F439893

General Info

Members Datasets Scaffolds Average Seq Length
421 237 842 405

Family's Representative Sequence

Representative Sequence 3300003756|Ga0055533_1000859|Ga0055533_10008596
Length 466
Sequence MKADAVARHGLCVCCRVAYTKSAVSLMTQVISSTSPIAPAAGTLARGDIRTLLLASLGGALEFYDFVVFVFFALPLSHLFFPPNTAPWVAQLQVYGIFAAGYLARPLGGIVMAHFGDRQGRKRMFTLSVFLMALPTLAIGLLPVYAQVGVLAPMLLLVMRVVQGVAIGGEVPGAWVFVAEHAPPGRVGFACACLTSGLTAGILIGSLTAAWINHHLAPEQVLGWGWRLPFLLGGVFGFIAVWLRRWLSETPVFAQLRERKEVSRELPLRTVLAGHGGSVLLSMAVTWTLTAAILVLILMLPNLAQKPFGIAPDVAFLGNSVAAFCLGLGCLAYGWLTDRIGAARALLVGSLALIAATYALFADLEAGGAHFLPLYALTGFLVGSVGVVPTVMVMAFPAPIRYSGISFAYNVAYAAFGALTATLISYLGERVGRMAPAHYVAMTAVVSVVAALWLMLSKRNKDKQLL

Samples

Sample ID Description Type Environment
1 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
58 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
59 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
60 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
112 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
118 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
173 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
174 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
175 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
176 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
177 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
178 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
179 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
180 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
181 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
182 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
183 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
184 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
185 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
186 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
187 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
188 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
189 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
190 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
191 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
192 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
193 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
194 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
195 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
196 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
197 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
198 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
199 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
200 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
201 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
202 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
203 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
204 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
205 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
206 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
207 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
208 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
209 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
210 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
211 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
212 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
213 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
214 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
215 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
216 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
217 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
218 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
219 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
220 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
221 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
222 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
223 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
224 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
225 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
226 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
227 2928163908 Burkholderia sp. 567 Isolate Unclassified
228 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
229 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
230 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
231 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
232 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
233 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
234 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
235 8018221730 Enterobacter sp. CM29 Isolate Unclassified
236 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
237 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.56
Metatranscriptomes 0
Isolates 15.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 4.04
Nodule 3.56
Rhizoplane 11.4
Rhizosphere 54.87
Stem 0
Stem Tuber 0.71
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055533_1000859 3300003756 Bacteria 9275
2 SwRhRL2b_contig_1553576 2162886007 Bacteria 2712
3 JGI24740J21852_10016034 3300001979 Bacteria 2718
4 JGI24739J22299_10000234 3300001989 Bacteria 18698
5 JGI24737J22298_10034322 3300001990 Bacteria 1573
6 JGI25156J39149_1005647 3300002705 Bacteria 3562
7 JGI25156J39149_1009922 3300002705 Bacteria 2276
8 JGI25157J39369_1001502 3300002741 Bacteria 8506
9 JGI25157J39369_1005316 3300002741 Bacteria 2126
10 JGI25152J39213_1000367 3300002773 Bacteria 27850
11 rootH2_10032116 3300003320 Bacteria 24090
12 Ga0055531_10010986 3300003794 Bacteria 4429
13 Ga0058692_1000014 3300003856 Bacteria 313984
14 Ga0058692_1005731 3300003856 Bacteria 3502
15 Ga0058692_1005732 3300003856 Bacteria 3502
16 Ga0058692_1009016 3300003856 Bacteria 2543
17 Ga0065703_1000120 3300005272 Bacteria 47864
18 Ga0065704_10003841 3300005289 Bacteria 6810
19 Ga0065704_10004799 3300005289 Bacteria 3915
20 Ga0065704_10006863 3300005289 Bacteria 2424
21 Ga0065704_10082709 3300005289 Bacteria 3562
22 Ga0065704_10092535 3300005289 Bacteria 2648
23 Ga0065704_10102278 3300005289 Bacteria 2204
24 Ga0070658_10063904 3300005327 Bacteria 3002
25 Ga0070683_100219227 3300005329 Bacteria 1808
26 Ga0068869_100098429 3300005334 Bacteria 2209
27 Ga0070666_10066533 3300005335 Bacteria 2446
28 Ga0070660_100000089 3300005339 Bacteria 55361
29 Ga0070669_100008173 3300005353 Bacteria 7472
30 Ga0070659_100000060 3300005366 Bacteria 85656
31 Ga0070667_100019631 3300005367 Bacteria 5606
32 Ga0070667_100111339 3300005367 Bacteria 2374
33 Ga0070663_100054988 3300005455 Bacteria 2847
34 Ga0070663_100134745 3300005455 Bacteria 1880
35 Ga0068867_100088127 3300005459 Bacteria 2352
36 Ga0068867_100140778 3300005459 Unclassified 1885
37 Ga0070696_100026507 3300005546 Bacteria 3943
38 Ga0070665_100000126 3300005548 Bacteria 146495
39 Ga0070665_100007189 3300005548 Bacteria 11317
40 Ga0070665_100024807 3300005548 Bacteria 6041
41 Ga0070665_100069632 3300005548 Bacteria 3526
42 Ga0070665_100099548 3300005548 Bacteria 2911
43 Ga0068855_100053417 3300005563 Bacteria 4753
44 Ga0070664_100123710 3300005564 Bacteria 2267
45 Ga0068857_100000386 3300005577 Bacteria 30880
46 Ga0068857_100000624 3300005577 Bacteria 26024
47 Ga0068856_100001432 3300005614 Bacteria 25027
48 Ga0068859_100000180 3300005617 Bacteria 61976
49 Ga0068851_10009423 3300005834 Bacteria 4540
50 Ga0068851_10016883 3300005834 Bacteria 3498
51 Ga0068870_10017520 3300005840 Bacteria 3441
52 Ga0068863_100254333 3300005841 Bacteria 1697
53 Ga0068858_100040054 3300005842 Bacteria 4345
54 Ga0068860_100020703 3300005843 Bacteria 6372
55 Ga0068862_100001242 3300005844 Bacteria 24005
56 Ga0075364_10023611 3300006051 Bacteria 3895
57 Ga0097620_100000180 3300006931 Bacteria 61976
58 Ga0079104_1000403 3300006946 Bacteria 49953
59 Ga0079104_1001267 3300006946 Bacteria 17519
60 Ga0079104_1001515 3300006946 Bacteria 15400
61 Ga0079104_1001820 3300006946 Bacteria 13146
62 Ga0079104_1002919 3300006946 Bacteria 8499
63 Ga0079104_1003023 3300006946 Bacteria 8256
64 Ga0079104_1010633 3300006946 Bacteria 3013
65 Ga0105251_10014126 3300009011 Bacteria 4431
66 Ga0105251_10017931 3300009011 Bacteria 3780
67 Ga0105251_10018857 3300009011 Bacteria 3658
68 Ga0105251_10019495 3300009011 Bacteria 3581
69 Ga0105251_10076878 3300009011 Bacteria 1548
70 Ga0105244_10002529 3300009036 Bacteria 13733
71 Ga0105244_10003241 3300009036 Bacteria 11771
72 Ga0105244_10007248 3300009036 Bacteria 7065
73 Ga0105244_10024469 3300009036 Bacteria 3294
74 Ga0105244_10095430 3300009036 Bacteria 1459
75 Ga0105250_10000045 3300009092 Bacteria 127333
76 Ga0105250_10002858 3300009092 Bacteria 8455
77 Ga0105250_10003849 3300009092 Bacteria 7035
78 Ga0105250_10021907 3300009092 Bacteria 2578
79 Ga0105250_10063487 3300009092 Bacteria 1487
80 Ga0105240_10009176 3300009093 Bacteria 14030
81 Ga0105240_10042823 3300009093 Bacteria 5767
82 Ga0105240_10053417 3300009093 Bacteria 5070
83 Ga0105240_10140588 3300009093 Bacteria 2887
84 Ga0105247_10000502 3300009101 Bacteria 32176
85 Ga0105243_10000163 3300009148 Bacteria 75904
86 Ga0105243_10003177 3300009148 Bacteria 13461
87 Ga0105237_10002077 3300009545 Bacteria 25319
88 Ga0105237_10002794 3300009545 Bacteria 21207
89 Ga0105237_10084826 3300009545 Bacteria 3157
90 Ga0105249_10070119 3300009553 Bacteria 3235
91 Ga0105032_101050 3300009979 Bacteria 2577
92 Ga0105239_10045695 3300010375 Bacteria 4800
93 Ga0157373_10053620 3300013100 Bacteria 2867
94 Ga0157373_10071331 3300013100 Bacteria 2454
95 Ga0157371_10017745 3300013102 Bacteria 5280
96 Ga0157371_10029749 3300013102 Bacteria 3946
97 Ga0157371_10053145 3300013102 Bacteria 2877
98 Ga0157371_10117427 3300013102 Bacteria 1891
99 Ga0157370_10004198 3300013104 Bacteria 16670
100 Ga0157370_10035747 3300013104 Bacteria 4826
101 Ga0157370_10141156 3300013104 Bacteria 2244
102 Ga0157369_10000183 3300013105 Bacteria 86986
103 Ga0157369_10081116 3300013105 Bacteria 3472
104 Ga0157372_10001095 3300013307 Bacteria 29471
105 Ga0157372_10024069 3300013307 Bacteria 6607
106 Ga0157372_10204062 3300013307 Bacteria 2290
107 Ga0157376_10040244 3300014969 Bacteria 3819
108 Ga0182006_1000025 3300015261 Bacteria 255969
109 Ga0182006_1033648 3300015261 Bacteria 2054
110 Ga0183366_1003 3300015679 Bacteria 453474
111 Ga0183370_1003 3300015680 Bacteria 454044
112 Ga0183369_1005 3300015685 Bacteria 453680
113 Ga0183368_1004 3300015687 Bacteria 1211761
114 Ga0183368_1006 3300015687 Bacteria 551576
115 Ga0163161_10040865 3300017792 Bacteria 3331
116 Ga0163161_10041470 3300017792 Bacteria 3307
117 Ga0213876_10000026 3300021384 Bacteria 231892
118 Ga0213876_10002743 3300021384 Bacteria 10255
119 Ga0213871_10009323 3300021441 Bacteria 2196
120 Ga0209674_100062 3300025226 Bacteria 276316
121 Ga0209258_100426 3300025242 Bacteria 49240
122 Ga0209646_1003696 3300025246 Bacteria 2951
123 Ga0209026_1000496 3300025250 Bacteria 28806
124 Ga0209026_1001270 3300025250 Bacteria 11518
125 Ga0209026_1007916 3300025250 Bacteria 2299
126 Ga0209759_1002665 3300025256 Bacteria 7644
127 Ga0209759_1007349 3300025256 Bacteria 3553
128 Ga0209129_1000008 3300025258 Bacteria 640959
129 Ga0209129_1003695 3300025258 Bacteria 6487
130 Ga0209455_1000225 3300025272 Bacteria 76514
131 Ga0209455_1000233 3300025272 Bacteria 70104
132 Ga0209758_1001246 3300025297 Bacteria 31649
133 Ga0209257_1000585 3300025304 Bacteria 61004
134 Ga0207696_1000140 3300025711 Bacteria 127393
135 Ga0207696_1004838 3300025711 Bacteria 5711
136 Ga0207696_1023140 3300025711 Bacteria 1963
137 Ga0207655_1000017 3300025728 Bacteria 544403
138 Ga0207655_1000026 3300025728 Bacteria 445528
139 Ga0207655_1000822 3300025728 Bacteria 33630
140 Ga0207655_1002118 3300025728 Bacteria 16607
141 Ga0207655_1003852 3300025728 Bacteria 10924
142 Ga0207655_1005359 3300025728 Bacteria 8750
143 Ga0207655_1005778 3300025728 Bacteria 8335
144 Ga0207655_1019483 3300025728 Bacteria 3542
145 Ga0207713_1000110 3300025735 Bacteria 135907
146 Ga0207713_1000419 3300025735 Bacteria 45136
147 Ga0207713_1002154 3300025735 Bacteria 14631
148 Ga0207713_1002981 3300025735 Bacteria 11834
149 Ga0207713_1010265 3300025735 Bacteria 5195
150 Ga0207713_1010976 3300025735 Bacteria 4969
151 Ga0207713_1013824 3300025735 Bacteria 4229
152 Ga0207713_1018276 3300025735 Bacteria 3476
153 Ga0207710_10000009 3300025900 Bacteria 485205
154 Ga0207680_10082962 3300025903 Bacteria 2019
155 Ga0207647_10007791 3300025904 Bacteria 7709
156 Ga0207647_10039306 3300025904 Bacteria 2986
157 Ga0207695_10000349 3300025913 Bacteria 106823
158 Ga0207695_10001818 3300025913 Bacteria 33585
159 Ga0207695_10022688 3300025913 Bacteria 7114
160 Ga0207695_10057826 3300025913 Bacteria 4027
161 Ga0207671_10000059 3300025914 Bacteria 179761
162 Ga0207671_10001066 3300025914 Bacteria 33299
163 Ga0207657_10000089 3300025919 Bacteria 86978
164 Ga0207681_10001205 3300025923 Bacteria 16638
165 Ga0207690_10000073 3300025932 Bacteria 88099
166 Ga0207709_10000001 3300025935 Bacteria 2228154
167 Ga0207709_10005426 3300025935 Bacteria 7246
168 Ga0207691_10029279 3300025940 Bacteria 5151
169 Ga0207689_10072449 3300025942 Bacteria 2830
170 Ga0207667_10000383 3300025949 Bacteria 59865
171 Ga0207667_10019207 3300025949 Bacteria 7642
172 Ga0207667_10394748 3300025949 Bacteria 1409
173 Ga0207658_10009192 3300025986 Bacteria 6703
174 Ga0207703_10090859 3300026035 Bacteria 2567
175 Ga0207678_10001217 3300026067 Bacteria 23682
176 Ga0207678_10010473 3300026067 Bacteria 8143
177 Ga0207678_10077853 3300026067 Bacteria 2840
178 Ga0207702_10000874 3300026078 Bacteria 31362
179 Ga0207674_10000009 3300026116 Bacteria 202730
180 Ga0207674_10000189 3300026116 Bacteria 75437
181 Ga0207683_10054669 3300026121 Bacteria 3501
182 Ga0209281_1000058 3300027111 Bacteria 300244
183 Ga0209281_1000120 3300027111 Bacteria 206692
184 Ga0209281_1000223 3300027111 Bacteria 121161
185 Ga0209281_1000648 3300027111 Bacteria 37573
186 Ga0209281_1000822 3300027111 Bacteria 28039
187 Ga0209281_1001003 3300027111 Bacteria 22148
188 Ga0209281_1001185 3300027111 Bacteria 17897
189 Ga0209281_1005142 3300027111 Bacteria 3700
190 Ga0209371_1000014 3300027312 Bacteria 661118
191 Ga0209371_1000030 3300027312 Bacteria 423605
192 Ga0209371_1000040 3300027312 Bacteria 340804
193 Ga0209371_1000544 3300027312 Bacteria 35405
194 Ga0209371_1000563 3300027312 Bacteria 33948
195 Ga0209371_1001916 3300027312 Bacteria 12706
196 Ga0209371_1010507 3300027312 Bacteria 2839
197 Ga0209371_1018399 3300027312 Bacteria 1777
198 Ga0268266_10000001 3300028379 Bacteria 4040580
199 Ga0268266_10000290 3300028379 Bacteria 82154
200 Ga0268266_10019713 3300028379 Bacteria 5747
201 Ga0268266_10049088 3300028379 Bacteria 3618
202 Ga0268266_10124043 3300028379 Bacteria 2302
203 Ga0268266_10203239 3300028379 Bacteria 1814
204 Ga0268265_10011767 3300028380 Bacteria 5916
205 Ga0268264_10007080 3300028381 Bacteria 9398
206 Ga0268256_1000021 3300030500 Bacteria 542735
207 Ga0268256_1000025 3300030500 Bacteria 484317
208 Ga0268256_1000041 3300030500 Bacteria 340725
209 Ga0268256_1000462 3300030500 Bacteria 35405
210 Ga0268256_1000488 3300030500 Bacteria 33948
211 Ga0268256_1006025 3300030500 Bacteria 4611
212 Ga0268256_1007839 3300030500 Bacteria 3744
213 Ga0268256_1008100 3300030500 Bacteria 3646
214 Ga0395900_0051509 3300037418 Bacteria 4240
215 Ga0436364_0234395 3300037853 Bacteria 2580
216 Ga0436364_1485394 3300037853 Bacteria 8992
217 Ga0237816_00315 3300039145 Bacteria 4142
218 Ga0436365_0084998 3300039437 Bacteria 507888
219 Ga0436365_1160573 3300039437 Unclassified 1636
220 Ga0436365_1936450 3300039437 Bacteria 28674
221 Ga0436360_1189232 3300039438 Bacteria 2980
222 Ga0436361_1091969 3300039447 Bacteria 3031
223 Ga0436363_0949788 3300039450 Bacteria 3346
224 Ga0436363_1372512 3300039450 Bacteria 1690
225 Ga0439438_001320 3300041405 Bacteria 10978
226 Ga0439466_0009751 3300041411 Bacteria 3581
227 Ga0439465_0001219 3300041413 Bacteria 8284
228 Ga0451833_1103254 3300041491 Bacteria 9628
229 Ga0451835_0337175 3300041492 Bacteria 4990
230 Ga0451839_1600379 3300041496 Bacteria 5691
231 Ga0451841_0807511 3300041498 Bacteria 8587
232 Ga0451843_0248513 3300041509 Bacteria 6840
233 Ga0451853_1441961 3300041512 Bacteria 15656
234 Ga0439445_0016500 3300042004 Bacteria 1816
235 Ga0439452_000005 3300042010 Bacteria 646919
236 Ga0439452_000007 3300042010 Bacteria 613625
237 Ga0439452_000056 3300042010 Bacteria 106151
238 Ga0439452_001034 3300042010 Bacteria 12307
239 Ga0450902_002386 3300042137 Bacteria 2660
240 Ga0439464_0008714 3300042439 Bacteria 2659
241 Ga0439464_0012291 3300042439 Bacteria 2278
242 Ga0466981_0000014 3300044669 Bacteria 109658
243 Ga0466961_0000388 3300044693 Bacteria 28274
244 Ga0466960_0030478 3300044901 Bacteria 2482
245 Ga0466958_0090722 3300045836 Bacteria 1891
246 Ga0495591_000231 3300046458 Bacteria 54648
247 Ga0495591_005800 3300046458 Bacteria 5615
248 Ga0495638_0000007 3300046460 Bacteria 602783
249 Ga0495650_0000028 3300046471 Bacteria 473012
250 Ga0495650_0000113 3300046471 Bacteria 196536
251 Ga0495607_0007957 3300046501 Bacteria 7286
252 Ga0495607_0067834 3300046501 Bacteria 2002
253 Ga0495606_0000374 3300046507 Bacteria 76132
254 Ga0495616_0018756 3300046513 Bacteria 3790
255 Ga0495648_0012054 3300046524 Bacteria 6475
256 Ga0495663_0005325 3300046525 Bacteria 3571
257 Ga0495654_0000390 3300046530 Bacteria 37861
258 Ga0495588_0004172 3300046674 Bacteria 6372
259 Ga0495649_0003172 3300046694 Bacteria 11243
260 Ga0495649_0033356 3300046694 Bacteria 2834
261 Ga0495589_0030745 3300046794 Bacteria 2704
262 Ga0495660_0000034 3300046810 Bacteria 201261
263 Ga0495604_0036858 3300047317 Bacteria 3854
264 Ga0495674_0001315 3300047319 Bacteria 24181
265 Ga0495672_0000029 3300047320 Bacteria 305231
266 Ga0495683_0087958 3300047323 Bacteria 1508
267 Ga0495683_0088047 3300047323 Bacteria 1507
268 Ga0495675_0038276 3300047444 Bacteria 3053
269 Ga0495673_0000820 3300047469 Bacteria 29164
270 Ga0495681_0038056 3300047470 Bacteria 2362
271 Ga0495686_0000390 3300047472 Bacteria 69916
272 Ga0495602_0092311 3300048088 Bacteria 2508
273 Ga0496100_0054924 3300048903 Bacteria 2600
274 Ga0496101_0063027 3300048904 Bacteria 2697
275 Ga0496104_0004669 3300048907 Bacteria 11920
276 Ga0496104_0073143 3300048907 Bacteria 3261
277 Ga0496104_0157940 3300048907 Bacteria 2176
278 Ga0496104_0202780 3300048907 Bacteria 1895
279 Ga0496105_0145221 3300048908 Bacteria 1951
280 Ga0496113_0070137 3300048916 Bacteria 2663
281 Ga0496115_0039456 3300048918 Bacteria 3750
282 Ga0496116_0022832 3300048919 Bacteria 4674
283 Ga0496116_0055404 3300048919 Bacteria 2604
284 Ga0496116_0088113 3300048919 Bacteria 1897
285 Ga0496116_0094368 3300048919 Bacteria 1808
286 Ga0496116_0111493 3300048919 Bacteria 1606
287 Ga0496117_0006936 3300048920 Bacteria 11227
288 Ga0496117_0016937 3300048920 Bacteria 6110
289 Ga0496117_0018838 3300048920 Bacteria 5696
290 Ga0496117_0028923 3300048920 Bacteria 4281
291 Ga0496117_0029466 3300048920 Bacteria 4230
292 Ga0496117_0057386 3300048920 Bacteria 2704
293 Ga0496118_0002877 3300048921 Bacteria 22448
294 Ga0496118_0013280 3300048921 Bacteria 7806
295 Ga0496118_0031304 3300048921 Bacteria 4412
296 Ga0496118_0047662 3300048921 Bacteria 3319
297 Ga0496118_0062221 3300048921 Bacteria 2757
298 Ga0496118_0065128 3300048921 Bacteria 2668
299 Ga0496119_0000026 3300048922 Bacteria 254759
300 Ga0496119_0005618 3300048922 Bacteria 11925
301 Ga0496119_0021763 3300048922 Bacteria 4618
302 Ga0496119_0038335 3300048922 Bacteria 3098
303 Ga0496119_0044918 3300048922 Bacteria 2776
304 Ga0496120_0007521 3300048923 Bacteria 8087
305 Ga0496120_0009560 3300048923 Bacteria 6861
306 Ga0496120_0027459 3300048923 Bacteria 3500
307 Ga0496120_0031588 3300048923 Bacteria 3204
308 Ga0496120_0033692 3300048923 Bacteria 3075
309 Ga0496121_0004701 3300048924 Bacteria 18089
310 Ga0496121_0006797 3300048924 Bacteria 14014
311 Ga0496121_0007313 3300048924 Bacteria 13353
312 Ga0496121_0018220 3300048924 Bacteria 7098
313 Ga0496121_0047057 3300048924 Bacteria 3683
314 Ga0496121_0054639 3300048924 Bacteria 3334
315 Ga0496121_0070229 3300048924 Bacteria 2822
316 Ga0496121_0080791 3300048924 Bacteria 2575
317 Ga0496121_0187862 3300048924 Bacteria 1484
318 Ga0496122_0000075 3300048925 Bacteria 219099
319 Ga0496122_0001095 3300048925 Bacteria 46975
320 Ga0496122_0002193 3300048925 Bacteria 28526
321 Ga0496122_0017775 3300048925 Bacteria 6615
322 Ga0496122_0037012 3300048925 Bacteria 3936
323 Ga0496122_0038666 3300048925 Bacteria 3816
324 Ga0496122_0050071 3300048925 Bacteria 3189
325 Ga0496123_0000019 3300048926 Bacteria 400216
326 Ga0496123_0000377 3300048926 Bacteria 83811
327 Ga0496123_0000774 3300048926 Bacteria 51762
328 Ga0496123_0002587 3300048926 Bacteria 22019
329 Ga0496123_0003347 3300048926 Bacteria 18138
330 Ga0496123_0064931 3300048926 Bacteria 2323
331 Ga0496124_0000142 3300048927 Bacteria 147311
332 Ga0496124_0006756 3300048927 Bacteria 12399
333 Ga0496124_0019620 3300048927 Bacteria 6283
334 Ga0496124_0045443 3300048927 Bacteria 3764
335 Ga0496124_0064289 3300048927 Bacteria 3063
336 Ga0496124_0131898 3300048927 Bacteria 1984
337 Ga0496125_0000795 3300048928 Bacteria 51440
338 Ga0496125_0018128 3300048928 Bacteria 6691
339 Ga0496125_0055603 3300048928 Bacteria 3222
340 Ga0496126_0032375 3300048929 Bacteria 4926
341 Ga0496126_0037899 3300048929 Bacteria 4491
342 Ga0496126_0039864 3300048929 Bacteria 4355
343 Ga0496126_0043465 3300048929 Bacteria 4145
344 Ga0496126_0093829 3300048929 Bacteria 2634
345 Ga0496126_0109399 3300048929 Bacteria 2408
346 Ga0495678_000984 3300049459 Bacteria 24399
347 Ga0495682_0000003 3300049460 Bacteria 515787
348 Ga0495682_0021220 3300049460 Bacteria 2434
349 Ga0501225_0001509 3300049705 Bacteria 7305
350 Ga0501035_0026672 3300049822 Bacteria 5285
351 Ga0501044_0030562 3300049823 Bacteria 5675
352 nmdc:mga0k408_2713_c1 3300050493 Bacteria 9399
353 Ga0500621_000006 3300053126 Bacteria 245480
354 Ga0500568_0000002 3300053139 Bacteria 880601
355 Ga0500573_0019984 3300053140 Bacteria 3836
356 Ga0500661_003390 3300055283 Bacteria 2989
357 2552746400 2551306352 Bacteria 3873115
358 2555261990 2554235234 Bacteria 5762085
359 2599412866 2599185169 Bacteria 5441380
360 2599745261 2599185240 Bacteria 7968121
361 2600206558 2599185355 Bacteria 7968906
362 2601525663 2600255254 Bacteria 5281859
363 2601530728 2600255255 Bacteria 5282785
364 2601617783 2600255280 Bacteria 5292309
365 2601622818 2600255281 Bacteria 5288753
366 2601644637 2600255287 Bacteria 5210468
367 2601651091 2600255288 Bacteria 5282738
368 2601656140 2600255289 Bacteria 5281907
369 2601661064 2600255290 Bacteria 5282218
370 2601664802 2600255291 Bacteria 5217298
371 2601697330 2600255298 Bacteria 5215185
372 2601702718 2600255299 Bacteria 5218662
373 2601708906 2600255300 Bacteria 5287774
374 2601713944 2600255301 Bacteria 5280532
375 2601718989 2600255302 Bacteria 5288235
376 2601722623 2600255303 Bacteria 5219315
377 2601728890 2600255304 Bacteria 5283973
378 2601733935 2600255305 Bacteria 5282329
379 2601738911 2600255306 Bacteria 5281613
380 2601743281 2600255307 Bacteria 5439064
381 2601754407 2600255309 Bacteria 5431045
382 2602021348 2600255392 Bacteria 5437392
383 2603662881 2602042052 Bacteria 5215873
384 2603667778 2602042053 Bacteria 5214361
385 2603841460 2602042103 Bacteria 5284714
386 2603846411 2602042104 Bacteria 5281639
387 2603851486 2602042105 Bacteria 5282303
388 2603856673 2602042106 Bacteria 5282744
389 2603874133 2602042110 Bacteria 5283285
390 2603878587 2602042111 Bacteria 5212080
391 2606051432 2603880178 Bacteria 5283018
392 2606072291 2603880184 Bacteria 5217896
393 2606149118 2603880202 Bacteria 5284684
394 2606179204 2603880211 Bacteria 5284226
395 2640733356 2639762793 Bacteria 3943681
396 2644362640 2643221665 Bacteria 4699229
397 2676409872 2675903046 Bacteria 5451247
398 2676747259 2675903129 Bacteria 7964495
399 2678230388 2675903507 Bacteria 3737791
400 2745161373 2744054655 Bacteria 3552603
401 2774389056 2773857761 Bacteria 3837365
402 2774439255 2773857770 Bacteria 3911866
403 2854601950 2854601825 Bacteria 4797592
404 2855195783 2855195626 Bacteria 4927512
405 2871286888 2871282230 Bacteria 4917173
406 2883093472 2883087390 Bacteria 9532701
407 2916701741 2916699645 Bacteria 3568996
408 2919185316 2919182534 Bacteria 3907101
409 2923637958 2923634449 Bacteria 4753480
410 2928162553 2928157003 Bacteria 7522202
411 2928166897 2928163908 Bacteria 7561269
412 2928515522 2928515477 Bacteria 4448421
413 2945936496 2945934425 Bacteria 7444609
414 2971825684 2971820967 Bacteria 5823634
415 2981995242 2981990288 Bacteria 7590678
416 2984572480 2984568884 Bacteria 3884413
417 2990709594 2990703756 Bacteria 7715990
418 642425276 641736151 Bacteria 7477263
419 8018223455 8018221730 Bacteria 4616064
420 8020960226 8020953355 Bacteria 7439080
421 8033233763 8033232454 Bacteria 3202805
422 Ga0055533_1000859
423 SwRhRL2b_contig_1553576
424 JGI24740J21852_10016034
425 JGI24739J22299_10000234
426 JGI24737J22298_10034322
427 JGI25156J39149_1005647
428 JGI25156J39149_1009922
429 JGI25157J39369_1001502
430 JGI25157J39369_1005316
431 JGI25152J39213_1000367
432 rootH2_10032116
433 Ga0055531_10010986
434 Ga0058692_1000014
435 Ga0058692_1005731
436 Ga0058692_1005732
437 Ga0058692_1009016
438 Ga0065703_1000120
439 Ga0065704_10003841
440 Ga0065704_10004799
441 Ga0065704_10006863
442 Ga0065704_10082709
443 Ga0065704_10092535
444 Ga0065704_10102278
445 Ga0070658_10063904
446 Ga0070683_100219227
447 Ga0068869_100098429
448 Ga0070666_10066533
449 Ga0070660_100000089
450 Ga0070669_100008173
451 Ga0070659_100000060
452 Ga0070667_100019631
453 Ga0070667_100111339
454 Ga0070663_100054988
455 Ga0070663_100134745
456 Ga0068867_100088127
457 Ga0068867_100140778
458 Ga0070696_100026507
459 Ga0070665_100000126
460 Ga0070665_100007189
461 Ga0070665_100024807
462 Ga0070665_100069632
463 Ga0070665_100099548
464 Ga0068855_100053417
465 Ga0070664_100123710
466 Ga0068857_100000386
467 Ga0068857_100000624
468 Ga0068856_100001432
469 Ga0068859_100000180
470 Ga0068851_10009423
471 Ga0068851_10016883
472 Ga0068870_10017520
473 Ga0068863_100254333
474 Ga0068858_100040054
475 Ga0068860_100020703
476 Ga0068862_100001242
477 Ga0075364_10023611
478 Ga0097620_100000180
479 Ga0079104_1000403
480 Ga0079104_1001267
481 Ga0079104_1001515
482 Ga0079104_1001820
483 Ga0079104_1002919
484 Ga0079104_1003023
485 Ga0079104_1010633
486 Ga0105251_10014126
487 Ga0105251_10017931
488 Ga0105251_10018857
489 Ga0105251_10019495
490 Ga0105251_10076878
491 Ga0105244_10002529
492 Ga0105244_10003241
493 Ga0105244_10007248
494 Ga0105244_10024469
495 Ga0105244_10095430
496 Ga0105250_10000045
497 Ga0105250_10002858
498 Ga0105250_10003849
499 Ga0105250_10021907
500 Ga0105250_10063487
501 Ga0105240_10009176
502 Ga0105240_10042823
503 Ga0105240_10053417
504 Ga0105240_10140588
505 Ga0105247_10000502
506 Ga0105243_10000163
507 Ga0105243_10003177
508 Ga0105237_10002077
509 Ga0105237_10002794
510 Ga0105237_10084826
511 Ga0105249_10070119
512 Ga0105032_101050
513 Ga0105239_10045695
514 Ga0157373_10053620
515 Ga0157373_10071331
516 Ga0157371_10017745
517 Ga0157371_10029749
518 Ga0157371_10053145
519 Ga0157371_10117427
520 Ga0157370_10004198
521 Ga0157370_10035747
522 Ga0157370_10141156
523 Ga0157369_10000183
524 Ga0157369_10081116
525 Ga0157372_10001095
526 Ga0157372_10024069
527 Ga0157372_10204062
528 Ga0157376_10040244
529 Ga0182006_1000025
530 Ga0182006_1033648
531 Ga0183366_1003
532 Ga0183370_1003
533 Ga0183369_1005
534 Ga0183368_1004
535 Ga0183368_1006
536 Ga0163161_10040865
537 Ga0163161_10041470
538 Ga0213876_10000026
539 Ga0213876_10002743
540 Ga0213871_10009323
541 Ga0209674_100062
542 Ga0209258_100426
543 Ga0209646_1003696
544 Ga0209026_1000496
545 Ga0209026_1001270
546 Ga0209026_1007916
547 Ga0209759_1002665
548 Ga0209759_1007349
549 Ga0209129_1000008
550 Ga0209129_1003695
551 Ga0209455_1000225
552 Ga0209455_1000233
553 Ga0209758_1001246
554 Ga0209257_1000585
555 Ga0207696_1000140
556 Ga0207696_1004838
557 Ga0207696_1023140
558 Ga0207655_1000017
559 Ga0207655_1000026
560 Ga0207655_1000822
561 Ga0207655_1002118
562 Ga0207655_1003852
563 Ga0207655_1005359
564 Ga0207655_1005778
565 Ga0207655_1019483
566 Ga0207713_1000110
567 Ga0207713_1000419
568 Ga0207713_1002154
569 Ga0207713_1002981
570 Ga0207713_1010265
571 Ga0207713_1010976
572 Ga0207713_1013824
573 Ga0207713_1018276
574 Ga0207710_10000009
575 Ga0207680_10082962
576 Ga0207647_10007791
577 Ga0207647_10039306
578 Ga0207695_10000349
579 Ga0207695_10001818
580 Ga0207695_10022688
581 Ga0207695_10057826
582 Ga0207671_10000059
583 Ga0207671_10001066
584 Ga0207657_10000089
585 Ga0207681_10001205
586 Ga0207690_10000073
587 Ga0207709_10000001
588 Ga0207709_10005426
589 Ga0207691_10029279
590 Ga0207689_10072449
591 Ga0207667_10000383
592 Ga0207667_10019207
593 Ga0207667_10394748
594 Ga0207658_10009192
595 Ga0207703_10090859
596 Ga0207678_10001217
597 Ga0207678_10010473
598 Ga0207678_10077853
599 Ga0207702_10000874
600 Ga0207674_10000009
601 Ga0207674_10000189
602 Ga0207683_10054669
603 Ga0209281_1000058
604 Ga0209281_1000120
605 Ga0209281_1000223
606 Ga0209281_1000648
607 Ga0209281_1000822
608 Ga0209281_1001003
609 Ga0209281_1001185
610 Ga0209281_1005142
611 Ga0209371_1000014
612 Ga0209371_1000030
613 Ga0209371_1000040
614 Ga0209371_1000544
615 Ga0209371_1000563
616 Ga0209371_1001916
617 Ga0209371_1010507
618 Ga0209371_1018399
619 Ga0268266_10000001
620 Ga0268266_10000290
621 Ga0268266_10019713
622 Ga0268266_10049088
623 Ga0268266_10124043
624 Ga0268266_10203239
625 Ga0268265_10011767
626 Ga0268264_10007080
627 Ga0268256_1000021
628 Ga0268256_1000025
629 Ga0268256_1000041
630 Ga0268256_1000462
631 Ga0268256_1000488
632 Ga0268256_1006025
633 Ga0268256_1007839
634 Ga0268256_1008100
635 Ga0395900_0051509
636 Ga0436364_0234395
637 Ga0436364_1485394
638 Ga0237816_00315
639 Ga0436365_0084998
640 Ga0436365_1160573
641 Ga0436365_1936450
642 Ga0436360_1189232
643 Ga0436361_1091969
644 Ga0436363_0949788
645 Ga0436363_1372512
646 Ga0439438_001320
647 Ga0439466_0009751
648 Ga0439465_0001219
649 Ga0451833_1103254
650 Ga0451835_0337175
651 Ga0451839_1600379
652 Ga0451841_0807511
653 Ga0451843_0248513
654 Ga0451853_1441961
655 Ga0439445_0016500
656 Ga0439452_000005
657 Ga0439452_000007
658 Ga0439452_000056
659 Ga0439452_001034
660 Ga0450902_002386
661 Ga0439464_0008714
662 Ga0439464_0012291
663 Ga0466981_0000014
664 Ga0466961_0000388
665 Ga0466960_0030478
666 Ga0466958_0090722
667 Ga0495591_000231
668 Ga0495591_005800
669 Ga0495638_0000007
670 Ga0495650_0000028
671 Ga0495650_0000113
672 Ga0495607_0007957
673 Ga0495607_0067834
674 Ga0495606_0000374
675 Ga0495616_0018756
676 Ga0495648_0012054
677 Ga0495663_0005325
678 Ga0495654_0000390
679 Ga0495588_0004172
680 Ga0495649_0003172
681 Ga0495649_0033356
682 Ga0495589_0030745
683 Ga0495660_0000034
684 Ga0495604_0036858
685 Ga0495674_0001315
686 Ga0495672_0000029
687 Ga0495683_0087958
688 Ga0495683_0088047
689 Ga0495675_0038276
690 Ga0495673_0000820
691 Ga0495681_0038056
692 Ga0495686_0000390
693 Ga0495602_0092311
694 Ga0496100_0054924
695 Ga0496101_0063027
696 Ga0496104_0004669
697 Ga0496104_0073143
698 Ga0496104_0157940
699 Ga0496104_0202780
700 Ga0496105_0145221
701 Ga0496113_0070137
702 Ga0496115_0039456
703 Ga0496116_0022832
704 Ga0496116_0055404
705 Ga0496116_0088113
706 Ga0496116_0094368
707 Ga0496116_0111493
708 Ga0496117_0006936
709 Ga0496117_0016937
710 Ga0496117_0018838
711 Ga0496117_0028923
712 Ga0496117_0029466
713 Ga0496117_0057386
714 Ga0496118_0002877
715 Ga0496118_0013280
716 Ga0496118_0031304
717 Ga0496118_0047662
718 Ga0496118_0062221
719 Ga0496118_0065128
720 Ga0496119_0000026
721 Ga0496119_0005618
722 Ga0496119_0021763
723 Ga0496119_0038335
724 Ga0496119_0044918
725 Ga0496120_0007521
726 Ga0496120_0009560
727 Ga0496120_0027459
728 Ga0496120_0031588
729 Ga0496120_0033692
730 Ga0496121_0004701
731 Ga0496121_0006797
732 Ga0496121_0007313
733 Ga0496121_0018220
734 Ga0496121_0047057
735 Ga0496121_0054639
736 Ga0496121_0070229
737 Ga0496121_0080791
738 Ga0496121_0187862
739 Ga0496122_0000075
740 Ga0496122_0001095
741 Ga0496122_0002193
742 Ga0496122_0017775
743 Ga0496122_0037012
744 Ga0496122_0038666
745 Ga0496122_0050071
746 Ga0496123_0000019
747 Ga0496123_0000377
748 Ga0496123_0000774
749 Ga0496123_0002587
750 Ga0496123_0003347
751 Ga0496123_0064931
752 Ga0496124_0000142
753 Ga0496124_0006756
754 Ga0496124_0019620
755 Ga0496124_0045443
756 Ga0496124_0064289
757 Ga0496124_0131898
758 Ga0496125_0000795
759 Ga0496125_0018128
760 Ga0496125_0055603
761 Ga0496126_0032375
762 Ga0496126_0037899
763 Ga0496126_0039864
764 Ga0496126_0043465
765 Ga0496126_0093829
766 Ga0496126_0109399
767 Ga0495678_000984
768 Ga0495682_0000003
769 Ga0495682_0021220
770 Ga0501225_0001509
771 Ga0501035_0026672
772 Ga0501044_0030562
773 nmdc:mga0k408_2713_c1
774 Ga0500621_000006
775 Ga0500568_0000002
776 Ga0500573_0019984
777 Ga0500661_003390
778 2552746400
779 2555261990
780 2599412866
781 2599745261
782 2600206558
783 2601525663
784 2601530728
785 2601617783
786 2601622818
787 2601644637
788 2601651091
789 2601656140
790 2601661064
791 2601664802
792 2601697330
793 2601702718
794 2601708906
795 2601713944
796 2601718989
797 2601722623
798 2601728890
799 2601733935
800 2601738911
801 2601743281
802 2601754407
803 2602021348
804 2603662881
805 2603667778
806 2603841460
807 2603846411
808 2603851486
809 2603856673
810 2603874133
811 2603878587
812 2606051432
813 2606072291
814 2606149118
815 2606179204
816 2640733356
817 2644362640
818 2676409872
819 2676747259
820 2678230388
821 2745161373
822 2774389056
823 2774439255
824 2854601950
825 2855195783
826 2871286888
827 2883093472
828 2916701741
829 2919185316
830 2923637958
831 2928162553
832 2928166897
833 2928515522
834 2945936496
835 2971825684
836 2981995242
837 2984572480
838 2990709594
839 642425276
840 8018223455
841 8020960226
842 8033233763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

51

275

0.92

PF07690

MFS_1

Major Facilitator Superfamily

52

421

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.7265 11 375
7spt-assembly1.cif.gz_A crystal structure of exofacial state human glucose transporter glut3 0.6818 5 373
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.6815 8 373
8sc4-assembly1.cif.gz_A human oct1 bound to metformin in inward-open conformation 0.6779 54 373
6n3i-assembly1.cif.gz_A crystal structure of a double trp xyle mutants (g58w/l315w) 0.6764 12 375
ID Description Score Start End Superfamily
af_Q2G0K4_242_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9 223 375 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8803 14 200 1.20.1250.20
af_P0C0L7_256_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8769 223 373 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8649 15 206 1.20.1250.20
af_P41036_268_460_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8285 202 372 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3B9W0D9-F1-model_v4 MFS transporter 0.9371 5 134 GO:0005886
GO:0022857
AF-A0A258A147-F1-model_v4 deleted 0.8867 96 377
AF-A0A3B9Y8J4-F1-model_v4 MFS transporter 0.8857 2 147 GO:0005886
GO:0022857
AF-A9WU20-F1-model_v4 Transporter, MFS superfamily 0.8857 13 138 GO:0005886
GO:0022857
AF-A0A522F1F9-F1-model_v4 MFS transporter 0.8831 11 198 GO:0005886
GO:0015293

Map