F439841

General Info

Members Datasets Scaffolds Average Seq Length
420 277 379 240

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0000186|Ga0496122_0000186_13954_14796
Length 280
Sequence MGVAGKPGNKTNLILRSVPYGKAPLLGYSPCYPFVFLEAPFMQNHQRRALVLFSGGQDSTTCLAWALDRYAHVETVAFDYGQRHHIELSARLNVLREIRANFPDWAPRLGEDHLLDLKVLGQVGDTAMTSNRAIEMQANGLPNTFVPGRNLLFLTLAAALGYRRQLDVLVGGMCETDFSGYPDCRDDTIKAQQVALGLGLGSRVTIETPLMWIDKSETWALAYQLGGDALVETIVEESHTCYLGERGARHDWGYGCGECPACKLRKIGWEKWVVASAAEG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2643221569 Achromobacter sp. Root565 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543030 Massilia sp. GV097 Isolate Unclassified
15 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
16 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
17 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
18 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
19 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
20 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
23 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
24 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
25 2855730933 Achromobacter sp. HZ28 Isolate Nodule
26 2855767633 Achromobacter sp. HZ34 Isolate Nodule
27 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
28 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
29 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
30 2858950400 Achromobacter sp. K91 Isolate Unclassified
31 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
32 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
33 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
34 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
35 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
36 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
37 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
38 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
39 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
40 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
41 2941479691
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
51 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
52 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
53 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
54 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
55 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
56 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
57 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
110 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
192 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.24
Metatranscriptomes 0
Isolates 9.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30
Nodule 1.9
Rhizoplane 2.14
Rhizosphere 45.95
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000005 3300002705 Bacteria 263980
2 JGI25154J39366_1000017 3300002738 Bacteria 252448
3 JGI25157J39369_1000003 3300002741 Bacteria 274935
4 JGI25157J39369_1000054 3300002741 Bacteria 108825
5 JGI25150J39212_1022319 3300002774 Bacteria 952
6 JGI25159J45721_1006065 3300002987 Bacteria 3676
7 JGI25159J45721_1007940 3300002987 Bacteria 2975
8 JGI25151J46595_10000739 3300003187 Bacteria 26852
9 JGI25151J46595_10013993 3300003187 Bacteria 3592
10 JGI25151J46595_10028623 3300003187 Bacteria 2216
11 JGI25153J46596_10021406 3300003215 Bacteria 2410
12 JGI25160J50197_1000340 3300003354 Bacteria 31558
13 JGI25161J50226_1000098 3300003374 Bacteria 71121
14 Ga0055538_1000038 3300003751 Bacteria 186588
15 Ga0055539_1000049 3300003752 Bacteria 186588
16 Ga0055533_1000060 3300003756 Bacteria 186588
17 Ga0055525_1000068 3300003759 Bacteria 186588
18 Ga0055529_1001125 3300003763 Bacteria 11497
19 Ga0055529_1008814 3300003763 Bacteria 1336
20 Ga0055526_1000687 3300003771 Bacteria 25833
21 Ga0055526_1014863 3300003771 Bacteria 3168
22 Ga0055537_1000016 3300003773 Bacteria 124167
23 Ga0055537_1000037 3300003773 Bacteria 95236
24 Ga0055524_1000111 3300003775 Bacteria 96812
25 Ga0055534_1000038 3300003784 Bacteria 105771
26 Ga0055534_1006462 3300003784 Bacteria 2946
27 Ga0055534_1015408 3300003784 Bacteria 1401
28 Ga0055528_1000071 3300003790 Bacteria 78628
29 Ga0055528_1002505 3300003790 Bacteria 9802
30 Ga0055530_10000119 3300003791 Bacteria 67867
31 Ga0055530_10002192 3300003791 Bacteria 12917
32 Ga0055530_10005072 3300003791 Bacteria 6459
33 Ga0055540_1000007 3300003792 Bacteria 318178
34 Ga0055540_1000059 3300003792 Bacteria 132075
35 Ga0055531_10001080 3300003794 Bacteria 21409
36 Ga0055531_10001730 3300003794 Bacteria 15622
37 Ga0055531_10002083 3300003794 Bacteria 13739
38 Ga0055531_10057344 3300003794 Bacteria 977
39 Ga0055541_1000036 3300003841 Bacteria 186588
40 Ga0055543_1000144 3300004625 Bacteria 59417
41 Ga0065165_1001018 3300005262 Bacteria 34062
42 Ga0065165_1015736 3300005262 Bacteria 2872
43 Ga0065165_1037053 3300005262 Bacteria 1481
44 Ga0065704_10073856 3300005289 Bacteria 6729
45 Ga0065715_10125553 3300005293 Bacteria 2128
46 Ga0070676_10001546 3300005328 Bacteria 11646
47 Ga0070676_10137276 3300005328 Bacteria 1553
48 Ga0070670_100007305 3300005331 Bacteria 9371
49 Ga0070677_10001119 3300005333 Bacteria 8608
50 Ga0070666_10240263 3300005335 Bacteria 1281
51 Ga0070666_10261523 3300005335 Bacteria 1227
52 Ga0070669_100025629 3300005353 Bacteria 4236
53 Ga0070675_100000234 3300005354 Bacteria 35700
54 Ga0070671_100004174 3300005355 Bacteria 11419
55 Ga0070671_100045338 3300005355 Bacteria 3655
56 Ga0070673_100002934 3300005364 Bacteria 10511
57 Ga0070667_100029895 3300005367 Bacteria 4542
58 Ga0070667_100360304 3300005367 Bacteria 1318
59 Ga0070667_100878894 3300005367 Bacteria 834
60 Ga0070678_100019228 3300005456 Bacteria 4448
61 Ga0068867_100000016 3300005459 Bacteria 108420
62 Ga0068867_100028011 3300005459 Bacteria 4054
63 Ga0068867_100083821 3300005459 Bacteria 2407
64 Ga0068867_100140140 3300005459 Bacteria 1889
65 Ga0068867_100175599 3300005459 Bacteria 1700
66 Ga0070706_100499496 3300005467 Bacteria 1132
67 Ga0070707_100388146 3300005468 Bacteria 1356
68 Ga0068853_100054182 3300005539 Bacteria 3456
69 Ga0070672_100002191 3300005543 Bacteria 12314
70 Ga0070672_100616359 3300005543 Bacteria 946
71 Ga0068855_100000083 3300005563 Bacteria 114159
72 Ga0068854_100006952 3300005578 Bacteria 7219
73 Ga0068854_100264720 3300005578 Bacteria 1378
74 Ga0068852_100125710 3300005616 Bacteria 2354
75 Ga0068861_100080409 3300005719 Bacteria 2550
76 Ga0068851_10178312 3300005834 Bacteria 1176
77 Ga0068862_100022726 3300005844 Bacteria 5247
78 Ga0070717_10549414 3300006028 Bacteria 1046
79 Ga0075364_10006188 3300006051 Bacteria 7014
80 Ga0075364_10010382 3300006051 Bacteria 5624
81 Ga0075364_10033567 3300006051 Bacteria 3306
82 Ga0075364_10069364 3300006051 Bacteria 2320
83 Ga0075364_10124814 3300006051 Bacteria 1725
84 Ga0075364_10571929 3300006051 Bacteria 772
85 Ga0075432_10004557 3300006058 Bacteria 4716
86 Ga0075362_10303024 3300006177 Bacteria 793
87 Ga0075366_10003489 3300006195 Bacteria 8307
88 Ga0075366_10005611 3300006195 Bacteria 6805
89 Ga0075366_10069368 3300006195 Bacteria 2098
90 Ga0097621_100197996 3300006237 Bacteria 1743
91 Ga0075370_10275569 3300006353 Bacteria 999
92 Ga0068865_100068556 3300006881 Bacteria 2508
93 Ga0079104_1000009 3300006946 Bacteria 367015
94 Ga0079104_1003264 3300006946 Bacteria 7751
95 Ga0099826_10201001 3300006948 Bacteria 1091
96 Ga0105244_10039824 3300009036 Bacteria 2444
97 Ga0105240_10275230 3300009093 Bacteria 1937
98 Ga0105243_10002440 3300009148 Bacteria 15526
99 Ga0105243_10737772 3300009148 Bacteria 964
100 Ga0105237_10009976 3300009545 Bacteria 10134
101 Ga0105239_10001091 3300010375 Bacteria 37522
102 Ga0157378_10197150 3300013297 Bacteria 1903
103 Ga0157377_10000006 3300014745 Bacteria 419853
104 Ga0182006_1119395 3300015261 Bacteria 917
105 Ga0213872_10002962 3300021361 Bacteria 9614
106 Ga0209435_100002 3300025206 Bacteria 794178
107 Ga0209436_124203 3300025208 Bacteria 746
108 Ga0209784_100021 3300025224 Bacteria 408534
109 Ga0209566_100039 3300025225 Bacteria 303368
110 Ga0209674_100036 3300025226 Bacteria 408534
111 Ga0209672_106813 3300025228 Bacteria 1821
112 Ga0209563_100040 3300025230 Bacteria 408534
113 Ga0209258_103752 3300025242 Bacteria 3136
114 Ga0207425_1001645 3300025245 Bacteria 8997
115 Ga0207425_1032379 3300025245 Bacteria 1035
116 Ga0209646_1000001 3300025246 Bacteria 3092932
117 Ga0209026_1000001 3300025250 Bacteria 1228671
118 Ga0209677_100023 3300025253 Bacteria 408534
119 Ga0209759_1000001 3300025256 Bacteria 2799452
120 Ga0209565_1000016 3300025263 Bacteria 477707
121 Ga0209565_1000055 3300025263 Bacteria 201184
122 Ga0209565_1011109 3300025263 Bacteria 2206
123 Ga0209565_1021405 3300025263 Bacteria 1352
124 Ga0209565_1021445 3300025263 Bacteria 1351
125 Ga0209455_1000880 3300025272 Bacteria 15861
126 Ga0209673_1000040 3300025273 Bacteria 312633
127 Ga0209673_1000253 3300025273 Bacteria 101531
128 Ga0209130_1000104 3300025284 Bacteria 136694
129 Ga0209130_1000161 3300025284 Bacteria 100375
130 Ga0209675_1000052 3300025291 Bacteria 201332
131 Ga0209675_1000099 3300025291 Bacteria 128911
132 Ga0209675_1005710 3300025291 Bacteria 5141
133 Ga0209675_1012021 3300025291 Bacteria 2819
134 Ga0209675_1013890 3300025291 Bacteria 2485
135 Ga0209676_1000023 3300025292 Bacteria 589732
136 Ga0209676_1003223 3300025292 Bacteria 10308
137 Ga0209676_1005933 3300025292 Bacteria 6186
138 Ga0209025_1000019 3300025294 Bacteria 631548
139 Ga0209025_1020858 3300025294 Bacteria 3557
140 Ga0209025_1035640 3300025294 Bacteria 2244
141 Ga0209025_1038095 3300025294 Bacteria 2121
142 Ga0209025_1070322 3300025294 Bacteria 1246
143 Ga0209564_1000121 3300025295 Bacteria 204081
144 Ga0209564_1000555 3300025295 Bacteria 59942
145 Ga0209564_1002809 3300025295 Bacteria 12946
146 Ga0209758_1000331 3300025297 Bacteria 88922
147 Ga0209050_1000022 3300025298 Bacteria 565239
148 Ga0209050_1000130 3300025298 Bacteria 186070
149 Ga0209050_1001541 3300025298 Bacteria 24191
150 Ga0209050_1004738 3300025298 Bacteria 8993
151 Ga0209050_1009194 3300025298 Bacteria 5104
152 Ga0209050_1013448 3300025298 Bacteria 3631
153 Ga0209256_1000001 3300025299 Bacteria 2166974
154 Ga0209256_1000019 3300025299 Bacteria 558627
155 Ga0209256_1000100 3300025299 Bacteria 201246
156 Ga0207426_1000156 3300025302 Bacteria 178646
157 Ga0207426_1008303 3300025302 Bacteria 4215
158 Ga0209051_1000004 3300025303 Bacteria 1155596
159 Ga0209051_1000013 3300025303 Bacteria 565239
160 Ga0209257_1000038 3300025304 Bacteria 609032
161 Ga0209257_1000042 3300025304 Bacteria 537149
162 Ga0209257_1000044 3300025304 Bacteria 486709
163 Ga0209257_1000059 3300025304 Bacteria 378097
164 Ga0209257_1020663 3300025304 Bacteria 2422
165 Ga0207697_10031606 3300025315 Bacteria 2166
166 Ga0207656_10053115 3300025321 Bacteria 1757
167 Ga0207656_10069185 3300025321 Bacteria 1566
168 Ga0207656_10069511 3300025321 Bacteria 1562
169 Ga0207682_10001442 3300025893 Bacteria 10973
170 Ga0207680_10239658 3300025903 Bacteria 1249
171 Ga0207645_10004439 3300025907 Bacteria 10385
172 Ga0207645_10065067 3300025907 Bacteria 2330
173 Ga0207695_10015393 3300025913 Bacteria 9005
174 Ga0207671_10012712 3300025914 Bacteria 6752
175 Ga0207671_10247012 3300025914 Bacteria 1402
176 Ga0207657_10093774 3300025919 Bacteria 2500
177 Ga0207646_10274507 3300025922 Bacteria 1524
178 Ga0207681_10033602 3300025923 Bacteria 3364
179 Ga0207694_10000054 3300025924 Bacteria 152124
180 Ga0207650_10006558 3300025925 Bacteria 7939
181 Ga0207659_10000679 3300025926 Bacteria 20195
182 Ga0207644_10017906 3300025931 Bacteria 4791
183 Ga0207644_10217569 3300025931 Bacteria 1512
184 Ga0207690_10006699 3300025932 Bacteria 6826
185 Ga0207709_10003184 3300025935 Bacteria 9861
186 Ga0207669_10081183 3300025937 Bacteria 2076
187 Ga0207704_10014224 3300025938 Bacteria 4013
188 Ga0207691_10005518 3300025940 Bacteria 12221
189 Ga0207691_10645297 3300025940 Bacteria 895
190 Ga0207689_10037972 3300025942 Bacteria 3991
191 Ga0207679_10003449 3300025945 Bacteria 9758
192 Ga0207667_10000043 3300025949 Bacteria 261426
193 Ga0207667_10005143 3300025949 Bacteria 15977
194 Ga0207651_10005287 3300025960 Bacteria 6607
195 Ga0207668_10132049 3300025972 Bacteria 1908
196 Ga0207640_10260829 3300025981 Bacteria 1350
197 Ga0207640_10421353 3300025981 Bacteria 1093
198 Ga0207658_10027050 3300025986 Bacteria 4028
199 Ga0207639_10119567 3300026041 Bacteria 2162
200 Ga0207648_10000023 3300026089 Bacteria 134519
201 Ga0207648_10008760 3300026089 Bacteria 9751
202 Ga0207648_10013333 3300026089 Bacteria 7653
203 Ga0207648_10773210 3300026089 Bacteria 893
204 Ga0207676_10030834 3300026095 Bacteria 4028
205 Ga0207675_100202573 3300026118 Bacteria 1906
206 Ga0207683_10021135 3300026121 Bacteria 5570
207 Ga0207698_10073987 3300026142 Bacteria 2715
208 Ga0207698_10354749 3300026142 Bacteria 1387
209 Ga0207698_10395098 3300026142 Bacteria 1320
210 Ga0209281_1000023 3300027111 Bacteria 519955
211 Ga0209281_1011656 3300027111 Bacteria 1960
212 Ga0209371_1004164 3300027312 Bacteria 6459
213 Ga0268265_10015164 3300028380 Bacteria 5266
214 Ga0268265_10708560 3300028380 Bacteria 973
215 Ga0307517_10053342 3300028786 Bacteria 4028
216 Ga0307515_10000515 3300028794 Bacteria 92187
217 Ga0307515_10002728 3300028794 Bacteria 37759
218 Ga0307515_10010616 3300028794 Bacteria 17622
219 Ga0307515_10047016 3300028794 Bacteria 6577
220 Ga0307515_10054125 3300028794 Bacteria 5899
221 Ga0307515_10137912 3300028794 Bacteria 2637
222 Ga0265338_10170384 3300028800 Bacteria 1671
223 Ga0268256_1003691 3300030500 Bacteria 6752
224 Ga0307512_10029747 3300030522 Bacteria 4765
225 Ga0307513_10000038 3300031456 Bacteria 174780
226 Ga0307513_10009886 3300031456 Bacteria 12037
227 Ga0307513_10011481 3300031456 Bacteria 11006
228 Ga0307513_10350493 3300031456 Bacteria 1224
229 Ga0307509_10000139 3300031507 Bacteria 108589
230 Ga0307509_10005507 3300031507 Bacteria 17584
231 Ga0307509_10009593 3300031507 Bacteria 12047
232 Ga0307408_100038722 3300031548 Bacteria 3365
233 Ga0307408_100131373 3300031548 Bacteria 1954
234 Ga0307508_10001423 3300031616 Bacteria 26934
235 Ga0307508_10002229 3300031616 Bacteria 20645
236 Ga0307508_10099492 3300031616 Bacteria 2501
237 Ga0307514_10003253 3300031649 Bacteria 15841
238 Ga0307514_10027741 3300031649 Bacteria 4574
239 Ga0307405_10010759 3300031731 Bacteria 4757
240 Ga0307413_10129855 3300031824 Bacteria 1722
241 Ga0307410_10006451 3300031852 Bacteria 6333
242 Ga0307406_10002771 3300031901 Bacteria 9568
243 Ga0307412_10000253 3300031911 Bacteria 34652
244 Ga0307412_10001946 3300031911 Bacteria 11420
245 Ga0307409_100011705 3300031995 Bacteria 5548
246 Ga0307416_100508457 3300032002 Bacteria 1270
247 Ga0307416_100552598 3300032002 Bacteria 1225
248 Ga0307414_10028096 3300032004 Bacteria 3644
249 Ga0307411_10001389 3300032005 Bacteria 9826
250 Ga0307411_10182791 3300032005 Bacteria 1593
251 Ga0307415_100073285 3300032126 Bacteria 2415
252 Ga0307507_10050177 3300033179 Bacteria 4032
253 Ga0307510_10003929 3300033180 Bacteria 17423
254 Ga0307510_10007365 3300033180 Bacteria 13115
255 Ga0307510_10028118 3300033180 Bacteria 6425
256 Ga0307510_10125110 3300033180 Bacteria 2262
257 Ga0373931_0185565 3300035691 Bacteria 1234
258 Ga0373937_0044887 3300036401 Bacteria 4037
259 Ga0395898_0028563 3300037466 Bacteria 5589
260 Ga0395905_0005652 3300037471 Bacteria 12719
261 Ga0436365_1665495 3300039437 Bacteria 1120
262 Ga0436360_0181010 3300039438 Bacteria 6161
263 Ga0436361_0758847 3300039447 Bacteria 32174
264 Ga0436361_1090697 3300039447 Bacteria 2257
265 Ga0451800_1175142 3300041459 Bacteria 1581
266 Ga0451807_0117596 3300041486 Bacteria 1733
267 Ga0451853_1399039 3300041512 Bacteria 1340
268 Ga0450911_000479 3300042115 Bacteria 12822
269 Ga0466972_0098744 3300044658 Bacteria 1382
270 Ga0453684_0028364 3300044712 Bacteria 7989
271 Ga0453684_0238409 3300044712 Bacteria 2095
272 Ga0451576_0077532 3300045051 Bacteria 3458
273 Ga0451576_0136104 3300045051 Bacteria 2562
274 Ga0495592_0000385 3300046454 Bacteria 34635
275 Ga0495638_0015497 3300046460 Bacteria 5116
276 Ga0495653_0066530 3300046463 Bacteria 2710
277 Ga0495605_0179517 3300046474 Bacteria 931
278 Ga0495584_0078554 3300046491 Bacteria 1660
279 Ga0495585_0012958 3300046492 Bacteria 4898
280 Ga0495585_0043998 3300046492 Bacteria 2495
281 Ga0495596_0000032 3300046500 Bacteria 102282
282 Ga0495607_0000004 3300046501 Bacteria 317271
283 Ga0495607_0062583 3300046501 Bacteria 2108
284 Ga0495606_0026051 3300046507 Bacteria 4172
285 Ga0495606_0034420 3300046507 Bacteria 3478
286 Ga0495616_0043637 3300046513 Bacteria 2277
287 Ga0495616_0075063 3300046513 Bacteria 1627
288 Ga0495620_0054063 3300046515 Bacteria 1698
289 Ga0495631_0009117 3300046518 Bacteria 4968
290 Ga0495632_0039513 3300046519 Bacteria 2381
291 Ga0495642_0061499 3300046528 Bacteria 1558
292 Ga0495586_0004459 3300046535 Bacteria 7475
293 Ga0495609_0014426 3300046538 Bacteria 3713
294 Ga0495597_0077411 3300046542 Bacteria 1425
295 Ga0495633_0007138 3300046558 Bacteria 6485
296 Ga0495656_0025401 3300046615 Bacteria 2348
297 Ga0495668_0129988 3300046616 Bacteria 1378
298 Ga0495611_0004888 3300046648 Bacteria 5752
299 Ga0495625_0077492 3300046660 Bacteria 2322
300 Ga0495635_0002815 3300046663 Bacteria 11937
301 Ga0495661_0029254 3300046665 Bacteria 3519
302 Ga0495646_0281833 3300046680 Bacteria 883
303 Ga0495670_0020286 3300046691 Bacteria 3276
304 Ga0495671_0173729 3300046692 Bacteria 1047
305 Ga0495589_0068691 3300046794 Bacteria 1733
306 Ga0495604_0005055 3300047317 Bacteria 10438
307 Ga0495680_0030115 3300047322 Bacteria 4435
308 Ga0495683_0007217 3300047323 Bacteria 6031
309 Ga0495677_0018301 3300047445 Bacteria 2539
310 Ga0495685_002329 3300047447 Bacteria 5933
311 Ga0495685_006986 3300047447 Bacteria 3715
312 Ga0495686_0006631 3300047472 Bacteria 8820
313 Ga0495626_0090410 3300048091 Bacteria 1346
314 Ga0495626_0098357 3300048091 Bacteria 1278
315 Ga0496102_0000367 3300048905 Bacteria 54225
316 Ga0496102_0001271 3300048905 Bacteria 22770
317 Ga0496102_0005122 3300048905 Bacteria 11111
318 Ga0496102_0144079 3300048905 Bacteria 2235
319 Ga0496103_0049133 3300048906 Bacteria 2608
320 Ga0496114_0036499 3300048917 Bacteria 4063
321 Ga0496116_0007553 3300048919 Bacteria 9615
322 Ga0496116_0029517 3300048919 Bacteria 3952
323 Ga0496117_0015974 3300048920 Bacteria 6360
324 Ga0496118_0063876 3300048921 Bacteria 2706
325 Ga0496118_0104410 3300048921 Bacteria 1902
326 Ga0496119_0132027 3300048922 Bacteria 1360
327 Ga0496121_0000153 3300048924 Bacteria 150635
328 Ga0496121_0076110 3300048924 Bacteria 2677
329 Ga0496121_0471927 3300048924 Bacteria 803
330 Ga0496122_0000186 3300048925 Bacteria 144012
331 Ga0496122_0236576 3300048925 Bacteria 1033
332 Ga0496122_0306131 3300048925 Bacteria 854
333 Ga0496123_0001621 3300048926 Bacteria 30304
334 Ga0496123_0070254 3300048926 Bacteria 2192
335 Ga0496124_0000007 3300048927 Bacteria 883534
336 Ga0496124_0150962 3300048927 Bacteria 1822
337 Ga0496125_0000023 3300048928 Bacteria 449042
338 Ga0496125_0012944 3300048928 Bacteria 8237
339 Ga0496125_0015921 3300048928 Bacteria 7243
340 Ga0496125_0040026 3300048928 Bacteria 4026
341 Ga0496125_0058456 3300048928 Bacteria 3115
342 Ga0496125_0094661 3300048928 Bacteria 2224
343 Ga0495682_0004006 3300049460 Bacteria 6416
344 Ga0501033_0019595 3300049570 Bacteria 5114
345 Ga0501033_0202301 3300049570 Bacteria 1418
346 Ga0501033_0521272 3300049570 Bacteria 821
347 Ga0501039_0431079 3300049575 Bacteria 1035
348 Ga0501046_0000042 3300049580 Bacteria 151850
349 Ga0501047_0000052 3300049581 Bacteria 153448
350 Ga0501047_0003810 3300049581 Bacteria 14175
351 Ga0501048_0000459 3300049582 Bacteria 28550
352 Ga0501249_030030 3300049679 Bacteria 1210
353 Ga0501083_0013331 3300049744 Bacteria 5748
354 Ga0501035_0021042 3300049822 Bacteria 5996
355 Ga0501035_0115242 3300049822 Bacteria 2352
356 Ga0501044_0000236 3300049823 Bacteria 69634
357 Ga0501044_0013239 3300049823 Bacteria 8930
358 nmdc:mga03683_76626_c1 3300050489 Bacteria 1438
359 nmdc:mga00v17_113109_c1 3300050491 Bacteria 1723
360 nmdc:mga00v17_5476_c1 3300050491 Bacteria 6687
361 nmdc:mga0k408_165520_c1 3300050493 Bacteria 1318
362 nmdc:mga0k408_17844_c1 3300050493 Bacteria 3956
363 nmdc:mga0k408_359824_c1 3300050493 Bacteria 867
364 nmdc:mga0k408_4151_c1 3300050493 Bacteria 7690
365 nmdc:mga0k408_8809_c1 3300050493 Bacteria 5429
366 Ga0500644_0033297 3300053088 Bacteria 1653
367 Ga0500651_0000423 3300053093 Bacteria 22721
368 Ga0500651_0034166 3300053093 Bacteria 3206
369 Ga0500562_013661 3300053108 Bacteria 2076
370 Ga0500652_003054 3300053131 Bacteria 5051
371 Ga0500559_0000114 3300053136 Bacteria 63472
372 Ga0500568_0113644 3300053139 Bacteria 1011
373 Ga0500600_0001892 3300053149 Bacteria 11457
374 Ga0500600_0137930 3300053149 Bacteria 1232
375 Ga0500622_0003067 3300053156 Bacteria 11521
376 Ga0500645_000042 3300053730 Bacteria 110470
377 Ga0500645_001234 3300053730 Bacteria 13469
378 Ga0500587_004238 3300053739 Bacteria 1975
379 Ga0501082_0076223 3300060353 Bacteria 2890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10170384 Ga0265338_101703842 219
2 3300045051 Ga0451576_0136104 Ga0451576_0136104_13_690 224
3 3300031456 Ga0307513_10011481 Ga0307513_100114816 226
4 iso_pu_bacteria 2739367655 2739611833 227
5 3300003763 Ga0055529_1008814 Ga0055529_10088141 228
6 3300031507 Ga0307509_10009593 Ga0307509_100095935 229
7 3300031616 Ga0307508_10099492 Ga0307508_100994921 229
8 3300033180 Ga0307510_10125110 Ga0307510_101251103 229
9 3300046680 Ga0495646_0281833 Ga0495646_0281833_64_768 229
10 iso_pu_bacteria 2599185292 2599905899 229
11 iso_pu_bacteria 2643221569 2643859111 229
12 iso_pu_bacteria 2643221594 2643979793 229
13 iso_pu_bacteria 2643221609 2644057847 229
14 iso_pu_bacteria 2643221611 2644072884 229
15 iso_pu_bacteria 2643221621 2644122979 229
16 iso_pu_bacteria 2643221644 2644245252 229
17 iso_pu_bacteria 2738543012 2739242117 229
18 iso_pu_bacteria 2738543018 2739276754 229
19 iso_pu_bacteria 2738543030 2739345798 229
20 iso_pu_bacteria 2808606395 2809033781 229
21 iso_pu_bacteria 2816332133 2816470266 229
22 iso_pu_bacteria 2855730933 2855733053 229
23 iso_pu_bacteria 2855767633 2855771805 229
24 iso_pu_bacteria 2857537821 2857539699 229
25 iso_pu_bacteria 2857542790 2857544142 229
26 iso_pu_bacteria 2857576091 2857580863 229
27 iso_pu_bacteria 2858950400 2858954538 229
28 iso_pu_bacteria 2881412998 2881415857 229
29 iso_pu_bacteria 2941479691 2941484893 229
30 3300005293 Ga0065715_10125553 Ga0065715_101255532 230
31 3300005328 Ga0070676_10001546 Ga0070676_100015465 230
32 3300005328 Ga0070676_10137276 Ga0070676_101372762 230
33 3300005331 Ga0070670_100007305 Ga0070670_1000073052 230
34 3300005333 Ga0070677_10001119 Ga0070677_100011198 230
35 3300005335 Ga0070666_10240263 Ga0070666_102402632 230
36 3300005335 Ga0070666_10261523 Ga0070666_102615232 230
37 3300005353 Ga0070669_100025629 Ga0070669_1000256293 230
38 3300005354 Ga0070675_100000234 Ga0070675_10000023420 230
39 3300005355 Ga0070671_100004174 Ga0070671_1000041746 230
40 3300005355 Ga0070671_100045338 Ga0070671_1000453381 230
41 3300005364 Ga0070673_100002934 Ga0070673_1000029345 230
42 3300005367 Ga0070667_100029895 Ga0070667_1000298955 230
43 3300005456 Ga0070678_100019228 Ga0070678_1000192285 230
44 3300005459 Ga0068867_100028011 Ga0068867_1000280115 230
45 3300005459 Ga0068867_100083821 Ga0068867_1000838211 230
46 3300005459 Ga0068867_100175599 Ga0068867_1001755991 230
47 3300005543 Ga0070672_100002191 Ga0070672_1000021912 230
48 3300005543 Ga0070672_100616359 Ga0070672_1006163592 230
49 3300005578 Ga0068854_100264720 Ga0068854_1002647202 230
50 3300005616 Ga0068852_100125710 Ga0068852_1001257102 230
51 3300005719 Ga0068861_100080409 Ga0068861_1000804092 230
52 3300005834 Ga0068851_10178312 Ga0068851_101783122 230
53 3300005844 Ga0068862_100022726 Ga0068862_1000227264 230
54 3300006195 Ga0075366_10003489 Ga0075366_100034897 230
55 3300006195 Ga0075366_10069368 Ga0075366_100693682 230
56 3300006237 Ga0097621_100197996 Ga0097621_1001979963 230
57 3300006353 Ga0075370_10275569 Ga0075370_102755692 230
58 3300006881 Ga0068865_100068556 Ga0068865_1000685562 230
59 3300009148 Ga0105243_10737772 Ga0105243_107377722 230
60 3300025315 Ga0207697_10031606 Ga0207697_100316064 230
61 3300025321 Ga0207656_10053115 Ga0207656_100531152 230
62 3300025321 Ga0207656_10069185 Ga0207656_100691852 230
63 3300025893 Ga0207682_10001442 Ga0207682_100014423 230
64 3300025907 Ga0207645_10004439 Ga0207645_100044392 230
65 3300025907 Ga0207645_10065067 Ga0207645_100650673 230
66 3300025923 Ga0207681_10033602 Ga0207681_100336023 230
67 3300025925 Ga0207650_10006558 Ga0207650_100065583 230
68 3300025926 Ga0207659_10000679 Ga0207659_100006795 230
69 3300025931 Ga0207644_10017906 Ga0207644_100179062 230
70 3300025931 Ga0207644_10217569 Ga0207644_102175692 230
71 3300025937 Ga0207669_10081183 Ga0207669_100811834 230
72 3300025938 Ga0207704_10014224 Ga0207704_100142242 230
73 3300025940 Ga0207691_10005518 Ga0207691_1000551810 230
74 3300025940 Ga0207691_10645297 Ga0207691_106452972 230
75 3300025942 Ga0207689_10037972 Ga0207689_100379724 230
76 3300025960 Ga0207651_10005287 Ga0207651_100052873 230
77 3300025972 Ga0207668_10132049 Ga0207668_101320492 230
78 3300025981 Ga0207640_10260829 Ga0207640_102608292 230
79 3300025981 Ga0207640_10421353 Ga0207640_104213532 230
80 3300025986 Ga0207658_10027050 Ga0207658_100270503 230
81 3300026041 Ga0207639_10119567 Ga0207639_101195673 230
82 3300026089 Ga0207648_10008760 Ga0207648_100087608 230
83 3300026089 Ga0207648_10013333 Ga0207648_100133333 230
84 3300026095 Ga0207676_10030834 Ga0207676_100308345 230
85 3300026118 Ga0207675_100202573 Ga0207675_1002025732 230
86 3300026121 Ga0207683_10021135 Ga0207683_100211353 230
87 3300026142 Ga0207698_10073987 Ga0207698_100739872 230
88 3300026142 Ga0207698_10354749 Ga0207698_103547492 230
89 3300028380 Ga0268265_10015164 Ga0268265_100151642 230
90 3300028794 Ga0307515_10010616 Ga0307515_100106165 230
91 3300028794 Ga0307515_10054125 Ga0307515_100541256 230
92 3300030522 Ga0307512_10029747 Ga0307512_100297473 230
93 3300031507 Ga0307509_10000139 Ga0307509_100001398 230
94 3300031507 Ga0307509_10005507 Ga0307509_1000550716 230
95 3300031548 Ga0307408_100131373 Ga0307408_1001313732 230
96 3300031649 Ga0307514_10027741 Ga0307514_100277414 230
97 3300031731 Ga0307405_10010759 Ga0307405_100107592 230
98 3300031824 Ga0307413_10129855 Ga0307413_101298552 230
99 3300031852 Ga0307410_10006451 Ga0307410_100064512 230
100 3300031901 Ga0307406_10002771 Ga0307406_100027717 230
101 3300031911 Ga0307412_10001946 Ga0307412_100019469 230
102 3300031995 Ga0307409_100011705 Ga0307409_1000117053 230
103 3300032002 Ga0307416_100508457 Ga0307416_1005084572 230
104 3300032004 Ga0307414_10028096 Ga0307414_100280963 230
105 3300032005 Ga0307411_10001389 Ga0307411_100013898 230
106 3300032005 Ga0307411_10182791 Ga0307411_101827912 230
107 3300032126 Ga0307415_100073285 Ga0307415_1000732854 230
108 3300033180 Ga0307510_10003929 Ga0307510_1000392912 230
109 3300033180 Ga0307510_10007365 Ga0307510_1000736513 230
110 3300033180 Ga0307510_10028118 Ga0307510_100281182 230
111 3300036401 Ga0373937_0044887 Ga0373937_0044887_128_829 230
112 3300037466 Ga0395898_0028563 Ga0395898_0028563_4812_5516 230
113 3300041486 Ga0451807_0117596 Ga0451807_0117596_48_749 230
114 3300042115 Ga0450911_000479 Ga0450911_000479_6838_7536 230
115 3300044712 Ga0453684_0028364 Ga0453684_0028364_5086_5784 230
116 3300046454 Ga0495592_0000385 Ga0495592_0000385_28160_28876 230
117 3300046515 Ga0495620_0054063 Ga0495620_0054063_769_1485 230
118 3300046692 Ga0495671_0173729 Ga0495671_0173729_112_819 230
119 3300048928 Ga0496125_0012944 Ga0496125_0012944_7416_8114 230
120 3300049679 Ga0501249_030030 Ga0501249_030030_433_1125 230
121 3300050489 nmdc:mga03683_76626_c1 nmdc:mga03683_76626_c1_567_1292 230
122 3300050493 nmdc:mga0k408_17844_c1 nmdc:mga0k408_17844_c1_990_1691 230
123 3300050493 nmdc:mga0k408_359824_c1 nmdc:mga0k408_359824_c1_49_765 230
124 3300050493 nmdc:mga0k408_4151_c1 nmdc:mga0k408_4151_c1_3968_4705 230
125 3300053088 Ga0500644_0033297 Ga0500644_0033297_83_799 230
126 3300053093 Ga0500651_0034166 Ga0500651_0034166_1169_1885 230
127 3300053131 Ga0500652_003054 Ga0500652_003054_569_1300 230
128 3300053136 Ga0500559_0000114 Ga0500559_0000114_7819_8535 230
129 3300053139 Ga0500568_0113644 Ga0500568_0113644_56_772 230
130 3300053156 Ga0500622_0003067 Ga0500622_0003067_9117_9833 230
131 3300053739 Ga0500587_004238 Ga0500587_004238_345_1061 230
132 3300003763 Ga0055529_1001125 Ga0055529_10011254 231
133 3300005459 Ga0068867_100140140 Ga0068867_1001401401 231
134 3300006946 Ga0079104_1003264 Ga0079104_10032642 231
135 3300025228 Ga0209672_106813 Ga0209672_1068131 231
136 3300025242 Ga0209258_103752 Ga0209258_1037522 231
137 3300025272 Ga0209455_1000880 Ga0209455_100088012 231
138 3300026089 Ga0207648_10773210 Ga0207648_107732101 231
139 3300027111 Ga0209281_1011656 Ga0209281_10116562 231
140 3300044712 Ga0453684_0238409 Ga0453684_0238409_759_1472 231
141 3300045051 Ga0451576_0077532 Ga0451576_0077532_1716_2429 231
142 3300048928 Ga0496125_0040026 Ga0496125_0040026_3173_3877 231
143 3300049570 Ga0501033_0202301 Ga0501033_0202301_14_763 231
144 3300049744 Ga0501083_0013331 Ga0501083_0013331_3318_4013 231
145 3300049822 Ga0501035_0115242 Ga0501035_0115242_1057_1806 231
146 3300049823 Ga0501044_0000236 Ga0501044_0000236_58_807 231
147 3300050493 nmdc:mga0k408_165520_c1 nmdc:mga0k408_165520_c1_259_987 231
148 iso_pu_bacteria 2511231026 2511385504 231
149 3300003187 JGI25151J46595_10000739 JGI25151J46595_100007399 232
150 3300003215 JGI25153J46596_10021406 JGI25153J46596_100214062 232
151 3300003751 Ga0055538_1000038 Ga0055538_100003836 232
152 3300003752 Ga0055539_1000049 Ga0055539_100004936 232
153 3300003756 Ga0055533_1000060 Ga0055533_100006036 232
154 3300003759 Ga0055525_1000068 Ga0055525_1000068158 232
155 3300003773 Ga0055537_1000037 Ga0055537_100003718 232
156 3300003784 Ga0055534_1000038 Ga0055534_100003818 232
157 3300003790 Ga0055528_1000071 Ga0055528_10000712 232
158 3300003791 Ga0055530_10002192 Ga0055530_1000219211 232
159 3300003791 Ga0055530_10005072 Ga0055530_100050726 232
160 3300003792 Ga0055540_1000007 Ga0055540_100000721 232
161 3300003794 Ga0055531_10002083 Ga0055531_100020832 232
162 3300003841 Ga0055541_1000036 Ga0055541_1000036158 232
163 3300005262 Ga0065165_1001018 Ga0065165_100101817 232
164 3300005262 Ga0065165_1037053 Ga0065165_10370531 232
165 3300005289 Ga0065704_10073856 Ga0065704_100738566 232
166 3300005367 Ga0070667_100360304 Ga0070667_1003603041 232
167 3300005367 Ga0070667_100878894 Ga0070667_1008788941 232
168 3300005459 Ga0068867_100000016 Ga0068867_1000000167 232
169 3300005467 Ga0070706_100499496 Ga0070706_1004994962 232
170 3300005468 Ga0070707_100388146 Ga0070707_1003881462 232
171 3300005539 Ga0068853_100054182 Ga0068853_1000541822 232
172 3300005563 Ga0068855_100000083 Ga0068855_10000008385 232
173 3300005578 Ga0068854_100006952 Ga0068854_1000069524 232
174 3300006028 Ga0070717_10549414 Ga0070717_105494142 232
175 3300006051 Ga0075364_10006188 Ga0075364_100061884 232
176 3300006051 Ga0075364_10010382 Ga0075364_100103823 232
177 3300006051 Ga0075364_10033567 Ga0075364_100335672 232
178 3300006051 Ga0075364_10069364 Ga0075364_100693642 232
179 3300006051 Ga0075364_10124814 Ga0075364_101248142 232
180 3300006058 Ga0075432_10004557 Ga0075432_100045573 232
181 3300006177 Ga0075362_10303024 Ga0075362_103030241 232
182 3300006195 Ga0075366_10005611 Ga0075366_100056113 232
183 3300006946 Ga0079104_1000009 Ga0079104_1000009259 232
184 3300009036 Ga0105244_10039824 Ga0105244_100398243 232
185 3300009093 Ga0105240_10275230 Ga0105240_102752302 232
186 3300009148 Ga0105243_10002440 Ga0105243_100024404 232
187 3300009545 Ga0105237_10009976 Ga0105237_100099769 232
188 3300010375 Ga0105239_10001091 Ga0105239_1000109124 232
189 3300013297 Ga0157378_10197150 Ga0157378_101971501 232
190 3300014745 Ga0157377_10000006 Ga0157377_10000006177 232
191 3300015261 Ga0182006_1119395 Ga0182006_11193951 232
192 3300021361 Ga0213872_10002962 Ga0213872_100029626 232
193 3300025224 Ga0209784_100021 Ga0209784_100021136 232
194 3300025225 Ga0209566_100039 Ga0209566_100039137 232
195 3300025226 Ga0209674_100036 Ga0209674_100036136 232
196 3300025230 Ga0209563_100040 Ga0209563_100040136 232
197 3300025253 Ga0209677_100023 Ga0209677_100023136 232
198 3300025263 Ga0209565_1000055 Ga0209565_1000055128 232
199 3300025273 Ga0209673_1000040 Ga0209673_1000040128 232
200 3300025291 Ga0209675_1000052 Ga0209675_100005261 232
201 3300025291 Ga0209675_1012021 Ga0209675_10120213 232
202 3300025292 Ga0209676_1005933 Ga0209676_10059334 232
203 3300025294 Ga0209025_1000019 Ga0209025_1000019345 232
204 3300025295 Ga0209564_1000121 Ga0209564_100012123 232
205 3300025297 Ga0209758_1000331 Ga0209758_100033158 232
206 3300025298 Ga0209050_1000130 Ga0209050_100013032 232
207 3300025298 Ga0209050_1001541 Ga0209050_100154121 232
208 3300025298 Ga0209050_1004738 Ga0209050_10047382 232
209 3300025298 Ga0209050_1013448 Ga0209050_10134482 232
210 3300025299 Ga0209256_1000019 Ga0209256_1000019320 232
211 3300025299 Ga0209256_1000100 Ga0209256_100010061 232
212 3300025303 Ga0209051_1000004 Ga0209051_100000474 232
213 3300025304 Ga0209257_1000038 Ga0209257_1000038208 232
214 3300025304 Ga0209257_1000044 Ga0209257_1000044352 232
215 3300025304 Ga0209257_1000059 Ga0209257_1000059227 232
216 3300025321 Ga0207656_10069511 Ga0207656_100695112 232
217 3300025903 Ga0207680_10239658 Ga0207680_102396582 232
218 3300025913 Ga0207695_10015393 Ga0207695_100153937 232
219 3300025914 Ga0207671_10012712 Ga0207671_100127122 232
220 3300025914 Ga0207671_10247012 Ga0207671_102470122 232
221 3300025919 Ga0207657_10093774 Ga0207657_100937743 232
222 3300025922 Ga0207646_10274507 Ga0207646_102745071 232
223 3300025924 Ga0207694_10000054 Ga0207694_10000054110 232
224 3300025932 Ga0207690_10006699 Ga0207690_100066994 232
225 3300025935 Ga0207709_10003184 Ga0207709_100031844 232
226 3300025945 Ga0207679_10003449 Ga0207679_100034496 232
227 3300025949 Ga0207667_10000043 Ga0207667_10000043115 232
228 3300025949 Ga0207667_10005143 Ga0207667_1000514312 232
229 3300026089 Ga0207648_10000023 Ga0207648_1000002338 232
230 3300026142 Ga0207698_10395098 Ga0207698_103950982 232
231 3300027111 Ga0209281_1000023 Ga0209281_1000023128 232
232 3300027312 Ga0209371_1004164 Ga0209371_10041646 232
233 3300028380 Ga0268265_10708560 Ga0268265_107085602 232
234 3300028786 Ga0307517_10053342 Ga0307517_100533424 232
235 3300028794 Ga0307515_10000515 Ga0307515_1000051567 232
236 3300028794 Ga0307515_10002728 Ga0307515_1000272822 232
237 3300028794 Ga0307515_10047016 Ga0307515_100470162 232
238 3300028794 Ga0307515_10137912 Ga0307515_101379123 232
239 3300030500 Ga0268256_1003691 Ga0268256_10036912 232
240 3300031456 Ga0307513_10009886 Ga0307513_100098868 232
241 3300031616 Ga0307508_10001423 Ga0307508_1000142313 232
242 3300031616 Ga0307508_10002229 Ga0307508_100022294 232
243 3300031649 Ga0307514_10003253 Ga0307514_100032536 232
244 3300031911 Ga0307412_10000253 Ga0307412_1000025329 232
245 3300032002 Ga0307416_100552598 Ga0307416_1005525982 232
246 3300033179 Ga0307507_10050177 Ga0307507_100501775 232
247 3300035691 Ga0373931_0185565 Ga0373931_0185565_459_1157 232
248 3300037471 Ga0395905_0005652 Ga0395905_0005652_1232_1963 232
249 3300039437 Ga0436365_1665495 Ga0436365_1665495_154_897 232
250 3300039438 Ga0436360_0181010 Ga0436360_0181010_217_930 232
251 3300039447 Ga0436361_0758847 Ga0436361_0758847_11793_12551 232
252 3300039447 Ga0436361_1090697 Ga0436361_1090697_1125_1883 232
253 3300044658 Ga0466972_0098744 Ga0466972_0098744_519_1223 232
254 3300046460 Ga0495638_0015497 Ga0495638_0015497_4365_5078 232
255 3300046463 Ga0495653_0066530 Ga0495653_0066530_484_1197 232
256 3300046474 Ga0495605_0179517 Ga0495605_0179517_186_899 232
257 3300046491 Ga0495584_0078554 Ga0495584_0078554_502_1215 232
258 3300046492 Ga0495585_0012958 Ga0495585_0012958_3820_4533 232
259 3300046492 Ga0495585_0043998 Ga0495585_0043998_17_730 232
260 3300046500 Ga0495596_0000032 Ga0495596_0000032_17527_18240 232
261 3300046501 Ga0495607_0000004 Ga0495607_0000004_53226_53957 232
262 3300046501 Ga0495607_0062583 Ga0495607_0062583_536_1249 232
263 3300046507 Ga0495606_0026051 Ga0495606_0026051_2620_3333 232
264 3300046507 Ga0495606_0034420 Ga0495606_0034420_1634_2347 232
265 3300046513 Ga0495616_0043637 Ga0495616_0043637_913_1626 232
266 3300046513 Ga0495616_0075063 Ga0495616_0075063_493_1206 232
267 3300046518 Ga0495631_0009117 Ga0495631_0009117_3580_4293 232
268 3300046519 Ga0495632_0039513 Ga0495632_0039513_723_1436 232
269 3300046528 Ga0495642_0061499 Ga0495642_0061499_17_781 232
270 3300046535 Ga0495586_0004459 Ga0495586_0004459_3171_3884 232
271 3300046538 Ga0495609_0014426 Ga0495609_0014426_2709_3422 232
272 3300046542 Ga0495597_0077411 Ga0495597_0077411_58_771 232
273 3300046558 Ga0495633_0007138 Ga0495633_0007138_1639_2352 232
274 3300046615 Ga0495656_0025401 Ga0495656_0025401_917_1630 232
275 3300046616 Ga0495668_0129988 Ga0495668_0129988_374_1087 232
276 3300046648 Ga0495611_0004888 Ga0495611_0004888_233_946 232
277 3300046660 Ga0495625_0077492 Ga0495625_0077492_1073_1786 232
278 3300046663 Ga0495635_0002815 Ga0495635_0002815_3158_3871 232
279 3300046665 Ga0495661_0029254 Ga0495661_0029254_1130_1843 232
280 3300046691 Ga0495670_0020286 Ga0495670_0020286_165_878 232
281 3300046794 Ga0495589_0068691 Ga0495589_0068691_529_1242 232
282 3300047317 Ga0495604_0005055 Ga0495604_0005055_7858_8571 232
283 3300047322 Ga0495680_0030115 Ga0495680_0030115_3388_4101 232
284 3300047323 Ga0495683_0007217 Ga0495683_0007217_2764_3477 232
285 3300047445 Ga0495677_0018301 Ga0495677_0018301_927_1640 232
286 3300047447 Ga0495685_002329 Ga0495685_002329_3571_4335 232
287 3300047447 Ga0495685_006986 Ga0495685_006986_970_1683 232
288 3300047472 Ga0495686_0006631 Ga0495686_0006631_4901_5623 232
289 3300048091 Ga0495626_0090410 Ga0495626_0090410_542_1255 232
290 3300048091 Ga0495626_0098357 Ga0495626_0098357_147_878 232
291 3300048905 Ga0496102_0000367 Ga0496102_0000367_13199_13960 232
292 3300048905 Ga0496102_0001271 Ga0496102_0001271_7617_8354 232
293 3300048905 Ga0496102_0005122 Ga0496102_0005122_6377_7183 232
294 3300048905 Ga0496102_0144079 Ga0496102_0144079_1156_1866 232
295 3300048906 Ga0496103_0049133 Ga0496103_0049133_1729_2490 232
296 3300048917 Ga0496114_0036499 Ga0496114_0036499_1314_2060 232
297 3300048919 Ga0496116_0007553 Ga0496116_0007553_4585_5304 232
298 3300048919 Ga0496116_0029517 Ga0496116_0029517_917_1627 232
299 3300048920 Ga0496117_0015974 Ga0496117_0015974_2433_3146 232
300 3300048921 Ga0496118_0063876 Ga0496118_0063876_812_1522 232
301 3300048921 Ga0496118_0104410 Ga0496118_0104410_1049_1762 232
302 3300048922 Ga0496119_0132027 Ga0496119_0132027_344_1057 232
303 3300048924 Ga0496121_0000153 Ga0496121_0000153_55284_55994 232
304 3300048924 Ga0496121_0076110 Ga0496121_0076110_1031_1759 232
305 3300048924 Ga0496121_0471927 Ga0496121_0471927_13_789 232
306 3300048925 Ga0496122_0000186 Ga0496122_0000186_13954_14796 232
307 3300048925 Ga0496122_0236576 Ga0496122_0236576_268_978 232
308 3300048925 Ga0496122_0306131 Ga0496122_0306131_113_823 232
309 3300048926 Ga0496123_0001621 Ga0496123_0001621_3337_4179 232
310 3300048926 Ga0496123_0070254 Ga0496123_0070254_700_1410 232
311 3300048927 Ga0496124_0000007 Ga0496124_0000007_446743_447468 232
312 3300048927 Ga0496124_0150962 Ga0496124_0150962_56_766 232
313 3300048928 Ga0496125_0000023 Ga0496125_0000023_150748_151458 232
314 3300048928 Ga0496125_0015921 Ga0496125_0015921_2602_3318 232
315 3300048928 Ga0496125_0058456 Ga0496125_0058456_1378_2091 232
316 3300048928 Ga0496125_0094661 Ga0496125_0094661_79_921 232
317 3300049460 Ga0495682_0004006 Ga0495682_0004006_3727_4440 232
318 3300049570 Ga0501033_0019595 Ga0501033_0019595_2160_2879 232
319 3300049570 Ga0501033_0521272 Ga0501033_0521272_68_796 232
320 3300049575 Ga0501039_0431079 Ga0501039_0431079_70_789 232
321 3300049580 Ga0501046_0000042 Ga0501046_0000042_56473_57219 232
322 3300049581 Ga0501047_0000052 Ga0501047_0000052_96230_96976 232
323 3300049581 Ga0501047_0003810 Ga0501047_0003810_5732_6451 232
324 3300049582 Ga0501048_0000459 Ga0501048_0000459_4918_5664 232
325 3300049822 Ga0501035_0021042 Ga0501035_0021042_4593_5312 232
326 3300049823 Ga0501044_0013239 Ga0501044_0013239_7821_8540 232
327 3300050491 nmdc:mga00v17_5476_c1 nmdc:mga00v17_5476_c1_473_1198 232
328 3300050493 nmdc:mga0k408_8809_c1 nmdc:mga0k408_8809_c1_3636_4334 232
329 3300053093 Ga0500651_0000423 Ga0500651_0000423_3405_4130 232
330 3300053108 Ga0500562_013661 Ga0500562_013661_1047_1817 232
331 3300053149 Ga0500600_0001892 Ga0500600_0001892_2496_3218 232
332 3300053149 Ga0500600_0137930 Ga0500600_0137930_333_1034 232
333 3300060353 Ga0501082_0076223 Ga0501082_0076223_30_728 232
334 iso_pu_bacteria 2521172590 2521560153 232
335 iso_pu_bacteria 2551306416 2553004939 232
336 iso_pu_bacteria 2765235838 2765571302 232
337 iso_pu_bacteria 2808606386 2808982532 232
338 iso_pu_bacteria 2808606415 2809129641 232
339 iso_pu_bacteria 2808606419 2809149304 232
340 iso_pu_bacteria 2818991449 2819616506 232
341 iso_pu_bacteria 2839094727 2839099143 232
342 iso_pu_bacteria 2852618963 2852619446 232
343 iso_pu_bacteria 2904439833 2904440814 232
344 iso_pu_bacteria 2904530477 2904535422 232
345 iso_pu_bacteria 2904584206 2904588438 232
346 iso_pu_bacteria 2904589729 2904594674 232
347 iso_pu_bacteria 2904601388 2904605903 232
348 iso_pu_bacteria 2919046199 2919048992 232
349 iso_pu_bacteria 2919079590 2919084595 232
350 iso_pu_bacteria 2923510766 2923513883 232
351 iso_pu_bacteria 2928130867 2928134273 232
352 iso_pu_bacteria 2511231002 2511243101 236
353 3300002705 JGI25156J39149_1000005 JGI25156J39149_1000005193 240
354 3300002738 JGI25154J39366_1000017 JGI25154J39366_1000017185 240
355 3300002741 JGI25157J39369_1000003 JGI25157J39369_1000003201 240
356 3300002741 JGI25157J39369_1000054 JGI25157J39369_100005436 240
357 3300002774 JGI25150J39212_1022319 JGI25150J39212_10223191 240
358 3300002987 JGI25159J45721_1006065 JGI25159J45721_10060652 240
359 3300002987 JGI25159J45721_1007940 JGI25159J45721_10079403 240
360 3300003187 JGI25151J46595_10013993 JGI25151J46595_100139934 240
361 3300003187 JGI25151J46595_10028623 JGI25151J46595_100286231 240
362 3300003354 JGI25160J50197_1000340 JGI25160J50197_10003402 240
363 3300003374 JGI25161J50226_1000098 JGI25161J50226_100009840 240
364 3300003771 Ga0055526_1000687 Ga0055526_100068712 240
365 3300003771 Ga0055526_1014863 Ga0055526_10148632 240
366 3300003773 Ga0055537_1000016 Ga0055537_100001694 240
367 3300003775 Ga0055524_1000111 Ga0055524_100011124 240
368 3300003784 Ga0055534_1006462 Ga0055534_10064622 240
369 3300003784 Ga0055534_1015408 Ga0055534_10154082 240
370 3300003790 Ga0055528_1002505 Ga0055528_10025054 240
371 3300003791 Ga0055530_10000119 Ga0055530_100001194 240
372 3300003792 Ga0055540_1000059 Ga0055540_100005980 240
373 3300003794 Ga0055531_10001080 Ga0055531_100010805 240
374 3300003794 Ga0055531_10001730 Ga0055531_1000173010 240
375 3300003794 Ga0055531_10057344 Ga0055531_100573441 240
376 3300004625 Ga0055543_1000144 Ga0055543_100014429 240
377 3300005262 Ga0065165_1015736 Ga0065165_10157362 240
378 3300006051 Ga0075364_10571929 Ga0075364_105719291 240
379 3300006948 Ga0099826_10201001 Ga0099826_102010012 240
380 3300025206 Ga0209435_100002 Ga0209435_100002309 240
381 3300025208 Ga0209436_124203 Ga0209436_1242031 240
382 3300025245 Ga0207425_1001645 Ga0207425_10016454 240
383 3300025245 Ga0207425_1032379 Ga0207425_10323792 240
384 3300025246 Ga0209646_1000001 Ga0209646_10000012452 240
385 3300025250 Ga0209026_1000001 Ga0209026_10000011108 240
386 3300025256 Ga0209759_1000001 Ga0209759_10000012083 240
387 3300025263 Ga0209565_1000016 Ga0209565_1000016394 240
388 3300025263 Ga0209565_1011109 Ga0209565_10111092 240
389 3300025263 Ga0209565_1021405 Ga0209565_10214052 240
390 3300025263 Ga0209565_1021445 Ga0209565_10214452 240
391 3300025273 Ga0209673_1000253 Ga0209673_10002532 240
392 3300025284 Ga0209130_1000104 Ga0209130_100010432 240
393 3300025284 Ga0209130_1000161 Ga0209130_100016120 240
394 3300025291 Ga0209675_1000099 Ga0209675_100009996 240
395 3300025291 Ga0209675_1005710 Ga0209675_10057104 240
396 3300025291 Ga0209675_1013890 Ga0209675_10138902 240
397 3300025292 Ga0209676_1000023 Ga0209676_1000023434 240
398 3300025292 Ga0209676_1003223 Ga0209676_10032234 240
399 3300025294 Ga0209025_1020858 Ga0209025_10208582 240
400 3300025294 Ga0209025_1035640 Ga0209025_10356402 240
401 3300025294 Ga0209025_1038095 Ga0209025_10380952 240
402 3300025294 Ga0209025_1070322 Ga0209025_10703221 240
403 3300025295 Ga0209564_1000555 Ga0209564_100055534 240
404 3300025295 Ga0209564_1002809 Ga0209564_100280913 240
405 3300025298 Ga0209050_1000022 Ga0209050_1000022416 240
406 3300025298 Ga0209050_1009194 Ga0209050_10091946 240
407 3300025299 Ga0209256_1000001 Ga0209256_10000011902 240
408 3300025302 Ga0207426_1000156 Ga0207426_100015636 240
409 3300025302 Ga0207426_1008303 Ga0207426_10083032 240
410 3300025303 Ga0209051_1000013 Ga0209051_1000013416 240
411 3300025304 Ga0209257_1000042 Ga0209257_100004271 240
412 3300025304 Ga0209257_1020663 Ga0209257_10206631 240
413 3300031456 Ga0307513_10000038 Ga0307513_1000003857 240
414 3300031456 Ga0307513_10350493 Ga0307513_103504932 240
415 3300031548 Ga0307408_100038722 Ga0307408_1000387223 240
416 3300041459 Ga0451800_1175142 Ga0451800_1175142_643_1365 240
417 3300041512 Ga0451853_1399039 Ga0451853_1399039_47_769 240
418 3300050491 nmdc:mga00v17_113109_c1 nmdc:mga00v17_113109_c1_417_1139 240
419 3300053730 Ga0500645_000042 Ga0500645_000042_7978_8700 240
420 3300053730 Ga0500645_001234 Ga0500645_001234_1245_1967 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06508

QueC

Queuosine biosynthesis protein QueC

48

273

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.9111 3 240
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.9024 3 240
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8997 3 240
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8909 3 240
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.8804 3 238
ID Description Score Start End Superfamily
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.906 4 240 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8939 4 240 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7805 3 237 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7513 3 237 3.40.50.620
4kr9B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6865 3 188 3.40.50.620
ID Description Score Start End GO Terms
AF-J3HMG5-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9849 115 239 GO:0008616
AF-A0A7C3GC97-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9816 111 240 GO:0008616
AF-A0A537QG75-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9806 101 239 GO:0008616
AF-A0A537MXM7-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9797 115 207 GO:0008616
AF-A0A7R7CPS8-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.97 4 66 GO:0008616

Feature Viewer

pLDDT pTM Quality
88.27 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map