106092971 164
298 3300025907 Ga0207645_10543469 Ga0207645_105434692 164
299 3300025911 Ga0207654_10018445 Ga0207654_100184453 164
300 3300025912 Ga0207707_10070523 Ga0207707_100705232 164
301 3300025912 Ga0207707_10245798 Ga0207707_102457983 164
302 3300025912 Ga0207707_10251354 Ga0207707_102513542 164
303 3300025912 Ga0207707_10386455 Ga0207707_103864551 164
304 3300025913 Ga0207695_10304135 Ga0207695_103041352 164
305 3300025913 Ga0207695_10474643 Ga0207695_104746432 164
306 3300025913 Ga0207695_10652926 Ga0207695_106529262 164
307 3300025914 Ga0207671_10230097 Ga0207671_102300972 164
308 3300025915 Ga0207693_10044388 Ga0207693_100443882 164
309 3300025915 Ga0207693_10052290 Ga0207693_100522902 164
310 3300025915 Ga0207693_10388031 Ga0207693_103880312 164
311 3300025916 Ga0207663_10045613 Ga0207663_100456133 164
312 3300025916 Ga0207663_10977959 Ga0207663_109779591 164
313 3300025917 Ga0207660_10039376 Ga0207660_100393763 164
314 3300025921 Ga0207652_10040248 Ga0207652_100402483 164
315 3300025921 Ga0207652_10537311 Ga0207652_105373112 164
316 3300025922 Ga0207646_10244209 Ga0207646_102442093 164
317 3300025923 Ga0207681_10394272 Ga0207681_103942721 164
318 3300025924 Ga0207694_10194066 Ga0207694_101940662 164
319 3300025924 Ga0207694_10313566 Ga0207694_103135663 164
320 3300025924 Ga0207694_10418342 Ga0207694_104183422 164
321 3300025924 Ga0207694_10718021 Ga0207694_107180212 164
322 3300025928 Ga0207700_10024041 Ga0207700_100240414 164
323 3300025928 Ga0207700_10181528 Ga0207700_101815282 164
324 3300025928 Ga0207700_10281318 Ga0207700_102813182 164
325 3300025929 Ga0207664_10009227 Ga0207664_100092277 164
326 3300025929 Ga0207664_10050398 Ga0207664_100503983 164
327 3300025929 Ga0207664_10390372 Ga0207664_103903722 164
328 3300025929 Ga0207664_10437088 Ga0207664_104370882 164
329 3300025929 Ga0207664_10612113 Ga0207664_106121132 164
330 3300025931 Ga0207644_10002643 Ga0207644_100026433 164
331 3300025934 Ga0207686_10114083 Ga0207686_101140832 164
332 3300025935 Ga0207709_10043185 Ga0207709_100431853 164
333 3300025939 Ga0207665_10004993 Ga0207665_100049933 164
334 3300025939 Ga0207665_10133736 Ga0207665_101337361 164
335 3300025939 Ga0207665_10175068 Ga0207665_101750682 164
336 3300025939 Ga0207665_10182802 Ga0207665_101828022 164
337 3300025942 Ga0207689_11031144 Ga0207689_110311441 164
338 3300025944 Ga0207661_10076723 Ga0207661_100767233 164
339 3300025944 Ga0207661_10263634 Ga0207661_102636342 164
340 3300025944 Ga0207661_10293168 Ga0207661_102931682 164
341 3300025949 Ga0207667_10089435 Ga0207667_100894354 164
342 3300025981 Ga0207640_10293547 Ga0207640_102935472 164
343 3300026023 Ga0207677_10147573 Ga0207677_101475732 164
344 3300026035 Ga0207703_10000818 Ga0207703_1000081823 164
345 3300026035 Ga0207703_10628617 Ga0207703_106286172 164
346 3300026041 Ga0207639_10006234 Ga0207639_100062343 164
347 3300026041 Ga0207639_10145553 Ga0207639_101455532 164
348 3300026041 Ga0207639_10204415 Ga0207639_102044153 164
349 3300026041 Ga0207639_10269866 Ga0207639_102698663 164
350 3300026078 Ga0207702_10019229 Ga0207702_100192295 164
351 3300026095 Ga0207676_10008732 Ga0207676_100087327 164
352 3300026095 Ga0207676_11137768 Ga0207676_111377682 164
353 3300026116 Ga0207674_10016690 Ga0207674_100166906 164
354 3300026116 Ga0207674_10505484 Ga0207674_105054842 164
355 3300026118 Ga0207675_100010289 Ga0207675_1000102895 164
356 3300026142 Ga0207698_10061432 Ga0207698_100614323 164
357 3300026142 Ga0207698_10296865 Ga0207698_102968652 164
358 3300031240 Ga0265320_10108765 Ga0265320_101087652 164
359 3300031344 Ga0265316_10838555 Ga0265316_108385551 164
360 3300031456 Ga0307513_10431979 Ga0307513_104319792 164
361 3300035112 Ga0373932_0045218 Ga0373932_0045218_538_1038 164
362 3300035119 Ga0373956_0536145 Ga0373956_0536145_35_532 164
363 3300035172 Ga0373955_0000430 Ga0373955_0000430_11068_11568 164
364 3300035410 Ga0373924_0063212 Ga0373924_0063212_869_1369 164
365 3300035692 Ga0373935_0737676 Ga0373935_0737676_29_529 164
366 3300035692 Ga0373935_1157583 Ga0373935_1157583_43_540 164
367 3300035695 Ga0373927_0400805 Ga0373927_0400805_299_799 164
368 3300036401 Ga0373937_0166046 Ga0373937_0166046_572_1072 164
369 3300036401 Ga0373937_0221186 Ga0373937_0221186_418_918 164
370 3300036401 Ga0373937_1119977 Ga0373937_1119977_125_622 164
371 3300037068 Ga0373925_0089845 Ga0373925_0089845_1253_1753 164
372 3300039437 Ga0436365_1827113 Ga0436365_1827113_944_1441 164
373 3300039447 Ga0436361_0456810 Ga0436361_0456810_263_760 164
374 3300042876 Ga0451577_0126127 Ga0451577_0126127_268_765 164
375 3300044694 Ga0466963_0002995 Ga0466963_0002995_3277_3774 164
376 3300044712 Ga0453684_0290350 Ga0453684_0290350_328_825 164
377 3300045051 Ga0451576_0495546 Ga0451576_0495546_695_1192 164
378 3300045976 Ga0466967_0005761 Ga0466967_0005761_150_647 164
379 3300046462 Ga0495651_0077384 Ga0495651_0077384_1121_1618 164
380 3300046462 Ga0495651_0410415 Ga0495651_0410415_204_710 164
381 3300046474 Ga0495605_0008611 Ga0495605_0008611_2134_2676 164
382 3300046475 Ga0495639_0222992 Ga0495639_0222992_354_854 164
383 3300046499 Ga0495594_0528495 Ga0495594_0528495_141_641 164
384 3300046516 Ga0495628_0062836 Ga0495628_0062836_1198_1695 164
385 3300047317 Ga0495604_0061859 Ga0495604_0061859_1055_1552 164
386 3300047317 Ga0495604_0411001 Ga0495604_0411001_291_797 164
387 3300047322 Ga0495680_0271033 Ga0495680_0271033_320_817 164
388 3300047444 Ga0495675_0216083 Ga0495675_0216083_575_1072 164
389 3300047471 Ga0495684_0279397 Ga0495684_0279397_409_912 164
390 3300048904 Ga0496101_0644677 Ga0496101_0644677_274_771 164
391 3300048905 Ga0496102_0091220 Ga0496102_0091220_2131_2628 164
392 3300048906 Ga0496103_0158610 Ga0496103_0158610_611_1108 164
393 3300048907 Ga0496104_0108276 Ga0496104_0108276_1153_1650 164
394 3300048907 Ga0496104_0195602 Ga0496104_0195602_1285_1782 164
395 3300048910 Ga0496107_0595903 Ga0496107_0595903_46_543 164
396 3300048913 Ga0496110_0194957 Ga0496110_0194957_581_1078 164
397 3300048913 Ga0496110_0764593 Ga0496110_0764593_60_560 164
398 3300048914 Ga0496111_0002956 Ga0496111_0002956_3490_3987 164
399 3300048915 Ga0496112_0199819 Ga0496112_0199819_1232_1729 164
400 3300048915 Ga0496112_0280264 Ga0496112_0280264_525_1022 164
401 3300048915 Ga0496112_0946498 Ga0496112_0946498_57_599 164
402 3300048916 Ga0496113_0170555 Ga0496113_0170555_42_539 164
403 3300048916 Ga0496113_0458489 Ga0496113_0458489_348_848 164
404 3300050507 nmdc:mga05p37_1342_c1 nmdc:mga05p37_1342_c1_10586_11089 164
405 3300050507 nmdc:mga05p37_292721_c1 nmdc:mga05p37_292721_c1_1264_1767 164
406 3300050512 nmdc:mga0n895_456523_c1 nmdc:mga0n895_456523_c1_539_1039 164
407 3300050514 nmdc:mga08x19_149428_c1 nmdc:mga08x19_149428_c1_215_712 164
408 3300059490 Ga0587066_043148 Ga0587066_043148_128_670 164
409 3300059491 Ga0587070_012929 Ga0587070_012929_396_938 164
410 3300059493 Ga0587077_003172 Ga0587077_003172_644_1186 164
411 3300059511 Ga0587091_004455 Ga0587091_004455_805_1302 164
412 3300059512 Ga0587092_001776 Ga0587092_001776_518_1015 164
413 3300059641 Ga0587068_023087 Ga0587068_023087_350_892 164
414 3300059642 Ga0587069_003443 Ga0587069_003443_538_1035 164
415 3300059643 Ga0587072_012897 Ga0587072_012897_532_1074 164
416 3300059645 Ga0587076_000747 Ga0587076_000747_2103_2645 164
417 3300059647 Ga0587079_009935 Ga0587079_009935_396_938 164
418 3300059647 Ga0587079_018946 Ga0587079_018946_38_538 164
419 3300059658 Ga0587119_005186 Ga0587119_005186_612_1109 164
420 3300060243 Ga0587060_001905 Ga0587060_001905_322_864 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

30

86

0.97

Feature Viewer

pLDDT pTM Quality
66.42 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map