F439896

General Info

Members Datasets Scaffolds Average Seq Length
421 266 842 295

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10007942|Ga0055531_100079424
Length 306
Sequence MSDGTSVAKAAKIPGDPKVIDGKAFAEGLRNKIAQQVASLKAKHGFVPGLAVVLVGEDPASKVYVRNKGEQTKASGMASFEHKLDASTSQADLLKLIDQLNKDPKVNGILCQLPVPKQIDPQAIIDAIDPDKDVDGFHVVNAGRLATGGKGLIPCTPYGCLLLLKDRLGDLAGKHAVVIGRSNIVGKPMAQLLLNESCTVTIAHSKTKDLPGEVRRADIVVAAVGRPEMVKGDWLKDGAVVIDVGINRVEKDGKFKLVGDVDYASCYPKASAITPVPGGVGPMTIALLLQNTLIAACRQRNVGLPD

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
247 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
256 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
257 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
264 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
265 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
266 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.48
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.55
Nodule 0
Rhizoplane 2.14
Rhizosphere 82.66
Stem 0
Stem Tuber 0.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10007942 3300003794 Bacteria 5688
2 JGI24739J22299_10013829 3300001989 Bacteria 2941
3 JGI24739J22299_10014686 3300001989 Bacteria 2847
4 JGI24737J22298_10001243 3300001990 Bacteria 9004
5 JGI24744J21845_10007524 3300002077 Bacteria 2250
6 JGI25165J46597_1000040 3300003214 Bacteria 277491
7 JGI25153J46596_10000059 3300003215 Bacteria 131871
8 JGI25153J46596_10041782 3300003215 Bacteria 1406
9 JGI25153J46596_10061478 3300003215 Bacteria 1017
10 Ga0055542_1001654 3300003762 Bacteria 9990
11 Ga0055529_1004304 3300003763 Bacteria 2180
12 Ga0070658_10000013 3300005327 Bacteria 267776
13 Ga0070658_10093494 3300005327 Bacteria 2480
14 Ga0070658_10169319 3300005327 Bacteria 1835
15 Ga0070658_10266247 3300005327 Bacteria 1456
16 Ga0070676_10005501 3300005328 Bacteria 6745
17 Ga0070670_100001895 3300005331 Bacteria 17089
18 Ga0068869_100000031 3300005334 Bacteria 60884
19 Ga0070682_100358181 3300005337 Bacteria 1090
20 Ga0068868_100000006 3300005338 Bacteria 123358
21 Ga0068868_100000060 3300005338 Bacteria 61952
22 Ga0070660_100000751 3300005339 Bacteria 21524
23 Ga0070660_100007343 3300005339 Bacteria 7678
24 Ga0070660_100015007 3300005339 Bacteria 5587
25 Ga0070660_100085947 3300005339 Bacteria 2474
26 Ga0070661_100021041 3300005344 Bacteria 4657
27 Ga0070692_10033345 3300005345 Bacteria 2594
28 Ga0070692_10086122 3300005345 Bacteria 1700
29 Ga0070668_100000001 3300005347 Bacteria 275905
30 Ga0070668_100000009 3300005347 Bacteria 136884
31 Ga0070668_100198856 3300005347 Bacteria 1645
32 Ga0070669_100078434 3300005353 Bacteria 2455
33 Ga0070675_100014931 3300005354 Bacteria 6133
34 Ga0070671_100000098 3300005355 Bacteria 55077
35 Ga0070671_100004832 3300005355 Bacteria 10716
36 Ga0070673_100000009 3300005364 Bacteria 155005
37 Ga0070659_100000005 3300005366 Bacteria 259902
38 Ga0070659_100014297 3300005366 Bacteria 5928
39 Ga0070659_100077761 3300005366 Bacteria 2647
40 Ga0070659_100556931 3300005366 Bacteria 982
41 Ga0070667_100000006 3300005367 Bacteria 336732
42 Ga0070705_100158038 3300005440 Bacteria 1512
43 Ga0070663_100004783 3300005455 Bacteria 7986
44 Ga0070663_100098167 3300005455 Bacteria 2182
45 Ga0070678_100033684 3300005456 Bacteria 3560
46 Ga0070662_100015380 3300005457 Bacteria 5123
47 Ga0070662_100195865 3300005457 Bacteria 1600
48 Ga0070681_10168285 3300005458 Bacteria 2114
49 Ga0068867_100000002 3300005459 Bacteria 247206
50 Ga0068867_100384552 3300005459 Bacteria 1180
51 Ga0070699_100222775 3300005518 Bacteria 1681
52 Ga0070679_100006705 3300005530 Bacteria 10738
53 Ga0070679_100095547 3300005530 Bacteria 2960
54 Ga0070684_100382728 3300005535 Bacteria 1296
55 Ga0068853_100000759 3300005539 Bacteria 22392
56 Ga0068853_100014991 3300005539 Bacteria 6368
57 Ga0070672_100086454 3300005543 Bacteria 2521
58 Ga0070686_100000180 3300005544 Bacteria 44847
59 Ga0070695_100014241 3300005545 Bacteria 4793
60 Ga0070696_100081918 3300005546 Bacteria 2287
61 Ga0070696_100299505 3300005546 Bacteria 1231
62 Ga0070693_100226290 3300005547 Bacteria 1228
63 Ga0070665_100000145 3300005548 Bacteria 131599
64 Ga0070665_100005652 3300005548 Bacteria 12856
65 Ga0070704_100050557 3300005549 Bacteria 2922
66 Ga0070664_100087766 3300005564 Bacteria 2689
67 Ga0070664_100442501 3300005564 Bacteria 1192
68 Ga0068857_100005407 3300005577 Bacteria 10890
69 Ga0068854_100003204 3300005578 Bacteria 10212
70 Ga0068856_100005689 3300005614 Bacteria 12276
71 Ga0068856_100080284 3300005614 Bacteria 3235
72 Ga0068852_100001541 3300005616 Bacteria 15633
73 Ga0068852_100238226 3300005616 Bacteria 1737
74 Ga0068859_100025222 3300005617 Bacteria 5966
75 Ga0068859_100142444 3300005617 Bacteria 2471
76 Ga0068864_100018221 3300005618 Bacteria 5861
77 Ga0068866_10093336 3300005718 Bacteria 1644
78 Ga0068866_10098357 3300005718 Bacteria 1609
79 Ga0068861_100043259 3300005719 Bacteria 3380
80 Ga0068861_100286438 3300005719 Bacteria 1421
81 Ga0068863_100000040 3300005841 Bacteria 158465
82 Ga0068863_100000659 3300005841 Bacteria 34872
83 Ga0068863_100001489 3300005841 Bacteria 23203
84 Ga0068863_100076539 3300005841 Bacteria 3165
85 Ga0068863_100789350 3300005841 Bacteria 947
86 Ga0068858_100000365 3300005842 Bacteria 47618
87 Ga0068860_100000120 3300005843 Bacteria 125823
88 Ga0068860_100000181 3300005843 Bacteria 101627
89 Ga0068862_100000695 3300005844 Bacteria 34344
90 Ga0068862_100026335 3300005844 Bacteria 4887
91 Ga0081538_10006928 3300005981 Bacteria 9859
92 Ga0081539_10035962 3300005985 Bacteria 2969
93 Ga0075432_10007555 3300006058 Bacteria 3703
94 Ga0075428_100857619 3300006844 Bacteria 964
95 Ga0075433_10178417 3300006852 Bacteria 1890
96 Ga0068865_100000014 3300006881 Bacteria 138727
97 Ga0097620_100025222 3300006931 Bacteria 5966
98 Ga0097620_100142442 3300006931 Bacteria 2471
99 Ga0111539_10000041 3300009094 Bacteria 131679
100 Ga0105245_10000160 3300009098 Bacteria 63445
101 Ga0105245_10068124 3300009098 Bacteria 3224
102 Ga0105245_10381818 3300009098 Bacteria 1403
103 Ga0105245_10437797 3300009098 Bacteria 1313
104 Ga0114129_10135574 3300009147 Bacteria 3378
105 Ga0105243_10000070 3300009148 Bacteria 120851
106 Ga0105241_10157160 3300009174 Bacteria 1866
107 Ga0105242_10001604 3300009176 Bacteria 17808
108 Ga0105248_10032701 3300009177 Bacteria 5810
109 Ga0105237_10320275 3300009545 Bacteria 1554
110 Ga0105249_10001735 3300009553 Bacteria 19048
111 Ga0105249_10379338 3300009553 Bacteria 1439
112 Ga0105239_10110863 3300010375 Bacteria 3041
113 Ga0105246_10003501 3300011119 Bacteria 9510
114 Ga0105246_10497877 3300011119 Bacteria 1034
115 Ga0157373_10015618 3300013100 Bacteria 5547
116 Ga0157373_10039126 3300013100 Bacteria 3396
117 Ga0157371_10000526 3300013102 Bacteria 45746
118 Ga0157371_10074704 3300013102 Bacteria 2400
119 Ga0157370_10060509 3300013104 Bacteria 3595
120 Ga0157369_10014466 3300013105 Bacteria 8907
121 Ga0157369_10032653 3300013105 Bacteria 5722
122 Ga0157374_10000542 3300013296 Bacteria 33699
123 Ga0157378_10000624 3300013297 Bacteria 33307
124 Ga0157372_10006512 3300013307 Bacteria 12431
125 Ga0157375_10023398 3300013308 Bacteria 5701
126 Ga0163163_10103086 3300014325 Bacteria 2877
127 Ga0157380_10030805 3300014326 Bacteria 4112
128 Ga0157377_10037303 3300014745 Bacteria 2677
129 Ga0157379_10175461 3300014968 Bacteria 1935
130 Ga0157376_10000096 3300014969 Bacteria 65482
131 Ga0163161_10107867 3300017792 Bacteria 2079
132 Ga0206354_10964747 3300020081 Bacteria 5049
133 Ga0206353_10498485 3300020082 Bacteria 7917
134 Ga0213876_10000404 3300021384 Bacteria 36232
135 Ga0213876_10000509 3300021384 Bacteria 30219
136 Ga0213876_10010288 3300021384 Bacteria 5025
137 Ga0207427_109067 3300025231 Bacteria 1083
138 Ga0209026_1003463 3300025250 Bacteria 5157
139 Ga0209148_1000147 3300025254 Bacteria 160231
140 Ga0209148_1000377 3300025254 Bacteria 54144
141 Ga0209233_1000003 3300025261 Bacteria 1607366
142 Ga0209455_1000299 3300025272 Bacteria 51077
143 Ga0209758_1000095 3300025297 Bacteria 237870
144 Ga0209050_1002379 3300025298 Bacteria 16342
145 Ga0209257_1000477 3300025304 Bacteria 72873
146 Ga0209257_1023894 3300025304 Bacteria 2132
147 Ga0207642_10063501 3300025899 Bacteria 1728
148 Ga0207647_10000242 3300025904 Bacteria 44571
149 Ga0207647_10000389 3300025904 Bacteria 35906
150 Ga0207647_10041178 3300025904 Bacteria 2906
151 Ga0207645_10008376 3300025907 Bacteria 7213
152 Ga0207705_10000002 3300025909 Bacteria 2046852
153 Ga0207705_10000042 3300025909 Bacteria 182120
154 Ga0207705_10018377 3300025909 Bacteria 4999
155 Ga0207705_10190259 3300025909 Bacteria 1551
156 Ga0207654_10002539 3300025911 Bacteria 9259
157 Ga0207695_10375652 3300025913 Bacteria 1307
158 Ga0207671_10000590 3300025914 Bacteria 48498
159 Ga0207671_10000779 3300025914 Bacteria 40358
160 Ga0207671_10127869 3300025914 Bacteria 1948
161 Ga0207662_10177187 3300025918 Bacteria 1370
162 Ga0207657_10000695 3300025919 Bacteria 35770
163 Ga0207657_10000900 3300025919 Bacteria 31430
164 Ga0207657_10024908 3300025919 Bacteria 5530
165 Ga0207657_10050336 3300025919 Bacteria 3626
166 Ga0207649_10091328 3300025920 Bacteria 1994
167 Ga0207649_10234621 3300025920 Bacteria 1314
168 Ga0207652_10000489 3300025921 Bacteria 40293
169 Ga0207652_10347275 3300025921 Bacteria 1339
170 Ga0207652_10368701 3300025921 Bacteria 1296
171 Ga0207681_10011059 3300025923 Bacteria 5542
172 Ga0207681_10041126 3300025923 Bacteria 3080
173 Ga0207681_10212180 3300025923 Bacteria 1493
174 Ga0207694_10012154 3300025924 Bacteria 6492
175 Ga0207650_10001173 3300025925 Bacteria 19275
176 Ga0207659_10011390 3300025926 Bacteria 5616
177 Ga0207687_10000252 3300025927 Bacteria 36302
178 Ga0207687_10015230 3300025927 Bacteria 5037
179 Ga0207687_10099031 3300025927 Bacteria 2141
180 Ga0207644_10000035 3300025931 Bacteria 131979
181 Ga0207644_10000132 3300025931 Bacteria 54023
182 Ga0207644_10083461 3300025931 Bacteria 2366
183 Ga0207690_10000002 3300025932 Bacteria 807473
184 Ga0207690_10000033 3300025932 Bacteria 149705
185 Ga0207690_10003756 3300025932 Bacteria 9003
186 Ga0207706_10009581 3300025933 Bacteria 8891
187 Ga0207706_10022061 3300025933 Bacteria 5715
188 Ga0207706_10450005 3300025933 Bacteria 1114
189 Ga0207686_10002334 3300025934 Bacteria 10371
190 Ga0207709_10000066 3300025935 Bacteria 189194
191 Ga0207704_10000002 3300025938 Bacteria 303025
192 Ga0207704_10000007 3300025938 Bacteria 211230
193 Ga0207704_10291318 3300025938 Bacteria 1246
194 Ga0207691_10098897 3300025940 Bacteria 2606
195 Ga0207691_10169362 3300025940 Bacteria 1913
196 Ga0207691_10251896 3300025940 Bacteria 1524
197 Ga0207711_10019188 3300025941 Bacteria 5693
198 Ga0207689_10000060 3300025942 Bacteria 85326
199 Ga0207689_10558802 3300025942 Bacteria 961
200 Ga0207679_10016805 3300025945 Bacteria 4864
201 Ga0207667_10011605 3300025949 Bacteria 10229
202 Ga0207651_10000004 3300025960 Bacteria 290191
203 Ga0207651_10154864 3300025960 Bacteria 1789
204 Ga0207712_10046324 3300025961 Bacteria 3014
205 Ga0207668_10000043 3300025972 Bacteria 103738
206 Ga0207668_10000147 3300025972 Bacteria 48279
207 Ga0207668_10465080 3300025972 Bacteria 1082
208 Ga0207640_10000695 3300025981 Bacteria 19606
209 Ga0207640_10137244 3300025981 Bacteria 1777
210 Ga0207658_10000010 3300025986 Bacteria 240224
211 Ga0207658_10000109 3300025986 Bacteria 89979
212 Ga0207677_10000043 3300026023 Bacteria 110161
213 Ga0207677_10000231 3300026023 Bacteria 43615
214 Ga0207703_10000540 3300026035 Bacteria 38909
215 Ga0207639_10003510 3300026041 Bacteria 10544
216 Ga0207639_10004222 3300026041 Bacteria 9682
217 Ga0207678_10022638 3300026067 Bacteria 5503
218 Ga0207678_10033366 3300026067 Bacteria 4485
219 Ga0207678_10056432 3300026067 Bacteria 3380
220 Ga0207678_10097061 3300026067 Bacteria 2519
221 Ga0207708_10232144 3300026075 Bacteria 1481
222 Ga0207702_10000443 3300026078 Bacteria 47033
223 Ga0207702_10005841 3300026078 Bacteria 10703
224 Ga0207641_10000039 3300026088 Bacteria 199453
225 Ga0207641_10000325 3300026088 Bacteria 58368
226 Ga0207641_10000755 3300026088 Bacteria 34850
227 Ga0207641_10006328 3300026088 Bacteria 10006
228 Ga0207648_10000003 3300026089 Bacteria 289983
229 Ga0207676_10002827 3300026095 Bacteria 12353
230 Ga0207674_10010068 3300026116 Bacteria 10749
231 Ga0207674_10362888 3300026116 Bacteria 1400
232 Ga0207675_100010405 3300026118 Bacteria 8715
233 Ga0207675_100157106 3300026118 Bacteria 2167
234 Ga0207683_10015611 3300026121 Bacteria 6464
235 Ga0207683_10559971 3300026121 Bacteria 1057
236 Ga0207698_10001072 3300026142 Bacteria 15905
237 Ga0207698_10230707 3300026142 Bacteria 1680
238 Ga0207698_10276330 3300026142 Bacteria 1551
239 Ga0207428_10000927 3300027907 Bacteria 32785
240 Ga0207428_10014717 3300027907 Bacteria 6779
241 Ga0268266_10000173 3300028379 Bacteria 117695
242 Ga0268266_10266150 3300028379 Bacteria 1590
243 Ga0268265_10000688 3300028380 Bacteria 33204
244 Ga0268265_10013881 3300028380 Bacteria 5482
245 Ga0268264_10000144 3300028381 Bacteria 168841
246 Ga0268264_10000435 3300028381 Bacteria 57505
247 Ga0268264_10037320 3300028381 Bacteria 4006
248 Ga0265338_10271763 3300028800 Bacteria 1242
249 Ga0265325_10178626 3300031241 Bacteria 990
250 Ga0265340_10051651 3300031247 Bacteria 1990
251 Ga0265331_10000732 3300031250 Bacteria 27697
252 Ga0307513_10032286 3300031456 Bacteria 5906
253 Ga0307513_10226860 3300031456 Bacteria 1684
254 Ga0307408_100107571 3300031548 Bacteria 2136
255 Ga0307408_100245302 3300031548 Bacteria 1474
256 Ga0265313_10000838 3300031595 Bacteria 30978
257 Ga0307508_10020176 3300031616 Bacteria 6054
258 Ga0307508_10035138 3300031616 Bacteria 4517
259 Ga0307508_10057836 3300031616 Bacteria 3431
260 Ga0316579_10064467 3300031691 Bacteria 1728
261 Ga0307516_10261428 3300031730 Bacteria 1421
262 Ga0307410_10112970 3300031852 Bacteria 1968
263 Ga0307410_10337277 3300031852 Bacteria 1201
264 Ga0307406_10103064 3300031901 Bacteria 1948
265 Ga0307407_10284162 3300031903 Bacteria 1147
266 Ga0307412_10006987 3300031911 Bacteria 6406
267 Ga0307409_100156528 3300031995 Bacteria 1986
268 Ga0307416_100134406 3300032002 Bacteria 2234
269 Ga0307416_100135137 3300032002 Bacteria 2229
270 Ga0307416_100144033 3300032002 Bacteria 2172
271 Ga0307411_10184894 3300032005 Bacteria 1585
272 Ga0307411_10341325 3300032005 Bacteria 1217
273 Ga0307415_100074526 3300032126 Bacteria 2399
274 Ga0316583_10000374 3300032133 Bacteria 12895
275 Ga0373932_0006219 3300035112 Bacteria 2821
276 Ga0373955_0312370 3300035172 Bacteria 949
277 Ga0316574_0064050 3300035398 Bacteria 2313
278 Ga0316574_0126905 3300035398 Bacteria 1640
279 Ga0373931_0151993 3300035691 Bacteria 1350
280 Ga0373931_0182305 3300035691 Bacteria 1244
281 Ga0373927_0126883 3300035695 Bacteria 1666
282 Ga0316584_0034904 3300036712 Bacteria 3730
283 Ga0316584_0080635 3300036712 Bacteria 2438
284 Ga0373925_0419613 3300037068 Bacteria 1093
285 Ga0395899_0006708 3300037312 Bacteria 8921
286 Ga0395900_0222354 3300037418 Bacteria 1902
287 Ga0395905_0264043 3300037471 Bacteria 1607
288 Ga0436364_0410843 3300037853 Bacteria 2105
289 Ga0395901_0085785 3300038443 Bacteria 3292
290 Ga0395901_0239839 3300038443 Bacteria 1891
291 Ga0436365_0709130 3300039437 Bacteria 46894
292 Ga0436365_1190967 3300039437 Bacteria 4875
293 Ga0436365_1302039 3300039437 Bacteria 91581
294 Ga0439448_0000851 3300042005 Bacteria 7453
295 Ga0439448_0044711 3300042005 Bacteria 1440
296 Ga0439448_0101385 3300042005 Bacteria 978
297 Ga0439455_0000039 3300042012 Bacteria 11478
298 Ga0439455_0006710 3300042012 Bacteria 2402
299 Ga0439458_0002053 3300042157 Bacteria 5001
300 Ga0439458_0013505 3300042157 Bacteria 1837
301 Ga0451577_0143146 3300042876 Bacteria 2149
302 Ga0466973_0033687 3300044659 Bacteria 4879
303 Ga0466961_0214512 3300044693 Bacteria 1187
304 Ga0466963_0003682 3300044694 Bacteria 8824
305 Ga0466971_0001276 3300044719 Bacteria 10502
306 Ga0466970_0102246 3300044765 Bacteria 1561
307 Ga0451576_0064805 3300045051 Bacteria 3806
308 Ga0466958_0010021 3300045836 Bacteria 5294
309 Ga0495606_0114347 3300046507 Bacteria 1623
310 Ga0495663_0011425 3300046525 Bacteria 2471
311 Ga0495654_0000620 3300046530 Bacteria 28271
312 Ga0495668_0001088 3300046616 Bacteria 28328
313 Ga0495647_0137275 3300046681 Bacteria 1041
314 Ga0495672_0132656 3300047320 Bacteria 1309
315 Ga0495686_0029155 3300047472 Bacteria 3591
316 Ga0495626_0000010 3300048091 Bacteria 270265
317 Ga0496100_0008215 3300048903 Bacteria 5814
318 Ga0496102_0254444 3300048905 Bacteria 1656
319 Ga0496105_0043864 3300048908 Bacteria 3688
320 Ga0496106_0230101 3300048909 Bacteria 1480
321 Ga0496106_0339958 3300048909 Bacteria 1205
322 Ga0496110_0050801 3300048913 Bacteria 3642
323 Ga0496112_0153794 3300048915 Bacteria 2268
324 Ga0496112_0560375 3300048915 Bacteria 1076
325 Ga0496115_0325470 3300048918 Bacteria 1256
326 Ga0496116_0001731 3300048919 Bacteria 23842
327 Ga0496117_0055162 3300048920 Bacteria 2779
328 Ga0496117_0115455 3300048920 Bacteria 1662
329 Ga0496121_0000652 3300048924 Bacteria 64960
330 Ga0496121_0014053 3300048924 Bacteria 8545
331 Ga0496122_0003068 3300048925 Bacteria 22527
332 Ga0496123_0002430 3300048926 Bacteria 23169
333 Ga0496124_0027143 3300048927 Bacteria 5145
334 Ga0496124_0168886 3300048927 Bacteria 1697
335 Ga0496125_0042756 3300048928 Bacteria 3854
336 Ga0496126_0093822 3300048929 Bacteria 2635
337 Ga0496126_0674321 3300048929 Bacteria 806
338 Ga0501032_0025401 3300049569 Bacteria 4083
339 Ga0501034_0007439 3300049571 Bacteria 11656
340 Ga0501036_0152745 3300049572 Bacteria 1947
341 Ga0501037_0020927 3300049573 Bacteria 4831
342 Ga0501037_0173716 3300049573 Bacteria 1531
343 Ga0501038_0101348 3300049574 Bacteria 2397
344 Ga0501039_0249016 3300049575 Bacteria 1397
345 Ga0501042_0234798 3300049578 Bacteria 1323
346 Ga0501043_0050523 3300049579 Bacteria 3268
347 Ga0501043_0184671 3300049579 Bacteria 1624
348 Ga0501043_0252926 3300049579 Bacteria 1357
349 Ga0501046_0001388 3300049580 Bacteria 23321
350 Ga0501046_0069162 3300049580 Bacteria 2748
351 Ga0501047_0012779 3300049581 Bacteria 7955
352 Ga0501047_0047659 3300049581 Bacteria 4139
353 Ga0501048_0075690 3300049582 Bacteria 2375
354 Ga0501067_0002003 3300049583 Bacteria 11220
355 Ga0501067_0019935 3300049583 Bacteria 3710
356 Ga0501068_0006095 3300049584 Bacteria 6630
357 Ga0501069_0102976 3300049585 Bacteria 1621
358 Ga0501070_0003153 3300049586 Bacteria 14358
359 Ga0501070_0023214 3300049586 Bacteria 5197
360 Ga0501070_0124261 3300049586 Bacteria 2133
361 Ga0501073_0060272 3300049589 Bacteria 2648
362 Ga0501073_0141749 3300049589 Bacteria 1665
363 Ga0501074_0116038 3300049590 Bacteria 1915
364 Ga0501074_0148118 3300049590 Bacteria 1679
365 Ga0501075_0050504 3300049591 Bacteria 3126
366 Ga0501076_0018341 3300049592 Bacteria 5334
367 Ga0501076_0079938 3300049592 Bacteria 2624
368 Ga0501076_0247673 3300049592 Bacteria 1458
369 Ga0501257_000023 3300049686 Bacteria 44305
370 Ga0501079_0044477 3300049741 Bacteria 3427
371 Ga0501079_0079713 3300049741 Bacteria 2532
372 Ga0501080_0018115 3300049742 Bacteria 6520
373 Ga0501080_0024544 3300049742 Bacteria 5589
374 Ga0501080_0051145 3300049742 Bacteria 3844
375 Ga0501080_0074236 3300049742 Bacteria 3163
376 Ga0501083_0002505 3300049744 Bacteria 12607
377 Ga0501083_0023125 3300049744 Bacteria 4312
378 Ga0501083_0065598 3300049744 Bacteria 2418
379 Ga0501083_0136142 3300049744 Bacteria 1609
380 Ga0501280_001412 3300049776 Bacteria 4465
381 Ga0501044_0028785 3300049823 Bacteria 5860
382 Ga0501044_0029871 3300049823 Bacteria 5746
383 Ga0501044_0043811 3300049823 Bacteria 4647
384 Ga0501044_0273233 3300049823 Bacteria 1625
385 Ga0501044_0308954 3300049823 Bacteria 1508
386 nmdc:mga05p37_257697_c1 3300050507 Bacteria 2089
387 nmdc:mga08y16_647_c1 3300050511 Bacteria 32685
388 nmdc:mga0n895_109173_c1 3300050512 Bacteria 2782
389 Ga0500643_001723 3300053087 Bacteria 12139
390 Ga0500647_0071114 3300053091 Bacteria 1672
391 Ga0500641_0005041 3300053096 Bacteria 4683
392 Ga0500594_0040833 3300053118 Bacteria 1268
393 Ga0500595_000378 3300053119 Bacteria 28743
394 Ga0500608_113853 3300053122 Bacteria 1236
395 Ga0500614_058155 3300053123 Bacteria 1033
396 Ga0500618_001512 3300053125 Bacteria 10238
397 Ga0500618_017099 3300053125 Bacteria 1807
398 Ga0500642_0063041 3300053130 Bacteria 1669
399 Ga0500568_0011952 3300053139 Bacteria 4005
400 Ga0500588_0037716 3300053146 Bacteria 1436
401 Ga0500604_0012011 3300053151 Bacteria 2334
402 Ga0500616_0007424 3300053153 Bacteria 6969
403 Ga0500616_0052396 3300053153 Bacteria 2146
404 Ga0500627_0000110 3300053158 Bacteria 26911
405 Ga0500627_0014110 3300053158 Bacteria 3052
406 Ga0500611_013617 3300053727 Bacteria 1400
407 Ga0500609_000813 3300053731 Bacteria 4685
408 Ga0500599_002527 3300053736 Bacteria 2197
409 Ga0501084_0090171 3300054114 Bacteria 2574
410 Ga0501084_0151167 3300054114 Bacteria 1957
411 Ga0590071_001526 3300059421 Bacteria 6072
412 Ga0590071_002509 3300059421 Bacteria 4616
413 Ga0590075_003746 3300059424 Bacteria 3607
414 Ga0501082_0036261 3300060353 Bacteria 4248
415 Ga0501082_0082177 3300060353 Bacteria 2779
416 Ga0501082_0236606 3300060353 Bacteria 1589
417 Ga0466962_0002038 3300061719 Bacteria 9549
418 2855021944 2855020534 Bacteria 3204685
419 2883296979 2883291878 Bacteria 5894118
420 2883359762 2883354860 Bacteria 5865246
421 2931400666 2931396565 Bacteria 7251677
422 Ga0055531_10007942
423 JGI24739J22299_10013829
424 JGI24739J22299_10014686
425 JGI24737J22298_10001243
426 JGI24744J21845_10007524
427 JGI25165J46597_1000040
428 JGI25153J46596_10000059
429 JGI25153J46596_10041782
430 JGI25153J46596_10061478
431 Ga0055542_1001654
432 Ga0055529_1004304
433 Ga0070658_10000013
434 Ga0070658_10093494
435 Ga0070658_10169319
436 Ga0070658_10266247
437 Ga0070676_10005501
438 Ga0070670_100001895
439 Ga0068869_100000031
440 Ga0070682_100358181
441 Ga0068868_100000006
442 Ga0068868_100000060
443 Ga0070660_100000751
444 Ga0070660_100007343
445 Ga0070660_100015007
446 Ga0070660_100085947
447 Ga0070661_100021041
448 Ga0070692_10033345
449 Ga0070692_10086122
450 Ga0070668_100000001
451 Ga0070668_100000009
452 Ga0070668_100198856
453 Ga0070669_100078434
454 Ga0070675_100014931
455 Ga0070671_100000098
456 Ga0070671_100004832
457 Ga0070673_100000009
458 Ga0070659_100000005
459 Ga0070659_100014297
460 Ga0070659_100077761
461 Ga0070659_100556931
462 Ga0070667_100000006
463 Ga0070705_100158038
464 Ga0070663_100004783
465 Ga0070663_100098167
466 Ga0070678_100033684
467 Ga0070662_100015380
468 Ga0070662_100195865
469 Ga0070681_10168285
470 Ga0068867_100000002
471 Ga0068867_100384552
472 Ga0070699_100222775
473 Ga0070679_100006705
474 Ga0070679_100095547
475 Ga0070684_100382728
476 Ga0068853_100000759
477 Ga0068853_100014991
478 Ga0070672_100086454
479 Ga0070686_100000180
480 Ga0070695_100014241
481 Ga0070696_100081918
482 Ga0070696_100299505
483 Ga0070693_100226290
484 Ga0070665_100000145
485 Ga0070665_100005652
486 Ga0070704_100050557
487 Ga0070664_100087766
488 Ga0070664_100442501
489 Ga0068857_100005407
490 Ga0068854_100003204
491 Ga0068856_100005689
492 Ga0068856_100080284
493 Ga0068852_100001541
494 Ga0068852_100238226
495 Ga0068859_100025222
496 Ga0068859_100142444
497 Ga0068864_100018221
498 Ga0068866_10093336
499 Ga0068866_10098357
500 Ga0068861_100043259
501 Ga0068861_100286438
502 Ga0068863_100000040
503 Ga0068863_100000659
504 Ga0068863_100001489
505 Ga0068863_100076539
506 Ga0068863_100789350
507 Ga0068858_100000365
508 Ga0068860_100000120
509 Ga0068860_100000181
510 Ga0068862_100000695
511 Ga0068862_100026335
512 Ga0081538_10006928
513 Ga0081539_10035962
514 Ga0075432_10007555
515 Ga0075428_100857619
516 Ga0075433_10178417
517 Ga0068865_100000014
518 Ga0097620_100025222
519 Ga0097620_100142442
520 Ga0111539_10000041
521 Ga0105245_10000160
522 Ga0105245_10068124
523 Ga0105245_10381818
524 Ga0105245_10437797
525 Ga0114129_10135574
526 Ga0105243_10000070
527 Ga0105241_10157160
528 Ga0105242_10001604
529 Ga0105248_10032701
530 Ga0105237_10320275
531 Ga0105249_10001735
532 Ga0105249_10379338
533 Ga0105239_10110863
534 Ga0105246_10003501
535 Ga0105246_10497877
536 Ga0157373_10015618
537 Ga0157373_10039126
538 Ga0157371_10000526
539 Ga0157371_10074704
540 Ga0157370_10060509
541 Ga0157369_10014466
542 Ga0157369_10032653
543 Ga0157374_10000542
544 Ga0157378_10000624
545 Ga0157372_10006512
546 Ga0157375_10023398
547 Ga0163163_10103086
548 Ga0157380_10030805
549 Ga0157377_10037303
550 Ga0157379_10175461
551 Ga0157376_10000096
552 Ga0163161_10107867
553 Ga0206354_10964747
554 Ga0206353_10498485
555 Ga0213876_10000404
556 Ga0213876_10000509
557 Ga0213876_10010288
558 Ga0207427_109067
559 Ga0209026_1003463
560 Ga0209148_1000147
561 Ga0209148_1000377
562 Ga0209233_1000003
563 Ga0209455_1000299
564 Ga0209758_1000095
565 Ga0209050_1002379
566 Ga0209257_1000477
567 Ga0209257_1023894
568 Ga0207642_10063501
569 Ga0207647_10000242
570 Ga0207647_10000389
571 Ga0207647_10041178
572 Ga0207645_10008376
573 Ga0207705_10000002
574 Ga0207705_10000042
575 Ga0207705_10018377
576 Ga0207705_10190259
577 Ga0207654_10002539
578 Ga0207695_10375652
579 Ga0207671_10000590
580 Ga0207671_10000779
581 Ga0207671_10127869
582 Ga0207662_10177187
583 Ga0207657_10000695
584 Ga0207657_10000900
585 Ga0207657_10024908
586 Ga0207657_10050336
587 Ga0207649_10091328
588 Ga0207649_10234621
589 Ga0207652_10000489
590 Ga0207652_10347275
591 Ga0207652_10368701
592 Ga0207681_10011059
593 Ga0207681_10041126
594 Ga0207681_10212180
595 Ga0207694_10012154
596 Ga0207650_10001173
597 Ga0207659_10011390
598 Ga0207687_10000252
599 Ga0207687_10015230
600 Ga0207687_10099031
601 Ga0207644_10000035
602 Ga0207644_10000132
603 Ga0207644_10083461
604 Ga0207690_10000002
605 Ga0207690_10000033
606 Ga0207690_10003756
607 Ga0207706_10009581
608 Ga0207706_10022061
609 Ga0207706_10450005
610 Ga0207686_10002334
611 Ga0207709_10000066
612 Ga0207704_10000002
613 Ga0207704_10000007
614 Ga0207704_10291318
615 Ga0207691_10098897
616 Ga0207691_10169362
617 Ga0207691_10251896
618 Ga0207711_10019188
619 Ga0207689_10000060
620 Ga0207689_10558802
621 Ga0207679_10016805
622 Ga0207667_10011605
623 Ga0207651_10000004
624 Ga0207651_10154864
625 Ga0207712_10046324
626 Ga0207668_10000043
627 Ga0207668_10000147
628 Ga0207668_10465080
629 Ga0207640_10000695
630 Ga0207640_10137244
631 Ga0207658_10000010
632 Ga0207658_10000109
633 Ga0207677_10000043
634 Ga0207677_10000231
635 Ga0207703_10000540
636 Ga0207639_10003510
637 Ga0207639_10004222
638 Ga0207678_10022638
639 Ga0207678_10033366
640 Ga0207678_10056432
641 Ga0207678_10097061
642 Ga0207708_10232144
643 Ga0207702_10000443
644 Ga0207702_10005841
645 Ga0207641_10000039
646 Ga0207641_10000325
647 Ga0207641_10000755
648 Ga0207641_10006328
649 Ga0207648_10000003
650 Ga0207676_10002827
651 Ga0207674_10010068
652 Ga0207674_10362888
653 Ga0207675_100010405
654 Ga0207675_100157106
655 Ga0207683_10015611
656 Ga0207683_10559971
657 Ga0207698_10001072
658 Ga0207698_10230707
659 Ga0207698_10276330
660 Ga0207428_10000927
661 Ga0207428_10014717
662 Ga0268266_10000173
663 Ga0268266_10266150
664 Ga0268265_10000688
665 Ga0268265_10013881
666 Ga0268264_10000144
667 Ga0268264_10000435
668 Ga0268264_10037320
669 Ga0265338_10271763
670 Ga0265325_10178626
671 Ga0265340_10051651
672 Ga0265331_10000732
673 Ga0307513_10032286
674 Ga0307513_10226860
675 Ga0307408_100107571
676 Ga0307408_100245302
677 Ga0265313_10000838
678 Ga0307508_10020176
679 Ga0307508_10035138
680 Ga0307508_10057836
681 Ga0316579_10064467
682 Ga0307516_10261428
683 Ga0307410_10112970
684 Ga0307410_10337277
685 Ga0307406_10103064
686 Ga0307407_10284162
687 Ga0307412_10006987
688 Ga0307409_100156528
689 Ga0307416_100134406
690 Ga0307416_100135137
691 Ga0307416_100144033
692 Ga0307411_10184894
693 Ga0307411_10341325
694 Ga0307415_100074526
695 Ga0316583_10000374
696 Ga0373932_0006219
697 Ga0373955_0312370
698 Ga0316574_0064050
699 Ga0316574_0126905
700 Ga0373931_0151993
701 Ga0373931_0182305
702 Ga0373927_0126883
703 Ga0316584_0034904
704 Ga0316584_0080635
705 Ga0373925_0419613
706 Ga0395899_0006708
707 Ga0395900_0222354
708 Ga0395905_0264043
709 Ga0436364_0410843
710 Ga0395901_0085785
711 Ga0395901_0239839
712 Ga0436365_0709130
713 Ga0436365_1190967
714 Ga0436365_1302039
715 Ga0439448_0000851
716 Ga0439448_0044711
717 Ga0439448_0101385
718 Ga0439455_0000039
719 Ga0439455_0006710
720 Ga0439458_0002053
721 Ga0439458_0013505
722 Ga0451577_0143146
723 Ga0466973_0033687
724 Ga0466961_0214512
725 Ga0466963_0003682
726 Ga0466971_0001276
727 Ga0466970_0102246
728 Ga0451576_0064805
729 Ga0466958_0010021
730 Ga0495606_0114347
731 Ga0495663_0011425
732 Ga0495654_0000620
733 Ga0495668_0001088
734 Ga0495647_0137275
735 Ga0495672_0132656
736 Ga0495686_0029155
737 Ga0495626_0000010
738 Ga0496100_0008215
739 Ga0496102_0254444
740 Ga0496105_0043864
741 Ga0496106_0230101
742 Ga0496106_0339958
743 Ga0496110_0050801
744 Ga0496112_0153794
745 Ga0496112_0560375
746 Ga0496115_0325470
747 Ga0496116_0001731
748 Ga0496117_0055162
749 Ga0496117_0115455
750 Ga0496121_0000652
751 Ga0496121_0014053
752 Ga0496122_0003068
753 Ga0496123_0002430
754 Ga0496124_0027143
755 Ga0496124_0168886
756 Ga0496125_0042756
757 Ga0496126_0093822
758 Ga0496126_0674321
759 Ga0501032_0025401
760 Ga0501034_0007439
761 Ga0501036_0152745
762 Ga0501037_0020927
763 Ga0501037_0173716
764 Ga0501038_0101348
765 Ga0501039_0249016
766 Ga0501042_0234798
767 Ga0501043_0050523
768 Ga0501043_0184671
769 Ga0501043_0252926
770 Ga0501046_0001388
771 Ga0501046_0069162
772 Ga0501047_0012779
773 Ga0501047_0047659
774 Ga0501048_0075690
775 Ga0501067_0002003
776 Ga0501067_0019935
777 Ga0501068_0006095
778 Ga0501069_0102976
779 Ga0501070_0003153
780 Ga0501070_0023214
781 Ga0501070_0124261
782 Ga0501073_0060272
783 Ga0501073_0141749
784 Ga0501074_0116038
785 Ga0501074_0148118
786 Ga0501075_0050504
787 Ga0501076_0018341
788 Ga0501076_0079938
789 Ga0501076_0247673
790 Ga0501257_000023
791 Ga0501079_0044477
792 Ga0501079_0079713
793 Ga0501080_0018115
794 Ga0501080_0024544
795 Ga0501080_0051145
796 Ga0501080_0074236
797 Ga0501083_0002505
798 Ga0501083_0023125
799 Ga0501083_0065598
800 Ga0501083_0136142
801 Ga0501280_001412
802 Ga0501044_0028785
803 Ga0501044_0029871
804 Ga0501044_0043811
805 Ga0501044_0273233
806 Ga0501044_0308954
807 nmdc:mga05p37_257697_c1
808 nmdc:mga08y16_647_c1
809 nmdc:mga0n895_109173_c1
810 Ga0500643_001723
811 Ga0500647_0071114
812 Ga0500641_0005041
813 Ga0500594_0040833
814 Ga0500595_000378
815 Ga0500608_113853
816 Ga0500614_058155
817 Ga0500618_001512
818 Ga0500618_017099
819 Ga0500642_0063041
820 Ga0500568_0011952
821 Ga0500588_0037716
822 Ga0500604_0012011
823 Ga0500616_0007424
824 Ga0500616_0052396
825 Ga0500627_0000110
826 Ga0500627_0014110
827 Ga0500611_013617
828 Ga0500609_000813
829 Ga0500599_002527
830 Ga0501084_0090171
831 Ga0501084_0151167
832 Ga0590071_001526
833 Ga0590071_002509
834 Ga0590075_003746
835 Ga0501082_0036261
836 Ga0501082_0082177
837 Ga0501082_0236606
838 Ga0466962_0002038
839 2855021944
840 2883296979
841 2883359762
842 2931400666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

20

135

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

138

300

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.979 2 286
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9758 2 283
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9721 2 286
2c2y-assembly1.cif.gz_A-2 three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis 0.9667 3 285
6ecr-assembly1.cif.gz_B the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp 0.965 1 286
ID Description Score Start End Superfamily
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9965 34 115 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9903 34 114 3.40.50.10860
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9839 32 115 3.40.50.10860
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9808 32 115 3.40.50.10860
4b4uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9807 31 115 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A6N6S1Z9-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9896 3 121 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A261WDD2-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9894 1 256 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A7Z7YRP5-F1-model_v4 methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) 0.9891 19 151 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A3C0Q5D5-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.989 121 282 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A3C1LSI1-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.989 8 105 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Map