F439862

General Info

Members Datasets Scaffolds Average Seq Length
420 249 840 132

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0001015|Ga0500641_0001015_123_524
Length 118
Sequence MQVRDGMTEVSLTVGPTHTLRDAARMMVEKGTGAALVSDGESPEPGIVTERDLLISVSERVIAATPDWSLERAAAEMSRRGVRHLVVFDAGDAIGVLSMRDIVRVWTSDGATSGMTPG

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
247 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 11.67
Rhizosphere 84.29
Stem 0
Stem Tuber 0
Unclassified 7.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0001015 3300053096 Bacteria 9981
2 JGI24740J21852_10022756 3300001979 Bacteria 2152
3 Ga0070676_10727135 3300005328 Unclassified 727
4 Ga0070683_100009649 3300005329 Bacteria 8260
5 Ga0070670_100144916 3300005331 Bacteria 2055
6 Ga0070670_100505383 3300005331 Bacteria 1075
7 Ga0070670_100884396 3300005331 Bacteria 809
8 Ga0070677_10000521 3300005333 Bacteria 13187
9 Ga0070666_10030539 3300005335 Bacteria 3551
10 Ga0070680_100014062 3300005336 Bacteria 6249
11 Ga0068868_100000694 3300005338 Bacteria 22626
12 Ga0070660_100187238 3300005339 Bacteria 1676
13 Ga0070691_10000004 3300005341 Bacteria 80156
14 Ga0070687_100085516 3300005343 Bacteria 1731
15 Ga0070668_100120801 3300005347 Bacteria 2094
16 Ga0070668_100297547 3300005347 Bacteria 1353
17 Ga0070669_100395911 3300005353 Unclassified 1129
18 Ga0070671_100061637 3300005355 Bacteria 3124
19 Ga0070674_100000141 3300005356 Bacteria 33366
20 Ga0070674_100224244 3300005356 Unclassified 1464
21 Ga0070673_100005888 3300005364 Bacteria 7910
22 Ga0070688_100000010 3300005365 Bacteria 84103
23 Ga0070688_100000686 3300005365 Bacteria 16820
24 Ga0070659_100003678 3300005366 Bacteria 10933
25 Ga0070667_100001110 3300005367 Bacteria 24556
26 Ga0070667_100037746 3300005367 Bacteria 4050
27 Ga0070667_101044470 3300005367 Bacteria 763
28 Ga0070713_100000503 3300005436 Bacteria 24991
29 Ga0070713_100486707 3300005436 Bacteria 1163
30 Ga0070710_10154265 3300005437 Bacteria 1419
31 Ga0070678_100007037 3300005456 Bacteria 6650
32 Ga0070681_10037706 3300005458 Bacteria 4849
33 Ga0070685_10000010 3300005466 Bacteria 146946
34 Ga0070685_10001080 3300005466 Bacteria 14623
35 Ga0070679_100000424 3300005530 Bacteria 35927
36 Ga0070684_100014422 3300005535 Bacteria 6403
37 Ga0070684_100111225 3300005535 Bacteria 2456
38 Ga0070684_100122802 3300005535 Bacteria 2337
39 Ga0070686_100166436 3300005544 Bacteria 1556
40 Ga0070693_100001267 3300005547 Bacteria 11429
41 Ga0070665_100002868 3300005548 Bacteria 18629
42 Ga0070665_100042444 3300005548 Bacteria 4572
43 Ga0068855_100053536 3300005563 Bacteria 4748
44 Ga0070664_100052530 3300005564 Bacteria 3453
45 Ga0070664_100289624 3300005564 Unclassified 1478
46 Ga0068854_100000082 3300005578 Bacteria 68340
47 Ga0068854_100097017 3300005578 Bacteria 2203
48 Ga0068856_100000136 3300005614 Bacteria 74026
49 Ga0068856_100013363 3300005614 Bacteria 7950
50 Ga0068856_101483218 3300005614 Bacteria 692
51 Ga0070702_100054974 3300005615 Bacteria 2293
52 Ga0068852_100000994 3300005616 Bacteria 18720
53 Ga0068859_101391825 3300005617 Bacteria 774
54 Ga0068864_100000090 3300005618 Bacteria 96213
55 Ga0068866_10000004 3300005718 Bacteria 202810
56 Ga0068866_10000206 3300005718 Bacteria 27716
57 Ga0068866_10016679 3300005718 Bacteria 3289
58 Ga0068861_100355723 3300005719 Bacteria 1286
59 Ga0068861_101963570 3300005719 Unclassified 583
60 Ga0068851_10001071 3300005834 Bacteria 11849
61 Ga0068863_100121298 3300005841 Bacteria 2493
62 Ga0068863_100190446 3300005841 Bacteria 1971
63 Ga0068858_100001180 3300005842 Bacteria 27065
64 Ga0068858_100281646 3300005842 Bacteria 1583
65 Ga0068860_100474956 3300005843 Bacteria 1246
66 Ga0068862_100017783 3300005844 Bacteria 5917
67 Ga0081455_10004942 3300005937 Bacteria 14737
68 Ga0081455_10280764 3300005937 Bacteria 1203
69 Ga0081538_10157987 3300005981 Bacteria 1013
70 Ga0081539_10000776 3300005985 Bacteria 62705
71 Ga0075365_10543000 3300006038 Bacteria 822
72 Ga0075368_10112694 3300006042 Bacteria 1122
73 Ga0070712_100000841 3300006175 Bacteria 18240
74 Ga0075367_10223024 3300006178 Bacteria 1180
75 Ga0097621_100160157 3300006237 Bacteria 1934
76 Ga0097621_101702745 3300006237 Bacteria 600
77 Ga0068871_100310952 3300006358 Bacteria 1385
78 Ga0075430_100206320 3300006846 Bacteria 1631
79 Ga0075433_10000337 3300006852 Bacteria 29062
80 Ga0068865_100001495 3300006881 Bacteria 13634
81 Ga0097620_101391872 3300006931 Bacteria 774
82 Ga0105240_10536233 3300009093 Unclassified 1297
83 Ga0105245_10000040 3300009098 Bacteria 144005
84 Ga0105245_10000117 3300009098 Bacteria 76863
85 Ga0105245_10000629 3300009098 Bacteria 32084
86 Ga0105245_10038238 3300009098 Bacteria 4270
87 Ga0105245_11084751 3300009098 Unclassified 847
88 Ga0105247_10050849 3300009101 Bacteria 2551
89 Ga0105247_10078003 3300009101 Unclassified 2083
90 Ga0105242_10000063 3300009176 Bacteria 74721
91 Ga0105242_10061550 3300009176 Bacteria 3087
92 Ga0105242_11575292 3300009176 Bacteria 690
93 Ga0105248_10000037 3300009177 Bacteria 180751
94 Ga0105248_11519020 3300009177 Bacteria 758
95 Ga0105249_10000218 3300009553 Bacteria 65480
96 Ga0105249_10017915 3300009553 Bacteria 6294
97 Ga0105249_11034453 3300009553 Bacteria 890
98 Ga0105246_10182023 3300011119 Bacteria 1619
99 Ga0157371_10004888 3300013102 Bacteria 11513
100 Ga0157369_10001730 3300013105 Bacteria 26528
101 Ga0157374_10001719 3300013296 Bacteria 18377
102 Ga0157374_10101946 3300013296 Bacteria 2752
103 Ga0157374_12263052 3300013296 Bacteria 571
104 Ga0157378_10149338 3300013297 Bacteria 2176
105 Ga0163162_10504488 3300013306 Bacteria 1340
106 Ga0163162_12003253 3300013306 Unclassified 663
107 Ga0157372_10000146 3300013307 Bacteria 77952
108 Ga0157372_12323447 3300013307 Unclassified 616
109 Ga0157375_10318422 3300013308 Bacteria 1720
110 Ga0157375_10462630 3300013308 Bacteria 1434
111 Ga0157375_13204230 3300013308 Bacteria 546
112 Ga0163163_10080228 3300014325 Bacteria 3263
113 Ga0163163_10278387 3300014325 Bacteria 1724
114 Ga0163163_10771727 3300014325 Bacteria 1025
115 Ga0157380_10001343 3300014326 Bacteria 16023
116 Ga0157379_10056698 3300014968 Bacteria 3500
117 Ga0157379_10088527 3300014968 Unclassified 2777
118 Ga0157379_10141140 3300014968 Bacteria 2172
119 Ga0157379_10712100 3300014968 Bacteria 943
120 Ga0163161_10000064 3300017792 Bacteria 108508
121 Ga0163161_10008446 3300017792 Bacteria 7130
122 Ga0206356_10906881 3300020070 Unclassified 593
123 Ga0206349_1553209 3300020075 Bacteria 502
124 Ga0206352_10936627 3300020078 Bacteria 640
125 Ga0154015_1003828 3300020610 Bacteria 913
126 Ga0207656_10001283 3300025321 Bacteria 8251
127 Ga0207682_10000769 3300025893 Bacteria 14799
128 Ga0207692_10126787 3300025898 Bacteria 1437
129 Ga0207642_10000005 3300025899 Bacteria 401934
130 Ga0207642_10000473 3300025899 Bacteria 12319
131 Ga0207642_10019348 3300025899 Bacteria 2635
132 Ga0207710_10041562 3300025900 Unclassified 2039
133 Ga0207680_10007123 3300025903 Bacteria 5437
134 Ga0207645_10582733 3300025907 Unclassified 759
135 Ga0207643_10259918 3300025908 Bacteria 1072
136 Ga0207707_10059817 3300025912 Bacteria 3315
137 Ga0207695_10665760 3300025913 Bacteria 922
138 Ga0207693_10010825 3300025915 Bacteria 7404
139 Ga0207660_10004388 3300025917 Bacteria 9200
140 Ga0207657_10166653 3300025919 Bacteria 1787
141 Ga0207649_10000003 3300025920 Bacteria 388908
142 Ga0207652_10000232 3300025921 Bacteria 58473
143 Ga0207650_10030751 3300025925 Bacteria 3871
144 Ga0207650_10359573 3300025925 Bacteria 1199
145 Ga0207687_10000070 3300025927 Bacteria 77432
146 Ga0207687_10020955 3300025927 Bacteria 4339
147 Ga0207700_10000003 3300025928 Bacteria 500797
148 Ga0207700_10867112 3300025928 Bacteria 808
149 Ga0207664_10015535 3300025929 Bacteria 5529
150 Ga0207644_10116586 3300025931 Bacteria 2027
151 Ga0207690_10002537 3300025932 Bacteria 11031
152 Ga0207686_10000230 3300025934 Bacteria 42566
153 Ga0207686_10030532 3300025934 Bacteria 3192
154 Ga0207669_10000003 3300025937 Bacteria 252239
155 Ga0207669_10000021 3300025937 Bacteria 100327
156 Ga0207669_10107293 3300025937 Bacteria 1862
157 Ga0207704_10000104 3300025938 Bacteria 46614
158 Ga0207691_10000178 3300025940 Bacteria 60110
159 Ga0207711_10000011 3300025941 Bacteria 518817
160 Ga0207711_11041839 3300025941 Bacteria 758
161 Ga0207661_10004619 3300025944 Bacteria 9651
162 Ga0207661_10007065 3300025944 Bacteria 7970
163 Ga0207661_10527283 3300025944 Bacteria 1081
164 Ga0207679_10018802 3300025945 Bacteria 4635
165 Ga0207679_10235554 3300025945 Unclassified 1548
166 Ga0207667_10122450 3300025949 Bacteria 2680
167 Ga0207651_10003288 3300025960 Bacteria 7914
168 Ga0207712_10000027 3300025961 Bacteria 263739
169 Ga0207712_10012099 3300025961 Bacteria 5510
170 Ga0207712_10382903 3300025961 Bacteria 1178
171 Ga0207668_11392613 3300025972 Bacteria 632
172 Ga0207640_10000054 3300025981 Bacteria 95136
173 Ga0207640_10047856 3300025981 Bacteria 2761
174 Ga0207658_10001811 3300025986 Bacteria 15995
175 Ga0207658_10056859 3300025986 Bacteria 2905
176 Ga0207677_10003648 3300026023 Bacteria 8170
177 Ga0207677_10009001 3300026023 Bacteria 5602
178 Ga0207703_10000020 3300026035 Bacteria 251603
179 Ga0207703_10301483 3300026035 Bacteria 1462
180 Ga0207639_11184986 3300026041 Bacteria 717
181 Ga0207702_10000105 3300026078 Bacteria 97835
182 Ga0207702_10001788 3300026078 Bacteria 21174
183 Ga0207702_10026085 3300026078 Bacteria 4852
184 Ga0207702_10214281 3300026078 Bacteria 1792
185 Ga0207641_10011027 3300026088 Bacteria 7412
186 Ga0207641_10076027 3300026088 Bacteria 2902
187 Ga0207641_10190668 3300026088 Bacteria 1884
188 Ga0207676_10000016 3300026095 Bacteria 311561
189 Ga0207675_100332344 3300026118 Bacteria 1486
190 Ga0207683_10167842 3300026121 Bacteria 1987
191 Ga0207698_10000015 3300026142 Bacteria 207368
192 Ga0207698_10044308 3300026142 Bacteria 3342
193 Ga0207698_11545185 3300026142 Unclassified 679
194 Ga0268266_10000029 3300028379 Bacteria 424015
195 Ga0268266_10000526 3300028379 Bacteria 53404
196 Ga0268266_10024467 3300028379 Bacteria 5135
197 Ga0268265_10001768 3300028380 Bacteria 17341
198 Ga0268264_10001191 3300028381 Bacteria 25160
199 Ga0268264_10227716 3300028381 Bacteria 1719
200 Ga0265337_1001256 3300028556 Bacteria 12773
201 Ga0265326_10000452 3300028558 Bacteria 16152
202 Ga0265319_1000010 3300028563 Bacteria 188773
203 Ga0265319_1077929 3300028563 Bacteria 1055
204 Ga0265322_10000005 3300028654 Bacteria 246112
205 Ga0265336_10047644 3300028666 Bacteria 1301
206 Ga0265338_10000287 3300028800 Bacteria 90818
207 Ga0265324_10000183 3300029957 Bacteria 48185
208 Ga0265324_10101630 3300029957 Bacteria 977
209 Ga0307511_10211734 3300030521 Bacteria 988
210 Ga0265328_10014040 3300031239 Bacteria 3160
211 Ga0265320_10000010 3300031240 Bacteria 250501
212 Ga0265325_10028601 3300031241 Bacteria 3003
213 Ga0265329_10001050 3300031242 Bacteria 13701
214 Ga0265339_10014859 3300031249 Bacteria 4682
215 Ga0265331_10000217 3300031250 Bacteria 69142
216 Ga0265327_10000040 3300031251 Bacteria 291052
217 Ga0265316_10055023 3300031344 Bacteria 3114
218 Ga0265313_10124893 3300031595 Bacteria 1119
219 Ga0265342_10144521 3300031712 Bacteria 1325
220 Ga0307410_10371956 3300031852 Bacteria 1147
221 Ga0307416_100005097 3300032002 Bacteria 8016
222 Ga0307415_100045299 3300032126 Bacteria 2948
223 Ga0373956_0293489 3300035119 Bacteria 774
224 Ga0373957_0154340 3300035120 Bacteria 943
225 Ga0316574_0042454 3300035398 Bacteria 2806
226 Ga0451800_0385771 3300041459 Bacteria 1555
227 Ga0451800_0612137 3300041459 Bacteria 663
228 Ga0451807_0762306 3300041486 Bacteria 500
229 Ga0451807_2751078 3300041486 Bacteria 1128
230 Ga0451847_0293030 3300041503 Bacteria 545
231 Ga0451849_0744065 3300041505 Bacteria 874
232 Ga0451853_1793063 3300041512 Bacteria 3429
233 Ga0439459_0203748 3300042438 Unclassified 541
234 Ga0466963_0000233 3300044694 Bacteria 24036
235 Ga0466957_0001268 3300044842 Bacteria 13149
236 Ga0466957_0200658 3300044842 Bacteria 1310
237 Ga0466957_0441928 3300044842 Bacteria 895
238 Ga0466958_0025743 3300045836 Bacteria 3472
239 Ga0495603_0000102 3300046455 Bacteria 40074
240 Ga0495603_0001271 3300046455 Bacteria 14685
241 Ga0495591_048307 3300046458 Unclassified 1174
242 Ga0495629_0000828 3300046459 Bacteria 25082
243 Ga0495629_0029414 3300046459 Bacteria 3896
244 Ga0495629_0172702 3300046459 Unclassified 1499
245 Ga0495641_0000004 3300046461 Bacteria 210501
246 Ga0495641_0040594 3300046461 Bacteria 2163
247 Ga0495641_0049179 3300046461 Bacteria 1932
248 Ga0495651_0069917 3300046462 Bacteria 2672
249 Ga0495651_0134502 3300046462 Unclassified 1801
250 Ga0495662_0000069 3300046476 Bacteria 36219
251 Ga0495662_0002052 3300046476 Bacteria 10100
252 Ga0495606_0000017 3300046507 Bacteria 284549
253 Ga0495608_0000013 3300046511 Bacteria 228481
254 Ga0495608_0005080 3300046511 Bacteria 9402
255 Ga0495608_0174767 3300046511 Bacteria 1361
256 Ga0495610_0109527 3300046512 Unclassified 1225
257 Ga0495618_0000267 3300046514 Bacteria 37924
258 Ga0495620_0000041 3300046515 Bacteria 112605
259 Ga0495628_0000794 3300046516 Bacteria 29108
260 Ga0495628_0003421 3300046516 Bacteria 14207
261 Ga0495628_0271639 3300046516 Unclassified 1261
262 Ga0495628_0361480 3300046516 Bacteria 1066
263 Ga0495630_0000026 3300046517 Bacteria 147084
264 Ga0495630_0000032 3300046517 Bacteria 134425
265 Ga0495630_0009525 3300046517 Bacteria 6985
266 Ga0495644_0075770 3300046523 Unclassified 1267
267 Ga0495652_0000018 3300046529 Bacteria 201634
268 Ga0495652_0084431 3300046529 Bacteria 2611
269 Ga0495652_0116183 3300046529 Bacteria 2143
270 Ga0495640_0026335 3300046533 Bacteria 4204
271 Ga0495640_0039697 3300046533 Bacteria 3301
272 Ga0495586_0000254 3300046535 Bacteria 35015
273 Ga0495587_0000272 3300046536 Bacteria 36939
274 Ga0495587_0065886 3300046536 Bacteria 2114
275 Ga0495621_0000692 3300046539 Bacteria 8511
276 Ga0495645_0008553 3300046543 Bacteria 7148
277 Ga0495667_0000038 3300046559 Bacteria 131349
278 Ga0495668_0283848 3300046616 Bacteria 907
279 Ga0495634_0012207 3300046642 Bacteria 6228
280 Ga0495634_0107580 3300046642 Unclassified 1796
281 Ga0495634_0148467 3300046642 Bacteria 1484
282 Ga0495625_0507923 3300046660 Bacteria 736
283 Ga0495635_0000005 3300046663 Bacteria 302178
284 Ga0495635_0256091 3300046663 Unclassified 1179
285 Ga0495588_0000073 3300046674 Bacteria 219005
286 Ga0495657_0000003 3300046675 Bacteria 279680
287 Ga0495657_0026099 3300046675 Bacteria 4141
288 Ga0495599_0269441 3300046678 Bacteria 1033
289 Ga0495623_0121912 3300046679 Bacteria 1569
290 Ga0495647_0010829 3300046681 Bacteria 3114
291 Ga0495647_0073084 3300046681 Bacteria 1376
292 Ga0495647_0182069 3300046681 Bacteria 914
293 Ga0495647_0340574 3300046681 Unclassified 681
294 Ga0495658_0016938 3300046683 Bacteria 3756
295 Ga0495658_0068054 3300046683 Bacteria 2061
296 Ga0495669_0003848 3300046684 Bacteria 6171
297 Ga0495613_0000027 3300046689 Bacteria 146674
298 Ga0495613_0001632 3300046689 Bacteria 17071
299 Ga0495624_0000123 3300046690 Bacteria 54291
300 Ga0495624_0000691 3300046690 Bacteria 26457
301 Ga0495624_0019486 3300046690 Bacteria 4525
302 Ga0495649_0007918 3300046694 Bacteria 6430
303 Ga0495600_0007613 3300046809 Bacteria 6634
304 Ga0495600_0030031 3300046809 Bacteria 3520
305 Ga0495600_0578824 3300046809 Bacteria 684
306 Ga0495581_0179913 3300047315 Archaea 1236
307 Ga0495604_0000723 3300047317 Bacteria 27948
308 Ga0495604_0023180 3300047317 Bacteria 4954
309 Ga0495674_0000039 3300047319 Bacteria 97645
310 Ga0495676_0034965 3300047321 Bacteria 4209
311 Ga0495676_0044649 3300047321 Bacteria 3615
312 Ga0495676_0496782 3300047321 Bacteria 801
313 Ga0495680_0000007 3300047322 Bacteria 152053
314 Ga0495680_0000929 3300047322 Bacteria 32526
315 Ga0495680_0001001 3300047322 Bacteria 31451
316 Ga0495680_0103038 3300047322 Bacteria 2124
317 Ga0495680_1069129 3300047322 Bacteria 511
318 Ga0495675_0000002 3300047444 Bacteria 216469
319 Ga0495684_0156167 3300047471 Bacteria 1704
320 Ga0495684_0259560 3300047471 Bacteria 1261
321 Ga0495686_0122196 3300047472 Unclassified 1550
322 Ga0495593_0677714 3300047673 Bacteria 517
323 Ga0495602_0000034 3300048088 Bacteria 140722
324 Ga0495602_0009482 3300048088 Bacteria 10121
325 Ga0495602_0156364 3300048088 Bacteria 1785
326 Ga0496100_0000024 3300048903 Bacteria 116138
327 Ga0496100_0556138 3300048903 Bacteria 888
328 Ga0496101_0000072 3300048904 Bacteria 116138
329 Ga0496101_0598058 3300048904 Bacteria 872
330 Ga0496102_0000749 3300048905 Bacteria 31723
331 Ga0496102_0181760 3300048905 Bacteria 1982
332 Ga0496102_0758629 3300048905 Bacteria 893
333 Ga0496102_0910329 3300048905 Bacteria 801
334 Ga0496103_0003112 3300048906 Bacteria 10202
335 Ga0496103_0735017 3300048906 Bacteria 625
336 Ga0496104_0000008 3300048907 Bacteria 516976
337 Ga0496104_0000230 3300048907 Bacteria 49225
338 Ga0496105_0000003 3300048908 Bacteria 713251
339 Ga0496105_0000051 3300048908 Bacteria 90365
340 Ga0496105_0443054 3300048908 Bacteria 1026
341 Ga0496106_0000040 3300048909 Bacteria 108754
342 Ga0496106_0000042 3300048909 Bacteria 106662
343 Ga0496107_0000025 3300048910 Bacteria 116138
344 Ga0496107_0030281 3300048910 Bacteria 3857
345 Ga0496107_0126294 3300048910 Bacteria 1887
346 Ga0496108_0000004 3300048911 Bacteria 545055
347 Ga0496108_0000005 3300048911 Bacteria 535059
348 Ga0496109_0000002 3300048912 Bacteria 443393
349 Ga0496109_0000013 3300048912 Bacteria 227469
350 Ga0496109_0000221 3300048912 Bacteria 56054
351 Ga0496109_0293051 3300048912 Unclassified 1534
352 Ga0496109_0825691 3300048912 Bacteria 865
353 Ga0496109_0907432 3300048912 Bacteria 819
354 Ga0496109_1050890 3300048912 Unclassified 752
355 Ga0496110_0017911 3300048913 Bacteria 5931
356 Ga0496110_0085616 3300048913 Bacteria 2813
357 Ga0496110_0818292 3300048913 Bacteria 836
358 Ga0496111_1340088 3300048914 Bacteria 503
359 Ga0496112_0000026 3300048915 Bacteria 144758
360 Ga0496112_0021401 3300048915 Bacteria 6150
361 Ga0496112_0226737 3300048915 Bacteria 1824
362 Ga0496112_0926924 3300048915 Bacteria 792
363 Ga0496113_0000005 3300048916 Bacteria 105956
364 Ga0496113_0039531 3300048916 Bacteria 3472
365 Ga0496114_0000003 3300048917 Bacteria 630981
366 Ga0496114_0005156 3300048917 Bacteria 10194
367 Ga0496114_0333630 3300048917 Bacteria 1341
368 Ga0496115_0000016 3300048918 Bacteria 187067
369 Ga0496115_0000827 3300048918 Bacteria 22678
370 Ga0496115_0004801 3300048918 Bacteria 9806
371 Ga0496118_0142297 3300048921 Bacteria 1518
372 Ga0496118_0330071 3300048921 Unclassified 823
373 Ga0496119_0244162 3300048922 Bacteria 908
374 Ga0496125_0613399 3300048928 Bacteria 592
375 Ga0501040_0339759 3300049576 Bacteria 1075
376 Ga0501040_0534579 3300049576 Bacteria 846
377 Ga0501042_0009362 3300049578 Bacteria 6526
378 Ga0501048_0230230 3300049582 Bacteria 1315
379 Ga0501067_0618485 3300049583 Unclassified 608
380 Ga0501068_0301909 3300049584 Bacteria 1025
381 Ga0501069_0178010 3300049585 Unclassified 1229
382 Ga0501070_0257910 3300049586 Bacteria 1425
383 Ga0501070_0570291 3300049586 Bacteria 904
384 Ga0501074_0051402 3300049590 Bacteria 2974
385 Ga0501076_0076532 3300049592 Bacteria 2684
386 Ga0501079_0669713 3300049741 Bacteria 817
387 Ga0501079_0969077 3300049741 Unclassified 670
388 Ga0501080_0090111 3300049742 Bacteria 2849
389 Ga0501045_0436084 3300049824 Bacteria 974
390 nmdc:mga0yw44_461209_c1 3300050492 Bacteria 861
391 nmdc:mga0yw44_503492_c1 3300050492 Bacteria 822
392 nmdc:mga06z11_179776_c1 3300050494 Bacteria 1219
393 nmdc:mga0qj67_183648_c1 3300050509 Bacteria 1699
394 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
395 Ga0495601_0000017 3300053077 Bacteria 204209
396 Ga0495601_0003205 3300053077 Bacteria 9362
397 Ga0495601_0004530 3300053077 Bacteria 8033
398 Ga0495601_0007036 3300053077 Bacteria 6593
399 Ga0495601_0020026 3300053077 Bacteria 4083
400 Ga0495601_0142066 3300053077 Bacteria 1566
401 Ga0495612_0003768 3300053078 Bacteria 6305
402 Ga0495612_0008866 3300053078 Bacteria 4074
403 Ga0495612_0010356 3300053078 Bacteria 3772
404 Ga0495612_0108697 3300053078 Bacteria 1185
405 Ga0495612_0147030 3300053078 Bacteria 1024
406 Ga0495612_0179560 3300053078 Bacteria 929
407 Ga0495655_0000258 3300053083 Bacteria 9877
408 Ga0495655_0001219 3300053083 Bacteria 3972
409 Ga0495595_0000007 3300053084 Bacteria 228504
410 Ga0495595_0000378 3300053084 Bacteria 16864
411 Ga0495595_0007746 3300053084 Bacteria 4398
412 Ga0495619_0000026 3300053085 Bacteria 167387
413 Ga0495619_0000127 3300053085 Bacteria 55995
414 Ga0495619_0003767 3300053085 Bacteria 9753
415 Ga0495619_0007002 3300053085 Bacteria 7137
416 Ga0495619_0416679 3300053085 Bacteria 927
417 Ga0500614_000426 3300053123 Bacteria 10958
418 Ga0500628_000072 3300053129 Bacteria 26251
419 Ga0501084_0607606 3300054114 Bacteria 924
420 Ga0501082_0412093 3300060353 Bacteria 1180
421 Ga0500641_0001015
422 JGI24740J21852_10022756
423 Ga0070676_10727135
424 Ga0070683_100009649
425 Ga0070670_100144916
426 Ga0070670_100505383
427 Ga0070670_100884396
428 Ga0070677_10000521
429 Ga0070666_10030539
430 Ga0070680_100014062
431 Ga0068868_100000694
432 Ga0070660_100187238
433 Ga0070691_10000004
434 Ga0070687_100085516
435 Ga0070668_100120801
436 Ga0070668_100297547
437 Ga0070669_100395911
438 Ga0070671_100061637
439 Ga0070674_100000141
440 Ga0070674_100224244
441 Ga0070673_100005888
442 Ga0070688_100000010
443 Ga0070688_100000686
444 Ga0070659_100003678
445 Ga0070667_100001110
446 Ga0070667_100037746
447 Ga0070667_101044470
448 Ga0070713_100000503
449 Ga0070713_100486707
450 Ga0070710_10154265
451 Ga0070678_100007037
452 Ga0070681_10037706
453 Ga0070685_10000010
454 Ga0070685_10001080
455 Ga0070679_100000424
456 Ga0070684_100014422
457 Ga0070684_100111225
458 Ga0070684_100122802
459 Ga0070686_100166436
460 Ga0070693_100001267
461 Ga0070665_100002868
462 Ga0070665_100042444
463 Ga0068855_100053536
464 Ga0070664_100052530
465 Ga0070664_100289624
466 Ga0068854_100000082
467 Ga0068854_100097017
468 Ga0068856_100000136
469 Ga0068856_100013363
470 Ga0068856_101483218
471 Ga0070702_100054974
472 Ga0068852_100000994
473 Ga0068859_101391825
474 Ga0068864_100000090
475 Ga0068866_10000004
476 Ga0068866_10000206
477 Ga0068866_10016679
478 Ga0068861_100355723
479 Ga0068861_101963570
480 Ga0068851_10001071
481 Ga0068863_100121298
482 Ga0068863_100190446
483 Ga0068858_100001180
484 Ga0068858_100281646
485 Ga0068860_100474956
486 Ga0068862_100017783
487 Ga0081455_10004942
488 Ga0081455_10280764
489 Ga0081538_10157987
490 Ga0081539_10000776
491 Ga0075365_10543000
492 Ga0075368_10112694
493 Ga0070712_100000841
494 Ga0075367_10223024
495 Ga0097621_100160157
496 Ga0097621_101702745
497 Ga0068871_100310952
498 Ga0075430_100206320
499 Ga0075433_10000337
500 Ga0068865_100001495
501 Ga0097620_101391872
502 Ga0105240_10536233
503 Ga0105245_10000040
504 Ga0105245_10000117
505 Ga0105245_10000629
506 Ga0105245_10038238
507 Ga0105245_11084751
508 Ga0105247_10050849
509 Ga0105247_10078003
510 Ga0105242_10000063
511 Ga0105242_10061550
512 Ga0105242_11575292
513 Ga0105248_10000037
514 Ga0105248_11519020
515 Ga0105249_10000218
516 Ga0105249_10017915
517 Ga0105249_11034453
518 Ga0105246_10182023
519 Ga0157371_10004888
520 Ga0157369_10001730
521 Ga0157374_10001719
522 Ga0157374_10101946
523 Ga0157374_12263052
524 Ga0157378_10149338
525 Ga0163162_10504488
526 Ga0163162_12003253
527 Ga0157372_10000146
528 Ga0157372_12323447
529 Ga0157375_10318422
530 Ga0157375_10462630
531 Ga0157375_13204230
532 Ga0163163_10080228
533 Ga0163163_10278387
534 Ga0163163_10771727
535 Ga0157380_10001343
536 Ga0157379_10056698
537 Ga0157379_10088527
538 Ga0157379_10141140
539 Ga0157379_10712100
540 Ga0163161_10000064
541 Ga0163161_10008446
542 Ga0206356_10906881
543 Ga0206349_1553209
544 Ga0206352_10936627
545 Ga0154015_1003828
546 Ga0207656_10001283
547 Ga0207682_10000769
548 Ga0207692_10126787
549 Ga0207642_10000005
550 Ga0207642_10000473
551 Ga0207642_10019348
552 Ga0207710_10041562
553 Ga0207680_10007123
554 Ga0207645_10582733
555 Ga0207643_10259918
556 Ga0207707_10059817
557 Ga0207695_10665760
558 Ga0207693_10010825
559 Ga0207660_10004388
560 Ga0207657_10166653
561 Ga0207649_10000003
562 Ga0207652_10000232
563 Ga0207650_10030751
564 Ga0207650_10359573
565 Ga0207687_10000070
566 Ga0207687_10020955
567 Ga0207700_10000003
568 Ga0207700_10867112
569 Ga0207664_10015535
570 Ga0207644_10116586
571 Ga0207690_10002537
572 Ga0207686_10000230
573 Ga0207686_10030532
574 Ga0207669_10000003
575 Ga0207669_10000021
576 Ga0207669_10107293
577 Ga0207704_10000104
578 Ga0207691_10000178
579 Ga0207711_10000011
580 Ga0207711_11041839
581 Ga0207661_10004619
582 Ga0207661_10007065
583 Ga0207661_10527283
584 Ga0207679_10018802
585 Ga0207679_10235554
586 Ga0207667_10122450
587 Ga0207651_10003288
588 Ga0207712_10000027
589 Ga0207712_10012099
590 Ga0207712_10382903
591 Ga0207668_11392613
592 Ga0207640_10000054
593 Ga0207640_10047856
594 Ga0207658_10001811
595 Ga0207658_10056859
596 Ga0207677_10003648
597 Ga0207677_10009001
598 Ga0207703_10000020
599 Ga0207703_10301483
600 Ga0207639_11184986
601 Ga0207702_10000105
602 Ga0207702_10001788
603 Ga0207702_10026085
604 Ga0207702_10214281
605 Ga0207641_10011027
606 Ga0207641_10076027
607 Ga0207641_10190668
608 Ga0207676_10000016
609 Ga0207675_100332344
610 Ga0207683_10167842
611 Ga0207698_10000015
612 Ga0207698_10044308
613 Ga0207698_11545185
614 Ga0268266_10000029
615 Ga0268266_10000526
616 Ga0268266_10024467
617 Ga0268265_10001768
618 Ga0268264_10001191
619 Ga0268264_10227716
620 Ga0265337_1001256
621 Ga0265326_10000452
622 Ga0265319_1000010
623 Ga0265319_1077929
624 Ga0265322_10000005
625 Ga0265336_10047644
626 Ga0265338_10000287
627 Ga0265324_10000183
628 Ga0265324_10101630
629 Ga0307511_10211734
630 Ga0265328_10014040
631 Ga0265320_10000010
632 Ga0265325_10028601
633 Ga0265329_10001050
634 Ga0265339_10014859
635 Ga0265331_10000217
636 Ga0265327_10000040
637 Ga0265316_10055023
638 Ga0265313_10124893
639 Ga0265342_10144521
640 Ga0307410_10371956
641 Ga0307416_100005097
642 Ga0307415_100045299
643 Ga0373956_0293489
644 Ga0373957_0154340
645 Ga0316574_0042454
646 Ga0451800_0385771
647 Ga0451800_0612137
648 Ga0451807_0762306
649 Ga0451807_2751078
650 Ga0451847_0293030
651 Ga0451849_0744065
652 Ga0451853_1793063
653 Ga0439459_0203748
654 Ga0466963_0000233
655 Ga0466957_0001268
656 Ga0466957_0200658
657 Ga0466957_0441928
658 Ga0466958_0025743
659 Ga0495603_0000102
660 Ga0495603_0001271
661 Ga0495591_048307
662 Ga0495629_0000828
663 Ga0495629_0029414
664 Ga0495629_0172702
665 Ga0495641_0000004
666 Ga0495641_0040594
667 Ga0495641_0049179
668 Ga0495651_0069917
669 Ga0495651_0134502
670 Ga0495662_0000069
671 Ga0495662_0002052
672 Ga0495606_0000017
673 Ga0495608_0000013
674 Ga0495608_0005080
675 Ga0495608_0174767
676 Ga0495610_0109527
677 Ga0495618_0000267
678 Ga0495620_0000041
679 Ga0495628_0000794
680 Ga0495628_0003421
681 Ga0495628_0271639
682 Ga0495628_0361480
683 Ga0495630_0000026
684 Ga0495630_0000032
685 Ga0495630_0009525
686 Ga0495644_0075770
687 Ga0495652_0000018
688 Ga0495652_0084431
689 Ga0495652_0116183
690 Ga0495640_0026335
691 Ga0495640_0039697
692 Ga0495586_0000254
693 Ga0495587_0000272
694 Ga0495587_0065886
695 Ga0495621_0000692
696 Ga0495645_0008553
697 Ga0495667_0000038
698 Ga0495668_0283848
699 Ga0495634_0012207
700 Ga0495634_0107580
701 Ga0495634_0148467
702 Ga0495625_0507923
703 Ga0495635_0000005
704 Ga0495635_0256091
705 Ga0495588_0000073
706 Ga0495657_0000003
707 Ga0495657_0026099
708 Ga0495599_0269441
709 Ga0495623_0121912
710 Ga0495647_0010829
711 Ga0495647_0073084
712 Ga0495647_0182069
713 Ga0495647_0340574
714 Ga0495658_0016938
715 Ga0495658_0068054
716 Ga0495669_0003848
717 Ga0495613_0000027
718 Ga0495613_0001632
719 Ga0495624_0000123
720 Ga0495624_0000691
721 Ga0495624_0019486
722 Ga0495649_0007918
723 Ga0495600_0007613
724 Ga0495600_0030031
725 Ga0495600_0578824
726 Ga0495581_0179913
727 Ga0495604_0000723
728 Ga0495604_0023180
729 Ga0495674_0000039
730 Ga0495676_0034965
731 Ga0495676_0044649
732 Ga0495676_0496782
733 Ga0495680_0000007
734 Ga0495680_0000929
735 Ga0495680_0001001
736 Ga0495680_0103038
737 Ga0495680_1069129
738 Ga0495675_0000002
739 Ga0495684_0156167
740 Ga0495684_0259560
741 Ga0495686_0122196
742 Ga0495593_0677714
743 Ga0495602_0000034
744 Ga0495602_0009482
745 Ga0495602_0156364
746 Ga0496100_0000024
747 Ga0496100_0556138
748 Ga0496101_0000072
749 Ga0496101_0598058
750 Ga0496102_0000749
751 Ga0496102_0181760
752 Ga0496102_0758629
753 Ga0496102_0910329
754 Ga0496103_0003112
755 Ga0496103_0735017
756 Ga0496104_0000008
757 Ga0496104_0000230
758 Ga0496105_0000003
759 Ga0496105_0000051
760 Ga0496105_0443054
761 Ga0496106_0000040
762 Ga0496106_0000042
763 Ga0496107_0000025
764 Ga0496107_0030281
765 Ga0496107_0126294
766 Ga0496108_0000004
767 Ga0496108_0000005
768 Ga0496109_0000002
769 Ga0496109_0000013
770 Ga0496109_0000221
771 Ga0496109_0293051
772 Ga0496109_0825691
773 Ga0496109_0907432
774 Ga0496109_1050890
775 Ga0496110_0017911
776 Ga0496110_0085616
777 Ga0496110_0818292
778 Ga0496111_1340088
779 Ga0496112_0000026
780 Ga0496112_0021401
781 Ga0496112_0226737
782 Ga0496112_0926924
783 Ga0496113_0000005
784 Ga0496113_0039531
785 Ga0496114_0000003
786 Ga0496114_0005156
787 Ga0496114_0333630
788 Ga0496115_0000016
789 Ga0496115_0000827
790 Ga0496115_0004801
791 Ga0496118_0142297
792 Ga0496118_0330071
793 Ga0496119_0244162
794 Ga0496125_0613399
795 Ga0501040_0339759
796 Ga0501040_0534579
797 Ga0501042_0009362
798 Ga0501048_0230230
799 Ga0501067_0618485
800 Ga0501068_0301909
801 Ga0501069_0178010
802 Ga0501070_0257910
803 Ga0501070_0570291
804 Ga0501074_0051402
805 Ga0501076_0076532
806 Ga0501079_0669713
807 Ga0501079_0969077
808 Ga0501080_0090111
809 Ga0501045_0436084
810 nmdc:mga0yw44_461209_c1
811 nmdc:mga0yw44_503492_c1
812 nmdc:mga06z11_179776_c1
813 nmdc:mga0qj67_183648_c1
814 nmdc:mga0a205_4_c1
815 Ga0495601_0000017
816 Ga0495601_0003205
817 Ga0495601_0004530
818 Ga0495601_0007036
819 Ga0495601_0020026
820 Ga0495601_0142066
821 Ga0495612_0003768
822 Ga0495612_0008866
823 Ga0495612_0010356
824 Ga0495612_0108697
825 Ga0495612_0147030
826 Ga0495612_0179560
827 Ga0495655_0000258
828 Ga0495655_0001219
829 Ga0495595_0000007
830 Ga0495595_0000378
831 Ga0495595_0007746
832 Ga0495619_0000026
833 Ga0495619_0000127
834 Ga0495619_0003767
835 Ga0495619_0007002
836 Ga0495619_0416679
837 Ga0500614_000426
838 Ga0500628_000072
839 Ga0501084_0607606
840 Ga0501082_0412093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

55

108

0.9

PF00571

CBS

CBS domain

2

59

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npl-assembly1.cif.gz_A crystal structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria, yb-derivative at 2.8 a resolution 0.9324 1 118
5nmu-assembly1.cif.gz_B-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.9288 1 118
5nmu-assembly1.cif.gz_C-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.9278 1 118
1pvm-assembly1.cif.gz_A crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum 0.914 1 119
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9071 6 123
ID Description Score Start End Superfamily
1pvmA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.914 1 119 3.10.580.10
af_O13965_237_391_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9074 1 122 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9071 6 123 3.10.580.10
af_Q5A3N2_197_353_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8992 1 132 3.10.580.10
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8984 8 122 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A7R7DVQ3-F1-model_v4 Histidine kinase 0.9897 1 131 GO:0016301
AF-A0A1C6UYX1-F1-model_v4 CBS domain-containing protein 0.9804 1 129
AF-A0A429F4T9-F1-model_v4 Histidine kinase 0.9782 1 121 GO:0016301
AF-A0A166QCH7-F1-model_v4 CBS domain-containing protein 0.9768 1 127
AF-A0A2I2KJ75-F1-model_v4 CBS domain-containing protein 0.9767 1 127

Map