F439800

General Info

Members Datasets Scaffolds Average Seq Length
420 292 840 340

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000314|Ga0453684_0000314_5587_6738
Length 383
Sequence MEGERCSAPLFSFFVDKNRLLSIKLENFRPSVTRGRWERRLAEMGKKLWNVAIAGATGAVGNQMIQCLEERNFPVGKIKFLASERSIGKVLDYKGKPVQVELLGHDSFEGIDIALFSAGGSRAQEFCPSAARAGAVCIDNSSAWRMDPDVPLVVPEVNPHAIAGYAKKGIIANPNCSTIQMVVALQPLHQYGTIKRIVVSTYQAVSGTGKKAIDELRIQTGKMLNGMPAEAKVYPYRIAFNCLPQIDSFEPNGYTKEEMKMVNETRKIMESDIRVTATTVRVPVFFGHSESVNIETEKKITVAKAFELLKKAPGCKLVDDVAKKVYPMPIDAAGQDLTFVGRIREDESVENGLNLWVVADNIRKGAATNAVQIAEILIKEYLR

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
169 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
170 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
177 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
178 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
179 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
201 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
202 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
203 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
204 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
205 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
206 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
207 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
208 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
209 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
210 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
228 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
229 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
230 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
231 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
232 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
236 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
237 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
238 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
239 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
240 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
241 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
242 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
243 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
244 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
245 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
246 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
247 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
248 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
249 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
250 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
251 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
252 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
256 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
257 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
258 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
259 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
260 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
261 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
262 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
263 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
264 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
269 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
285 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
286 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
287 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
288 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
289 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
290 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
291 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
292 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.24
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 0.24
Rhizosphere 94.29
Stem 0
Stem Tuber 0
Unclassified 5.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0000314 3300044712 Bacteria 205428
2 SwRhRL2b_contig_1022993 2162886007 Bacteria 1219
3 SwRhRL2b_contig_2470157 2162886007 Bacteria 3198
4 JGI26145J50221_1000424 3300003371 Bacteria 3687
5 JGI26138J51218_100456 3300003504 Bacteria 1632
6 Ga0055536_1003210 3300003781 Bacteria 8863
7 Ga0065704_10003670 3300005289 Bacteria 9459
8 Ga0065704_10080643 3300005289 Bacteria 3908
9 Ga0070676_10004546 3300005328 Bacteria 7310
10 Ga0070683_100012598 3300005329 Bacteria 7351
11 Ga0070683_100227967 3300005329 Bacteria 1771
12 Ga0070690_100000079 3300005330 Bacteria 47120
13 Ga0070690_100017722 3300005330 Bacteria 4290
14 Ga0070690_100030007 3300005330 Bacteria 3376
15 Ga0070670_100010254 3300005331 Bacteria 7996
16 Ga0070670_100041369 3300005331 Bacteria 3961
17 Ga0070677_10002772 3300005333 Bacteria 5609
18 Ga0070666_10083103 3300005335 Bacteria 2190
19 Ga0070680_100000490 3300005336 Bacteria 27129
20 Ga0070682_100031936 3300005337 Bacteria 3189
21 Ga0070682_100035602 3300005337 Bacteria 3040
22 Ga0070682_100053042 3300005337 Bacteria 2540
23 Ga0068868_100020844 3300005338 Bacteria 4933
24 Ga0070660_100001164 3300005339 Bacteria 17777
25 Ga0070689_100000034 3300005340 Bacteria 91533
26 Ga0070689_100002297 3300005340 Bacteria 12434
27 Ga0070689_100073928 3300005340 Bacteria 2667
28 Ga0070691_10061663 3300005341 Bacteria 1804
29 Ga0070687_100000684 3300005343 Bacteria 11315
30 Ga0070687_100016560 3300005343 Bacteria 3366
31 Ga0070687_100067325 3300005343 Bacteria 1911
32 Ga0070661_100002167 3300005344 Bacteria 13528
33 Ga0070669_100000781 3300005353 Bacteria 23077
34 Ga0070675_100006403 3300005354 Bacteria 9035
35 Ga0070675_100179041 3300005354 Bacteria 1832
36 Ga0070674_100000624 3300005356 Bacteria 17812
37 Ga0070673_100009445 3300005364 Bacteria 6545
38 Ga0070688_100000313 3300005365 Bacteria 24772
39 Ga0070688_100001228 3300005365 Bacteria 12789
40 Ga0070659_100000742 3300005366 Bacteria 23697
41 Ga0070659_100038025 3300005366 Bacteria 3752
42 Ga0070667_100013183 3300005367 Bacteria 6832
43 Ga0070703_10015143 3300005406 Bacteria 2205
44 Ga0070711_100091140 3300005439 Bacteria 2197
45 Ga0070705_100046263 3300005440 Bacteria 2508
46 Ga0070705_100110604 3300005440 Bacteria 1755
47 Ga0070700_100005489 3300005441 Bacteria 6726
48 Ga0070700_100164835 3300005441 Bacteria 1529
49 Ga0070694_100002018 3300005444 Bacteria 12050
50 Ga0070694_100027756 3300005444 Bacteria 3680
51 Ga0070694_100070165 3300005444 Bacteria 2412
52 Ga0070678_100000285 3300005456 Bacteria 23459
53 Ga0070662_100000403 3300005457 Bacteria 25695
54 Ga0070681_10001230 3300005458 Bacteria 22255
55 Ga0068867_100000283 3300005459 Bacteria 33506
56 Ga0070685_10000278 3300005466 Bacteria 32947
57 Ga0070685_10055768 3300005466 Bacteria 2296
58 Ga0070685_10095851 3300005466 Bacteria 1804
59 Ga0070706_100321144 3300005467 Bacteria 1444
60 Ga0070699_100011718 3300005518 Bacteria 7569
61 Ga0070699_100315210 3300005518 Bacteria 1405
62 Ga0070699_100327417 3300005518 Bacteria 1378
63 Ga0070679_100108342 3300005530 Bacteria 2764
64 Ga0070679_100225842 3300005530 Bacteria 1833
65 Ga0070684_100033664 3300005535 Bacteria 4377
66 Ga0070697_100143110 3300005536 Bacteria 2012
67 Ga0070672_100000390 3300005543 Bacteria 25442
68 Ga0070686_100000053 3300005544 Bacteria 95565
69 Ga0070695_100012558 3300005545 Bacteria 5085
70 Ga0070695_100217652 3300005545 Bacteria 1374
71 Ga0070696_100019327 3300005546 Bacteria 4613
72 Ga0070696_100020295 3300005546 Bacteria 4505
73 Ga0070693_100028839 3300005547 Bacteria 3021
74 Ga0070704_100237348 3300005549 Unclassified 1490
75 Ga0068855_100067432 3300005563 Bacteria 4169
76 Ga0070664_100024894 3300005564 Bacteria 4958
77 Ga0070664_100038381 3300005564 Bacteria 4031
78 Ga0068857_100043831 3300005577 Bacteria 3968
79 Ga0068854_100187707 3300005578 Bacteria 1618
80 Ga0070702_100003027 3300005615 Bacteria 7435
81 Ga0068859_100000160 3300005617 Bacteria 65092
82 Ga0068866_10002068 3300005718 Bacteria 8345
83 Ga0068866_10107251 3300005718 Bacteria 1552
84 Ga0068870_10006547 3300005840 Bacteria 5139
85 Ga0068860_100157356 3300005843 Bacteria 2190
86 Ga0068862_100010650 3300005844 Bacteria 7596
87 Ga0081455_10000521 3300005937 Bacteria 49943
88 Ga0081539_10020906 3300005985 Bacteria 4397
89 Ga0075432_10000241 3300006058 Bacteria 14765
90 Ga0097621_100019309 3300006237 Bacteria 5228
91 Ga0097621_100176901 3300006237 Bacteria 1842
92 Ga0097621_100195010 3300006237 Bacteria 1756
93 Ga0068871_100004427 3300006358 Bacteria 9769
94 Ga0075428_100033100 3300006844 Bacteria 5708
95 Ga0075428_100229285 3300006844 Unclassified 2004
96 Ga0075430_100000557 3300006846 Bacteria 28299
97 Ga0075430_100004945 3300006846 Bacteria 11212
98 Ga0075431_100006102 3300006847 Bacteria 11949
99 Ga0075431_100032984 3300006847 Bacteria 5337
100 Ga0075433_10001170 3300006852 Bacteria 19071
101 Ga0075433_10085175 3300006852 Bacteria 2790
102 Ga0075433_10102207 3300006852 Bacteria 2538
103 Ga0075434_100143982 3300006871 Bacteria 2404
104 Ga0075429_100002456 3300006880 Bacteria 15595
105 Ga0075429_100030010 3300006880 Bacteria 4722
106 Ga0068865_100000255 3300006881 Bacteria 29495
107 Ga0075436_100036845 3300006914 Bacteria 3377
108 Ga0097620_100000160 3300006931 Bacteria 65092
109 Ga0075435_100028150 3300007076 Bacteria 4405
110 Ga0105251_10007549 3300009011 Bacteria 6678
111 Ga0111539_10147184 3300009094 Bacteria 2758
112 Ga0105245_10001098 3300009098 Bacteria 24523
113 Ga0114129_10014775 3300009147 Bacteria 11123
114 Ga0114129_10030029 3300009147 Bacteria 7696
115 Ga0105243_10002152 3300009148 Bacteria 16640
116 Ga0105242_10000070 3300009176 Bacteria 71709
117 Ga0105242_10106969 3300009176 Bacteria 2378
118 Ga0105248_10000116 3300009177 Bacteria 90171
119 Ga0105249_10191340 3300009553 Bacteria 1997
120 Ga0105239_10019572 3300010375 Bacteria 7472
121 Ga0105246_10000360 3300011119 Bacteria 24556
122 Ga0157371_10023934 3300013102 Bacteria 4462
123 Ga0157369_10099144 3300013105 Bacteria 3106
124 Ga0157378_10136441 3300013297 Bacteria 2275
125 Ga0157378_10324852 3300013297 Unclassified 1496
126 Ga0157378_10421633 3300013297 Bacteria 1319
127 Ga0157372_10504107 3300013307 Bacteria 1411
128 Ga0157375_10072877 3300013308 Bacteria 3452
129 Ga0157375_10288204 3300013308 Bacteria 1805
130 Ga0163163_10200013 3300014325 Bacteria 2046
131 Ga0157380_10005526 3300014326 Bacteria 8838
132 Ga0157380_10011782 3300014326 Bacteria 6324
133 Ga0157380_10076101 3300014326 Bacteria 2730
134 Ga0157377_10004074 3300014745 Bacteria 6671
135 Ga0157376_10000589 3300014969 Bacteria 23423
136 Ga0209676_1000024 3300025292 Bacteria 578839
137 Ga0209257_1000122 3300025304 Bacteria 219678
138 Ga0207713_1000976 3300025735 Bacteria 25293
139 Ga0207688_10003178 3300025901 Bacteria 8959
140 Ga0207680_10038565 3300025903 Bacteria 2766
141 Ga0207645_10000548 3300025907 Bacteria 31271
142 Ga0207643_10027636 3300025908 Bacteria 3146
143 Ga0207684_10086989 3300025910 Bacteria 2662
144 Ga0207707_10005282 3300025912 Bacteria 11303
145 Ga0207660_10001231 3300025917 Bacteria 17143
146 Ga0207662_10004332 3300025918 Bacteria 7452
147 Ga0207662_10021290 3300025918 Bacteria 3705
148 Ga0207662_10084425 3300025918 Bacteria 1943
149 Ga0207662_10086507 3300025918 Bacteria 1921
150 Ga0207657_10002953 3300025919 Bacteria 18249
151 Ga0207649_10004525 3300025920 Bacteria 7545
152 Ga0207652_10085042 3300025921 Bacteria 2772
153 Ga0207646_10069881 3300025922 Bacteria 3136
154 Ga0207681_10000614 3300025923 Bacteria 23945
155 Ga0207650_10014063 3300025925 Bacteria 5557
156 Ga0207650_10039853 3300025925 Bacteria 3435
157 Ga0207659_10004023 3300025926 Bacteria 8872
158 Ga0207687_10010229 3300025927 Bacteria 6128
159 Ga0207644_10212868 3300025931 Bacteria 1529
160 Ga0207690_10018831 3300025932 Bacteria 4240
161 Ga0207690_10024395 3300025932 Bacteria 3788
162 Ga0207706_10000107 3300025933 Bacteria 88259
163 Ga0207686_10005990 3300025934 Bacteria 6525
164 Ga0207709_10006398 3300025935 Bacteria 6608
165 Ga0207670_10000024 3300025936 Bacteria 143058
166 Ga0207670_10010149 3300025936 Bacteria 5410
167 Ga0207670_10145230 3300025936 Bacteria 1754
168 Ga0207669_10010925 3300025937 Bacteria 4393
169 Ga0207704_10007990 3300025938 Bacteria 5031
170 Ga0207691_10001089 3300025940 Bacteria 27030
171 Ga0207711_10017200 3300025941 Bacteria 6009
172 Ga0207661_10019236 3300025944 Bacteria 5087
173 Ga0207679_10005406 3300025945 Bacteria 8002
174 Ga0207679_10011851 3300025945 Bacteria 5667
175 Ga0207667_10044199 3300025949 Bacteria 4722
176 Ga0207651_10000235 3300025960 Bacteria 23991
177 Ga0207712_10048784 3300025961 Bacteria 2947
178 Ga0207640_10154540 3300025981 Bacteria 1690
179 Ga0207658_10027316 3300025986 Bacteria 4008
180 Ga0207677_10011820 3300026023 Bacteria 4993
181 Ga0207708_10000621 3300026075 Bacteria 27264
182 Ga0207708_10000680 3300026075 Bacteria 25920
183 Ga0207708_10123112 3300026075 Bacteria 2022
184 Ga0207708_10159675 3300026075 Bacteria 1780
185 Ga0207648_10000204 3300026089 Bacteria 63130
186 Ga0207648_10000502 3300026089 Bacteria 43633
187 Ga0207674_10042444 3300026116 Bacteria 4697
188 Ga0207683_10000122 3300026121 Bacteria 64170
189 Ga0209973_1000057 3300027252 Bacteria 5854
190 Ga0209969_1000185 3300027360 Bacteria 8369
191 Ga0209967_1000025 3300027364 Bacteria 19389
192 Ga0209981_1000051 3300027378 Bacteria 11981
193 Ga0209984_1000118 3300027424 Bacteria 9017
194 Ga0210000_1000019 3300027462 Bacteria 27891
195 Ga0209968_1000004 3300027526 Bacteria 57411
196 Ga0209982_1000045 3300027552 Bacteria 11326
197 Ga0209970_1000115 3300027614 Bacteria 11663
198 Ga0210002_1000052 3300027617 Bacteria 17586
199 Ga0209983_1000055 3300027665 Bacteria 16980
200 Ga0209971_1000413 3300027682 Bacteria 11490
201 Ga0209966_1000037 3300027695 Bacteria 55075
202 Ga0209998_10000379 3300027717 Bacteria 12836
203 Ga0209974_10000011 3300027876 Bacteria 48263
204 Ga0207428_10001360 3300027907 Bacteria 25986
205 Ga0268265_10030489 3300028380 Bacteria 3885
206 Ga0268265_10341288 3300028380 Bacteria 1364
207 Ga0268264_10081643 3300028381 Bacteria 2764
208 Ga0265323_10006522 3300028653 Bacteria 4904
209 Ga0265329_10015209 3300031242 Bacteria 2693
210 Ga0265316_10051955 3300031344 Bacteria 3217
211 Ga0307509_10328349 3300031507 Bacteria 1263
212 Ga0307408_100048667 3300031548 Unclassified 3041
213 Ga0316575_10002785 3300031665 Bacteria 5917
214 Ga0316579_10002409 3300031691 Bacteria 7055
215 Ga0316579_10048216 3300031691 Bacteria 1990
216 Ga0316579_10052429 3300031691 Bacteria 1910
217 Ga0316576_10045003 3300031727 Bacteria 3190
218 Ga0316578_10009026 3300031728 Bacteria 5107
219 Ga0316578_10056419 3300031728 Bacteria 2307
220 Ga0307405_10000935 3300031731 Bacteria 11626
221 Ga0316577_10004431 3300031733 Bacteria 7245
222 Ga0316577_10029851 3300031733 Bacteria 3042
223 Ga0316577_10107443 3300031733 Bacteria 1565
224 Ga0307413_10221880 3300031824 Unclassified 1381
225 Ga0307406_10111653 3300031901 Unclassified 1883
226 Ga0307416_100003312 3300032002 Bacteria 9417
227 Ga0307411_10005438 3300032005 Bacteria 6256
228 Ga0307415_100250196 3300032126 Bacteria 1439
229 Ga0316583_10000756 3300032133 Bacteria 10123
230 Ga0316583_10031090 3300032133 Bacteria 1901
231 Ga0316585_10028861 3300032137 Bacteria 1736
232 Ga0316593_10005526 3300032168 Bacteria 3344
233 Ga0373942_0008390 3300035207 Bacteria 2410
234 Ga0373942_0016304 3300035207 Bacteria 1821
235 Ga0316574_0000749 3300035398 Bacteria 13966
236 Ga0373931_0060711 3300035691 Bacteria 2036
237 Ga0316582_0003819 3300036647 Bacteria 7485
238 Ga0316582_0009194 3300036647 Bacteria 5351
239 Ga0316582_0011810 3300036647 Bacteria 4845
240 Ga0316582_0049275 3300036647 Bacteria 2665
241 Ga0316582_0151802 3300036647 Bacteria 1566
242 Ga0316582_0248100 3300036647 Bacteria 1220
243 Ga0316584_0019927 3300036712 Bacteria 4854
244 Ga0316584_0035921 3300036712 Bacteria 3676
245 Ga0400484_45216 3300038725 Bacteria 5757
246 Ga0400490_40128 3300038726 Bacteria 1135
247 Ga0400483_108087 3300039062 Bacteria 1542
248 Ga0400483_233302 3300039062 Unclassified 2504
249 Ga0400489_56792 3300039093 Bacteria 1512
250 Ga0439433_0037673 3300041999 Bacteria 1120
251 Ga0439441_001474 3300042001 Bacteria 3087
252 Ga0439432_038225 3300042006 Bacteria 1529
253 Ga0439464_0025657 3300042439 Unclassified 1632
254 Ga0439460_0016737 3300042461 Bacteria 1957
255 Ga0451577_0000149 3300042876 Bacteria 155208
256 Ga0451577_0014995 3300042876 Bacteria 7212
257 Ga0451577_0019982 3300042876 Bacteria 6152
258 Ga0451577_0040577 3300042876 Bacteria 4179
259 Ga0451577_0145016 3300042876 Bacteria 2135
260 Ga0451577_0152781 3300042876 Bacteria 2077
261 Ga0451577_0187036 3300042876 Bacteria 1868
262 Ga0451577_0206511 3300042876 Bacteria 1774
263 Ga0451577_0275125 3300042876 Bacteria 1525
264 Ga0451577_0349252 3300042876 Bacteria 1342
265 Ga0453683_0000075 3300044673 Bacteria 150395
266 Ga0453683_0000121 3300044673 Bacteria 116746
267 Ga0453683_0000138 3300044673 Bacteria 105792
268 Ga0453683_0000237 3300044673 Bacteria 73077
269 Ga0453683_0004259 3300044673 Bacteria 10213
270 Ga0453683_0031052 3300044673 Bacteria 3376
271 Ga0453683_0046014 3300044673 Bacteria 2736
272 Ga0453684_0000494 3300044712 Bacteria 155208
273 Ga0453684_0002200 3300044712 Bacteria 48517
274 Ga0453684_0006331 3300044712 Bacteria 22596
275 Ga0453684_0018715 3300044712 Bacteria 10607
276 Ga0453684_0021707 3300044712 Bacteria 9572
277 Ga0453684_0025096 3300044712 Bacteria 8670
278 Ga0453684_0065939 3300044712 Bacteria 4613
279 Ga0453684_0087198 3300044712 Bacteria 3869
280 Ga0453684_0206633 3300044712 Bacteria 2285
281 Ga0453684_0213510 3300044712 Bacteria 2241
282 Ga0453684_0581585 3300044712 Bacteria 1230
283 Ga0453684_0779842 3300044712 Bacteria 1032
284 Ga0451576_0020754 3300045051 Bacteria 7150
285 Ga0451576_0023119 3300045051 Bacteria 6735
286 Ga0451576_0033097 3300045051 Bacteria 5496
287 Ga0451576_0082909 3300045051 Bacteria 3335
288 Ga0451576_0121281 3300045051 Bacteria 2722
289 Ga0451576_0402791 3300045051 Bacteria 1435
290 Ga0495594_0083528 3300046499 Bacteria 1785
291 Ga0495663_0002343 3300046525 Bacteria 5723
292 Ga0495633_0025163 3300046558 Bacteria 2932
293 Ga0495659_0070222 3300046664 Bacteria 1311
294 Ga0495658_0031671 3300046683 Bacteria 2882
295 Ga0496106_0301043 3300048909 Bacteria 1286
296 Ga0496117_0002428 3300048920 Bacteria 23566
297 Ga0496118_0029837 3300048921 Bacteria 4564
298 Ga0496120_0004563 3300048923 Bacteria 11538
299 Ga0496122_0002055 3300048925 Bacteria 29867
300 Ga0496122_0005568 3300048925 Bacteria 14913
301 Ga0496122_0005815 3300048925 Bacteria 14499
302 Ga0496123_0000669 3300048926 Bacteria 56717
303 Ga0496123_0004555 3300048926 Bacteria 14460
304 Ga0496123_0005356 3300048926 Bacteria 12956
305 Ga0496124_0000009 3300048927 Bacteria 734820
306 Ga0496124_0000608 3300048927 Bacteria 60173
307 Ga0501290_000115 3300049513 Bacteria 12068
308 Ga0501291_000030 3300049514 Bacteria 17861
309 Ga0501292_000505 3300049515 Bacteria 4901
310 Ga0501293_000010 3300049516 Bacteria 12308
311 Ga0501294_001122 3300049517 Unclassified 2792
312 Ga0501295_000007 3300049518 Bacteria 26337
313 Ga0501296_000214 3300049519 Bacteria 6015
314 Ga0501297_000001 3300049520 Bacteria 42118
315 Ga0501298_000004 3300049521 Bacteria 30757
316 Ga0501300_000019 3300049523 Bacteria 23860
317 Ga0501301_000262 3300049524 Unclassified 3074
318 Ga0501031_0019711 3300049568 Bacteria 4395
319 Ga0501031_0095653 3300049568 Bacteria 1938
320 Ga0501032_0052452 3300049569 Bacteria 2748
321 Ga0501034_0000122 3300049571 Bacteria 144085
322 Ga0501034_0038701 3300049571 Bacteria 4829
323 Ga0501036_0037395 3300049572 Bacteria 4107
324 Ga0501036_0133722 3300049572 Bacteria 2093
325 Ga0501037_0011161 3300049573 Bacteria 6612
326 Ga0501039_0091515 3300049575 Bacteria 2370
327 Ga0501039_0094592 3300049575 Bacteria 2329
328 Ga0501040_0182091 3300049576 Bacteria 1489
329 Ga0501041_0023337 3300049577 Bacteria 3710
330 Ga0501042_0003139 3300049578 Bacteria 10296
331 Ga0501042_0075776 3300049578 Bacteria 2407
332 Ga0501048_0031184 3300049582 Bacteria 3857
333 Ga0501048_0048969 3300049582 Bacteria 3013
334 Ga0501048_0108694 3300049582 Bacteria 1958
335 Ga0501069_0035756 3300049585 Bacteria 2737
336 Ga0501069_0123467 3300049585 Bacteria 1480
337 Ga0501071_0008899 3300049587 Bacteria 6659
338 Ga0501071_0087864 3300049587 Bacteria 2281
339 Ga0501071_0103150 3300049587 Bacteria 2104
340 Ga0501074_0067859 3300049590 Bacteria 2564
341 Ga0501077_0054719 3300049593 Bacteria 2534
342 Ga0501199_002402 3300049650 Bacteria 1749
343 Ga0501202_003240 3300049652 Unclassified 2779
344 Ga0501206_000772 3300049653 Bacteria 3919
345 Ga0501207_005180 3300049654 Unclassified 1798
346 Ga0501208_000854 3300049655 Unclassified 2618
347 Ga0501209_010403 3300049656 Bacteria 1911
348 Ga0501214_000218 3300049659 Unclassified 3544
349 Ga0501216_000078 3300049660 Bacteria 8838
350 Ga0501217_007543 3300049661 Bacteria 2335
351 Ga0501223_009984 3300049663 Bacteria 1916
352 Ga0501227_023174 3300049665 Unclassified 1441
353 Ga0501228_000843 3300049666 Unclassified 2079
354 Ga0501233_000199 3300049668 Bacteria 8855
355 Ga0501239_000354 3300049672 Unclassified 3421
356 Ga0501243_000695 3300049675 Bacteria 4646
357 Ga0501246_000143 3300049676 Unclassified 4429
358 Ga0501249_000064 3300049679 Bacteria 38154
359 Ga0501250_010181 3300049680 Unclassified 1074
360 Ga0501251_000292 3300049681 Bacteria 4437
361 Ga0501253_000022 3300049683 Bacteria 12018
362 Ga0501255_001754 3300049684 Unclassified 1806
363 Ga0501258_000058 3300049687 Bacteria 5843
364 Ga0501259_002338 3300049688 Unclassified 3102
365 Ga0501260_000014 3300049689 Bacteria 11562
366 Ga0501261_000664 3300049690 Bacteria 4323
367 Ga0501219_000438 3300049703 Bacteria 6768
368 Ga0501221_000058 3300049704 Bacteria 11924
369 Ga0501225_0000087 3300049705 Bacteria 29216
370 Ga0501245_000429 3300049708 Bacteria 5091
371 Ga0501083_0045592 3300049744 Bacteria 2966
372 Ga0501232_000349 3300049757 Unclassified 2983
373 Ga0501241_012035 3300049758 Bacteria 1572
374 Ga0501264_000170 3300049761 Bacteria 10571
375 Ga0501268_009357 3300049765 Bacteria 1504
376 Ga0501272_000030 3300049769 Bacteria 9319
377 Ga0501273_000292 3300049770 Unclassified 3856
378 Ga0501275_000419 3300049772 Bacteria 4851
379 Ga0501279_000378 3300049775 Bacteria 5925
380 Ga0501282_000885 3300049778 Bacteria 3398
381 Ga0501283_000003 3300049779 Bacteria 31030
382 Ga0501035_0047555 3300049822 Bacteria 3851
383 Ga0501035_0108945 3300049822 Bacteria 2428
384 Ga0501035_0181288 3300049822 Bacteria 1814
385 Ga0501044_0440469 3300049823 Bacteria 1211
386 Ga0501044_0458830 3300049823 Bacteria 1180
387 Ga0501045_0016949 3300049824 Bacteria 5174
388 Ga0501045_0291319 3300049824 Bacteria 1215
389 Ga0501212_000212 3300049851 Bacteria 5097
390 Ga0501226_000189 3300049853 Bacteria 9906
391 nmdc:mga05p37_14841_c1 3300050507 Bacteria 9355
392 nmdc:mga05p37_23767_c1 3300050507 Bacteria 7443
393 nmdc:mga05p37_703219_c1 3300050507 Bacteria 1122
394 nmdc:mga09592_15063_c1 3300050508 Bacteria 6316
395 nmdc:mga09592_2382_c1 3300050508 Bacteria 15175
396 nmdc:mga0qj67_14210_c1 3300050509 Bacteria 6017
397 nmdc:mga0qj67_653_c1 3300050509 Bacteria 23876
398 nmdc:mga06r32_27080_c1 3300050510 Bacteria 5351
399 nmdc:mga06r32_85987_c1 3300050510 Bacteria 3067
400 nmdc:mga08y16_185707_c1 3300050511 Bacteria 2158
401 nmdc:mga0n895_216133_c1 3300050512 Bacteria 1947
402 nmdc:mga0n895_51849_c1 3300050512 Bacteria 4026
403 nmdc:mga08x19_286975_c1 3300050514 Bacteria 1141
404 nmdc:mga0a205_205511_c1 3300050515 Bacteria 1859
405 nmdc:mga0a205_69562_c1 3300050515 Bacteria 3399
406 Ga0501084_0009535 3300054114 Bacteria 8035
407 Ga0590071_023465 3300059421 Bacteria 1459
408 Ga0590074_014837 3300059423 Bacteria 1319
409 Ga0590075_014338 3300059424 Bacteria 1937
410 Ga0501082_0344524 3300060353 Bacteria 1299
411 Ga0530510_0018938 3300061734 Bacteria 4882
412 2524003879 2523533628 Bacteria 4098242
413 2842781118 2842780639 Bacteria 4337790
414 2916180202 2916178963 Bacteria 5265078
415 2923517955 2923516293 Bacteria 3716336
416 2987607384 2987605356 Bacteria 4187822
417 8002872544 8002869464 Bacteria 3588529
418 8021624502 8021622325 Bacteria 4844743
419 8021627630 8021626552 Bacteria 4665214
420 8021650753 8021648035 Bacteria 4772378
421 Ga0453684_0000314
422 SwRhRL2b_contig_1022993
423 SwRhRL2b_contig_2470157
424 JGI26145J50221_1000424
425 JGI26138J51218_100456
426 Ga0055536_1003210
427 Ga0065704_10003670
428 Ga0065704_10080643
429 Ga0070676_10004546
430 Ga0070683_100012598
431 Ga0070683_100227967
432 Ga0070690_100000079
433 Ga0070690_100017722
434 Ga0070690_100030007
435 Ga0070670_100010254
436 Ga0070670_100041369
437 Ga0070677_10002772
438 Ga0070666_10083103
439 Ga0070680_100000490
440 Ga0070682_100031936
441 Ga0070682_100035602
442 Ga0070682_100053042
443 Ga0068868_100020844
444 Ga0070660_100001164
445 Ga0070689_100000034
446 Ga0070689_100002297
447 Ga0070689_100073928
448 Ga0070691_10061663
449 Ga0070687_100000684
450 Ga0070687_100016560
451 Ga0070687_100067325
452 Ga0070661_100002167
453 Ga0070669_100000781
454 Ga0070675_100006403
455 Ga0070675_100179041
456 Ga0070674_100000624
457 Ga0070673_100009445
458 Ga0070688_100000313
459 Ga0070688_100001228
460 Ga0070659_100000742
461 Ga0070659_100038025
462 Ga0070667_100013183
463 Ga0070703_10015143
464 Ga0070711_100091140
465 Ga0070705_100046263
466 Ga0070705_100110604
467 Ga0070700_100005489
468 Ga0070700_100164835
469 Ga0070694_100002018
470 Ga0070694_100027756
471 Ga0070694_100070165
472 Ga0070678_100000285
473 Ga0070662_100000403
474 Ga0070681_10001230
475 Ga0068867_100000283
476 Ga0070685_10000278
477 Ga0070685_10055768
478 Ga0070685_10095851
479 Ga0070706_100321144
480 Ga0070699_100011718
481 Ga0070699_100315210
482 Ga0070699_100327417
483 Ga0070679_100108342
484 Ga0070679_100225842
485 Ga0070684_100033664
486 Ga0070697_100143110
487 Ga0070672_100000390
488 Ga0070686_100000053
489 Ga0070695_100012558
490 Ga0070695_100217652
491 Ga0070696_100019327
492 Ga0070696_100020295
493 Ga0070693_100028839
494 Ga0070704_100237348
495 Ga0068855_100067432
496 Ga0070664_100024894
497 Ga0070664_100038381
498 Ga0068857_100043831
499 Ga0068854_100187707
500 Ga0070702_100003027
501 Ga0068859_100000160
502 Ga0068866_10002068
503 Ga0068866_10107251
504 Ga0068870_10006547
505 Ga0068860_100157356
506 Ga0068862_100010650
507 Ga0081455_10000521
508 Ga0081539_10020906
509 Ga0075432_10000241
510 Ga0097621_100019309
511 Ga0097621_100176901
512 Ga0097621_100195010
513 Ga0068871_100004427
514 Ga0075428_100033100
515 Ga0075428_100229285
516 Ga0075430_100000557
517 Ga0075430_100004945
518 Ga0075431_100006102
519 Ga0075431_100032984
520 Ga0075433_10001170
521 Ga0075433_10085175
522 Ga0075433_10102207
523 Ga0075434_100143982
524 Ga0075429_100002456
525 Ga0075429_100030010
526 Ga0068865_100000255
527 Ga0075436_100036845
528 Ga0097620_100000160
529 Ga0075435_100028150
530 Ga0105251_10007549
531 Ga0111539_10147184
532 Ga0105245_10001098
533 Ga0114129_10014775
534 Ga0114129_10030029
535 Ga0105243_10002152
536 Ga0105242_10000070
537 Ga0105242_10106969
538 Ga0105248_10000116
539 Ga0105249_10191340
540 Ga0105239_10019572
541 Ga0105246_10000360
542 Ga0157371_10023934
543 Ga0157369_10099144
544 Ga0157378_10136441
545 Ga0157378_10324852
546 Ga0157378_10421633
547 Ga0157372_10504107
548 Ga0157375_10072877
549 Ga0157375_10288204
550 Ga0163163_10200013
551 Ga0157380_10005526
552 Ga0157380_10011782
553 Ga0157380_10076101
554 Ga0157377_10004074
555 Ga0157376_10000589
556 Ga0209676_1000024
557 Ga0209257_1000122
558 Ga0207713_1000976
559 Ga0207688_10003178
560 Ga0207680_10038565
561 Ga0207645_10000548
562 Ga0207643_10027636
563 Ga0207684_10086989
564 Ga0207707_10005282
565 Ga0207660_10001231
566 Ga0207662_10004332
567 Ga0207662_10021290
568 Ga0207662_10084425
569 Ga0207662_10086507
570 Ga0207657_10002953
571 Ga0207649_10004525
572 Ga0207652_10085042
573 Ga0207646_10069881
574 Ga0207681_10000614
575 Ga0207650_10014063
576 Ga0207650_10039853
577 Ga0207659_10004023
578 Ga0207687_10010229
579 Ga0207644_10212868
580 Ga0207690_10018831
581 Ga0207690_10024395
582 Ga0207706_10000107
583 Ga0207686_10005990
584 Ga0207709_10006398
585 Ga0207670_10000024
586 Ga0207670_10010149
587 Ga0207670_10145230
588 Ga0207669_10010925
589 Ga0207704_10007990
590 Ga0207691_10001089
591 Ga0207711_10017200
592 Ga0207661_10019236
593 Ga0207679_10005406
594 Ga0207679_10011851
595 Ga0207667_10044199
596 Ga0207651_10000235
597 Ga0207712_10048784
598 Ga0207640_10154540
599 Ga0207658_10027316
600 Ga0207677_10011820
601 Ga0207708_10000621
602 Ga0207708_10000680
603 Ga0207708_10123112
604 Ga0207708_10159675
605 Ga0207648_10000204
606 Ga0207648_10000502
607 Ga0207674_10042444
608 Ga0207683_10000122
609 Ga0209973_1000057
610 Ga0209969_1000185
611 Ga0209967_1000025
612 Ga0209981_1000051
613 Ga0209984_1000118
614 Ga0210000_1000019
615 Ga0209968_1000004
616 Ga0209982_1000045
617 Ga0209970_1000115
618 Ga0210002_1000052
619 Ga0209983_1000055
620 Ga0209971_1000413
621 Ga0209966_1000037
622 Ga0209998_10000379
623 Ga0209974_10000011
624 Ga0207428_10001360
625 Ga0268265_10030489
626 Ga0268265_10341288
627 Ga0268264_10081643
628 Ga0265323_10006522
629 Ga0265329_10015209
630 Ga0265316_10051955
631 Ga0307509_10328349
632 Ga0307408_100048667
633 Ga0316575_10002785
634 Ga0316579_10002409
635 Ga0316579_10048216
636 Ga0316579_10052429
637 Ga0316576_10045003
638 Ga0316578_10009026
639 Ga0316578_10056419
640 Ga0307405_10000935
641 Ga0316577_10004431
642 Ga0316577_10029851
643 Ga0316577_10107443
644 Ga0307413_10221880
645 Ga0307406_10111653
646 Ga0307416_100003312
647 Ga0307411_10005438
648 Ga0307415_100250196
649 Ga0316583_10000756
650 Ga0316583_10031090
651 Ga0316585_10028861
652 Ga0316593_10005526
653 Ga0373942_0008390
654 Ga0373942_0016304
655 Ga0316574_0000749
656 Ga0373931_0060711
657 Ga0316582_0003819
658 Ga0316582_0009194
659 Ga0316582_0011810
660 Ga0316582_0049275
661 Ga0316582_0151802
662 Ga0316582_0248100
663 Ga0316584_0019927
664 Ga0316584_0035921
665 Ga0400484_45216
666 Ga0400490_40128
667 Ga0400483_108087
668 Ga0400483_233302
669 Ga0400489_56792
670 Ga0439433_0037673
671 Ga0439441_001474
672 Ga0439432_038225
673 Ga0439464_0025657
674 Ga0439460_0016737
675 Ga0451577_0000149
676 Ga0451577_0014995
677 Ga0451577_0019982
678 Ga0451577_0040577
679 Ga0451577_0145016
680 Ga0451577_0152781
681 Ga0451577_0187036
682 Ga0451577_0206511
683 Ga0451577_0275125
684 Ga0451577_0349252
685 Ga0453683_0000075
686 Ga0453683_0000121
687 Ga0453683_0000138
688 Ga0453683_0000237
689 Ga0453683_0004259
690 Ga0453683_0031052
691 Ga0453683_0046014
692 Ga0453684_0000494
693 Ga0453684_0002200
694 Ga0453684_0006331
695 Ga0453684_0018715
696 Ga0453684_0021707
697 Ga0453684_0025096
698 Ga0453684_0065939
699 Ga0453684_0087198
700 Ga0453684_0206633
701 Ga0453684_0213510
702 Ga0453684_0581585
703 Ga0453684_0779842
704 Ga0451576_0020754
705 Ga0451576_0023119
706 Ga0451576_0033097
707 Ga0451576_0082909
708 Ga0451576_0121281
709 Ga0451576_0402791
710 Ga0495594_0083528
711 Ga0495663_0002343
712 Ga0495633_0025163
713 Ga0495659_0070222
714 Ga0495658_0031671
715 Ga0496106_0301043
716 Ga0496117_0002428
717 Ga0496118_0029837
718 Ga0496120_0004563
719 Ga0496122_0002055
720 Ga0496122_0005568
721 Ga0496122_0005815
722 Ga0496123_0000669
723 Ga0496123_0004555
724 Ga0496123_0005356
725 Ga0496124_0000009
726 Ga0496124_0000608
727 Ga0501290_000115
728 Ga0501291_000030
729 Ga0501292_000505
730 Ga0501293_000010
731 Ga0501294_001122
732 Ga0501295_000007
733 Ga0501296_000214
734 Ga0501297_000001
735 Ga0501298_000004
736 Ga0501300_000019
737 Ga0501301_000262
738 Ga0501031_0019711
739 Ga0501031_0095653
740 Ga0501032_0052452
741 Ga0501034_0000122
742 Ga0501034_0038701
743 Ga0501036_0037395
744 Ga0501036_0133722
745 Ga0501037_0011161
746 Ga0501039_0091515
747 Ga0501039_0094592
748 Ga0501040_0182091
749 Ga0501041_0023337
750 Ga0501042_0003139
751 Ga0501042_0075776
752 Ga0501048_0031184
753 Ga0501048_0048969
754 Ga0501048_0108694
755 Ga0501069_0035756
756 Ga0501069_0123467
757 Ga0501071_0008899
758 Ga0501071_0087864
759 Ga0501071_0103150
760 Ga0501074_0067859
761 Ga0501077_0054719
762 Ga0501199_002402
763 Ga0501202_003240
764 Ga0501206_000772
765 Ga0501207_005180
766 Ga0501208_000854
767 Ga0501209_010403
768 Ga0501214_000218
769 Ga0501216_000078
770 Ga0501217_007543
771 Ga0501223_009984
772 Ga0501227_023174
773 Ga0501228_000843
774 Ga0501233_000199
775 Ga0501239_000354
776 Ga0501243_000695
777 Ga0501246_000143
778 Ga0501249_000064
779 Ga0501250_010181
780 Ga0501251_000292
781 Ga0501253_000022
782 Ga0501255_001754
783 Ga0501258_000058
784 Ga0501259_002338
785 Ga0501260_000014
786 Ga0501261_000664
787 Ga0501219_000438
788 Ga0501221_000058
789 Ga0501225_0000087
790 Ga0501245_000429
791 Ga0501083_0045592
792 Ga0501232_000349
793 Ga0501241_012035
794 Ga0501264_000170
795 Ga0501268_009357
796 Ga0501272_000030
797 Ga0501273_000292
798 Ga0501275_000419
799 Ga0501279_000378
800 Ga0501282_000885
801 Ga0501283_000003
802 Ga0501035_0047555
803 Ga0501035_0108945
804 Ga0501035_0181288
805 Ga0501044_0440469
806 Ga0501044_0458830
807 Ga0501045_0016949
808 Ga0501045_0291319
809 Ga0501212_000212
810 Ga0501226_000189
811 nmdc:mga05p37_14841_c1
812 nmdc:mga05p37_23767_c1
813 nmdc:mga05p37_703219_c1
814 nmdc:mga09592_15063_c1
815 nmdc:mga09592_2382_c1
816 nmdc:mga0qj67_14210_c1
817 nmdc:mga0qj67_653_c1
818 nmdc:mga06r32_27080_c1
819 nmdc:mga06r32_85987_c1
820 nmdc:mga08y16_185707_c1
821 nmdc:mga0n895_216133_c1
822 nmdc:mga0n895_51849_c1
823 nmdc:mga08x19_286975_c1
824 nmdc:mga0a205_205511_c1
825 nmdc:mga0a205_69562_c1
826 Ga0501084_0009535
827 Ga0590071_023465
828 Ga0590074_014837
829 Ga0590075_014338
830 Ga0501082_0344524
831 Ga0530510_0018938
832 2524003879
833 2842781118
834 2916180202
835 2923517955
836 2987607384
837 8002872544
838 8021624502
839 8021627630
840 8021650753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

185

364

0.98

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

50

165

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.9805 7 339
2r00-assembly2.cif.gz_C-2 crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae 0.9786 5 339
2gz3-assembly1.cif.gz_C structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with nadp and aspartate-semialdehyde 0.9769 7 339
3pwk-assembly1.cif.gz_B crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2-aminoadipate 0.974 7 339
2yv3-assembly1.cif.gz_B crystal structure of aspartate semialdehyde dehydrogenase from thermus thermophilus hb8 0.9709 10 335
ID Description Score Start End Superfamily
af_Q93Y73_167_356_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9808 133 320 3.30.360.10
2gyyD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.978 133 321 3.30.360.10
2yv3B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9778 133 320 3.30.360.10
2r00C02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9767 133 321 3.30.360.10
2r00C02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9715 133 321 3.30.360.10
ID Description Score Start End GO Terms
AF-X1MBL6-F1-model_v4 Semialdehyde dehydrogenase dimerisation domain-containing protein 0.9931 153 339 GO:0008652
GO:0016620
GO:0046983
AF-A0A849U1R9-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.9924 241 340 GO:0008652
GO:0016620
GO:0046983
AF-A0A2N1UQH2-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.992 196 340 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661
AF-A0A0S8CGG3-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.992 195 339 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661
AF-X1MD22-F1-model_v4 Semialdehyde dehydrogenase dimerisation domain-containing protein 0.9908 178 339 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661

Map