F440010

General Info

Members Datasets Scaffolds Average Seq Length
421 254 843 287

Family's Representative Sequence

Representative Sequence 3300025263|Ga0209565_1000134|Ga0209565_100013453
Length 304
Sequence MRLSLALRRGKGHLGSMDIPADAPTGLAMALDPLVTRILAPNPSPFTYTGTQTYLVGTTELAVIDPGPDDPEHLEALVAAIAGRKLLAILCTHTHRDHSPAAAPLKALTGAPVIGCAPLSLTDAGPRADAAFDTGYAPDRVLEDGEQLSGPGWTLTAVATPGHTSNHLCFALEETGGLFSGDHVMGWSTTVVAPPDGDMAAYMRSLDKLMGREQDRIYFPAHGEPIERPHRFVRGLIGHRRQREGQILRLLRAGTGTVPAMVERMYAGLDPRLNGAAGRSVLAHLIDLRDRGLVGEEGGAWKMA

Samples

Sample ID Description Type Environment
1 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
223 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
226 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
243 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
247 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
251 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
252 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
253 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
254 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.05
Nodule 0.48
Rhizoplane 3.8
Rhizosphere 71.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209565_1000134 3300025263 Bacteria 104013
2 JGI24740J21852_10003247 3300001979 Bacteria 7180
3 JGI24739J22299_10010647 3300001989 Bacteria 3411
4 JGI24737J22298_10002289 3300001990 Bacteria 6809
5 JGI24737J22298_10012312 3300001990 Bacteria 2789
6 JGI24737J22298_10033410 3300001990 Bacteria 1598
7 JGI24735J21928_10000590 3300002067 Bacteria 12771
8 JGI24735J21928_10001504 3300002067 Bacteria 8243
9 JGI24735J21928_10001790 3300002067 Bacteria 7539
10 JGI24735J21928_10004614 3300002067 Bacteria 4616
11 JGI24735J21928_10018807 3300002067 Bacteria 2128
12 JGI24735J21928_10018837 3300002067 Bacteria 2126
13 JGI24738J21930_10000184 3300002075 Bacteria 16152
14 JGI24744J21845_10008674 3300002077 Bacteria 2089
15 JGI24751J29686_10000660 3300002459 Bacteria 8652
16 JGI25150J39212_1002047 3300002774 Bacteria 5243
17 JGI25153J46596_10000395 3300003215 Bacteria 29365
18 JGI25153J46596_10002504 3300003215 Bacteria 10546
19 rootH1_10055751 3300003316 Bacteria 1033
20 rootH1_10055751 3300003323 Unclassified 3937
21 rootH1_10100018 3300003316 Bacteria 4198
22 rootH1_10122197 3300003316 Bacteria 1782
23 rootH2_10001791 3300003320 Bacteria 1918
24 rootL2_10247348 3300003322 Bacteria 1248
25 rootH1_10035136 3300003323 Bacteria 3354
26 Ga0055526_1004784 3300003771 Bacteria 8017
27 Ga0055537_1001358 3300003773 Bacteria 9868
28 Ga0055537_1002042 3300003773 Bacteria 7124
29 Ga0055524_1000056 3300003775 Bacteria 141764
30 Ga0055530_10000931 3300003791 Bacteria 23980
31 Ga0055530_10020923 3300003791 Bacteria 1940
32 Ga0055540_1002064 3300003792 Bacteria 11085
33 Ga0055531_10000013 3300003794 Bacteria 187583
34 Ga0065165_1002739 3300005262 Bacteria 14075
35 Ga0065165_1003272 3300005262 Bacteria 11685
36 Ga0065165_1009273 3300005262 Bacteria 4438
37 Ga0065165_1011299 3300005262 Bacteria 3746
38 Ga0065165_1035594 3300005262 Bacteria 1527
39 Ga0070658_10000479 3300005327 Bacteria 34657
40 Ga0070658_10102032 3300005327 Bacteria 2372
41 Ga0070676_10000230 3300005328 Bacteria 23872
42 Ga0070676_10044427 3300005328 Bacteria 2585
43 Ga0070683_100387006 3300005329 Bacteria 1333
44 Ga0070670_100130729 3300005331 Bacteria 2168
45 Ga0068869_100000200 3300005334 Bacteria 31213
46 Ga0070666_10000234 3300005335 Bacteria 37494
47 Ga0068868_100001398 3300005338 Bacteria 16647
48 Ga0070660_100004174 3300005339 Bacteria 9975
49 Ga0070660_100004583 3300005339 Bacteria 9552
50 Ga0070660_100075067 3300005339 Bacteria 2646
51 Ga0070660_100192891 3300005339 Bacteria 1651
52 Ga0070668_100000047 3300005347 Bacteria 76386
53 Ga0070668_100005498 3300005347 Bacteria 9394
54 Ga0070668_100038200 3300005347 Bacteria 3669
55 Ga0070668_100199554 3300005347 Bacteria 1642
56 Ga0070669_100000008 3300005353 Bacteria 226764
57 Ga0070669_100000437 3300005353 Bacteria 31806
58 Ga0070669_100119035 3300005353 Bacteria 2012
59 Ga0070675_100006627 3300005354 Bacteria 8902
60 Ga0070671_100000010 3300005355 Bacteria 202799
61 Ga0070671_100000169 3300005355 Bacteria 43010
62 Ga0070671_100017053 3300005355 Bacteria 5875
63 Ga0070674_100051002 3300005356 Bacteria 2849
64 Ga0070673_100000006 3300005364 Bacteria 184299
65 Ga0070667_100000030 3300005367 Bacteria 178327
66 Ga0070663_100004887 3300005455 Bacteria 7911
67 Ga0070662_100007108 3300005457 Bacteria 7246
68 Ga0068867_100000001 3300005459 Bacteria 427563
69 Ga0068853_100161610 3300005539 Bacteria 2022
70 Ga0070686_100000352 3300005544 Bacteria 29658
71 Ga0070686_100085533 3300005544 Bacteria 2098
72 Ga0068855_100010482 3300005563 Bacteria 11182
73 Ga0068855_100105901 3300005563 Bacteria 3233
74 Ga0068855_100244870 3300005563 Bacteria 2002
75 Ga0068855_100244978 3300005563 Bacteria 2001
76 Ga0068857_100233163 3300005577 Bacteria 1684
77 Ga0068856_100240799 3300005614 Bacteria 1824
78 Ga0068852_100003329 3300005616 Bacteria 11220
79 Ga0068852_100185302 3300005616 Bacteria 1960
80 Ga0068852_100419042 3300005616 Bacteria 1320
81 Ga0068859_100002317 3300005617 Bacteria 19344
82 Ga0068859_100005156 3300005617 Bacteria 13269
83 Ga0068859_100103882 3300005617 Bacteria 2900
84 Ga0068859_100260377 3300005617 Bacteria 1826
85 Ga0068864_100023017 3300005618 Bacteria 5229
86 Ga0068861_100000001 3300005719 Bacteria 116118
87 Ga0068851_10007559 3300005834 Bacteria 4994
88 Ga0068851_10142290 3300005834 Bacteria 1305
89 Ga0068863_100000001 3300005841 Bacteria 581116
90 Ga0068863_100000093 3300005841 Bacteria 96862
91 Ga0068863_100000582 3300005841 Bacteria 37202
92 Ga0068863_100065620 3300005841 Bacteria 3434
93 Ga0068858_100006839 3300005842 Bacteria 11087
94 Ga0068858_100010200 3300005842 Bacteria 8915
95 Ga0068858_100036302 3300005842 Bacteria 4570
96 Ga0068860_100002229 3300005843 Bacteria 20406
97 Ga0068860_100003988 3300005843 Bacteria 15146
98 Ga0068860_100017800 3300005843 Bacteria 6923
99 Ga0068860_100629906 3300005843 Bacteria 1079
100 Ga0068862_100001451 3300005844 Bacteria 21840
101 Ga0068862_100011082 3300005844 Bacteria 7448
102 Ga0068862_100091483 3300005844 Bacteria 2650
103 Ga0075363_100182305 3300006048 Bacteria 1195
104 Ga0075367_10000607 3300006178 Bacteria 13767
105 Ga0075370_10036426 3300006353 Bacteria 2764
106 Ga0075370_10040892 3300006353 Bacteria 2616
107 Ga0075430_100229937 3300006846 Bacteria 1538
108 Ga0075434_100198543 3300006871 Bacteria 2026
109 Ga0068865_100000003 3300006881 Bacteria 231761
110 Ga0097620_100002317 3300006931 Bacteria 19344
111 Ga0097620_100005156 3300006931 Bacteria 13269
112 Ga0097620_100103880 3300006931 Bacteria 2900
113 Ga0097620_100260385 3300006931 Bacteria 1826
114 Ga0079104_1007109 3300006946 Bacteria 4114
115 Ga0105240_10091793 3300009093 Bacteria 3709
116 Ga0105245_10000113 3300009098 Bacteria 78545
117 Ga0105247_10000673 3300009101 Bacteria 26928
118 Ga0105247_10012233 3300009101 Bacteria 5157
119 Ga0105243_10000373 3300009148 Bacteria 48115
120 Ga0105243_10060689 3300009148 Bacteria 3021
121 Ga0105242_10010122 3300009176 Bacteria 7223
122 Ga0105248_10001758 3300009177 Bacteria 24108
123 Ga0105248_10004862 3300009177 Bacteria 14873
124 Ga0105248_10014065 3300009177 Bacteria 8807
125 Ga0105237_10005899 3300009545 Bacteria 13731
126 Ga0105238_10574796 3300009551 Bacteria 1133
127 Ga0105249_10000045 3300009553 Bacteria 182927
128 Ga0105249_10037210 3300009553 Bacteria 4416
129 Ga0105249_10084345 3300009553 Bacteria 2959
130 Ga0105239_10012172 3300010375 Bacteria 9592
131 Ga0105239_10129322 3300010375 Bacteria 2808
132 Ga0105246_10001620 3300011119 Bacteria 13399
133 Ga0157373_10004770 3300013100 Bacteria 10203
134 Ga0157373_10074190 3300013100 Bacteria 2400
135 Ga0157371_10208590 3300013102 Bacteria 1402
136 Ga0157371_10361403 3300013102 Bacteria 1058
137 Ga0157370_10000069 3300013104 Bacteria 112889
138 Ga0157370_10018262 3300013104 Bacteria 7054
139 Ga0157369_10173906 3300013105 Bacteria 2268
140 Ga0157369_10345800 3300013105 Bacteria 1545
141 Ga0157374_10057699 3300013296 Bacteria 3626
142 Ga0157378_10002300 3300013297 Bacteria 16976
143 Ga0163162_10012502 3300013306 Bacteria 8294
144 Ga0163162_10054234 3300013306 Bacteria 4032
145 Ga0157372_10059842 3300013307 Bacteria 4262
146 Ga0157372_10113522 3300013307 Bacteria 3105
147 Ga0157372_10118609 3300013307 Bacteria 3036
148 Ga0157372_10141635 3300013307 Bacteria 2771
149 Ga0157380_10008488 3300014326 Bacteria 7338
150 Ga0157376_10000089 3300014969 Bacteria 69351
151 Ga0163161_10019426 3300017792 Bacteria 4767
152 Ga0207425_1000041 3300025245 Bacteria 210441
153 Ga0209148_1000238 3300025254 Bacteria 87836
154 Ga0209129_1002094 3300025258 Bacteria 10228
155 Ga0209565_1000008 3300025263 Bacteria 774179
156 Ga0209455_1000952 3300025272 Bacteria 14767
157 Ga0209673_1002352 3300025273 Bacteria 13340
158 Ga0209675_1015089 3300025291 Bacteria 2314
159 Ga0209676_1016916 3300025292 Bacteria 2606
160 Ga0209025_1000068 3300025294 Bacteria 294129
161 Ga0209564_1012455 3300025295 Bacteria 3708
162 Ga0209758_1000004 3300025297 Bacteria 1375322
163 Ga0209758_1005937 3300025297 Bacteria 9061
164 Ga0209050_1000001 3300025298 Bacteria 3563507
165 Ga0209050_1000581 3300025298 Bacteria 59224
166 Ga0209050_1005993 3300025298 Bacteria 7374
167 Ga0209050_1014296 3300025298 Bacteria 3432
168 Ga0209256_1000009 3300025299 Bacteria 922071
169 Ga0209256_1000010 3300025299 Bacteria 912110
170 Ga0209051_1000191 3300025303 Bacteria 108763
171 Ga0209257_1000876 3300025304 Bacteria 42634
172 Ga0209257_1002898 3300025304 Bacteria 15899
173 Ga0209257_1003401 3300025304 Bacteria 13704
174 Ga0209257_1003674 3300025304 Bacteria 12823
175 Ga0209257_1014986 3300025304 Bacteria 3271
176 Ga0207697_10000036 3300025315 Bacteria 49927
177 Ga0207656_10076003 3300025321 Bacteria 1501
178 Ga0207710_10024250 3300025900 Bacteria 2610
179 Ga0207680_10000097 3300025903 Bacteria 40203
180 Ga0207680_10037307 3300025903 Bacteria 2805
181 Ga0207647_10001988 3300025904 Bacteria 15633
182 Ga0207647_10002647 3300025904 Bacteria 13526
183 Ga0207647_10007503 3300025904 Bacteria 7877
184 Ga0207647_10032481 3300025904 Bacteria 3352
185 Ga0207645_10003616 3300025907 Bacteria 11690
186 Ga0207645_10082030 3300025907 Bacteria 2067
187 Ga0207705_10000121 3300025909 Bacteria 86649
188 Ga0207705_10000365 3300025909 Bacteria 41098
189 Ga0207705_10053618 3300025909 Bacteria 2905
190 Ga0207695_10077775 3300025913 Bacteria 3368
191 Ga0207657_10015487 3300025919 Bacteria 7387
192 Ga0207657_10026870 3300025919 Bacteria 5279
193 Ga0207657_10027486 3300025919 Bacteria 5210
194 Ga0207657_10180243 3300025919 Bacteria 1708
195 Ga0207681_10000002 3300025923 Bacteria 985597
196 Ga0207681_10000463 3300025923 Bacteria 28492
197 Ga0207681_10027175 3300025923 Bacteria 3698
198 Ga0207650_10104123 3300025925 Bacteria 2189
199 Ga0207687_10000225 3300025927 Bacteria 38523
200 Ga0207644_10000002 3300025931 Bacteria 942221
201 Ga0207644_10000012 3300025931 Bacteria 186652
202 Ga0207644_10069262 3300025931 Bacteria 2576
203 Ga0207644_10136303 3300025931 Bacteria 1885
204 Ga0207644_10380165 3300025931 Bacteria 1151
205 Ga0207690_10368792 3300025932 Bacteria 1139
206 Ga0207706_10008805 3300025933 Bacteria 9291
207 Ga0207706_10026490 3300025933 Bacteria 5189
208 Ga0207706_10033279 3300025933 Bacteria 4590
209 Ga0207706_10211000 3300025933 Bacteria 1702
210 Ga0207686_10005107 3300025934 Bacteria 7060
211 Ga0207709_10000173 3300025935 Bacteria 86350
212 Ga0207704_10000001 3300025938 Bacteria 716296
213 Ga0207691_10009162 3300025940 Bacteria 9499
214 Ga0207711_10000852 3300025941 Bacteria 29486
215 Ga0207711_10113796 3300025941 Bacteria 2409
216 Ga0207689_10000744 3300025942 Bacteria 31242
217 Ga0207667_10000016 3300025949 Bacteria 391466
218 Ga0207667_10167891 3300025949 Bacteria 2256
219 Ga0207667_10276112 3300025949 Bacteria 1718
220 Ga0207651_10000002 3300025960 Bacteria 427663
221 Ga0207712_10000174 3300025961 Bacteria 66500
222 Ga0207668_10000066 3300025972 Bacteria 84452
223 Ga0207668_10000304 3300025972 Bacteria 32235
224 Ga0207668_10001421 3300025972 Bacteria 14084
225 Ga0207668_10003796 3300025972 Bacteria 8901
226 Ga0207640_10021246 3300025981 Bacteria 3866
227 Ga0207658_10000019 3300025986 Bacteria 206335
228 Ga0207658_10003580 3300025986 Bacteria 10968
229 Ga0207677_10000030 3300026023 Bacteria 120692
230 Ga0207703_10001492 3300026035 Bacteria 21341
231 Ga0207703_10006199 3300026035 Bacteria 9569
232 Ga0207703_10042647 3300026035 Bacteria 3640
233 Ga0207639_10008795 3300026041 Bacteria 6939
234 Ga0207639_10023944 3300026041 Bacteria 4413
235 Ga0207639_10122498 3300026041 Bacteria 2139
236 Ga0207678_10000857 3300026067 Bacteria 27922
237 Ga0207702_10002945 3300026078 Bacteria 15895
238 Ga0207641_10000001 3300026088 Bacteria 1180841
239 Ga0207641_10000029 3300026088 Bacteria 229383
240 Ga0207641_10002512 3300026088 Bacteria 16895
241 Ga0207641_10091771 3300026088 Bacteria 2658
242 Ga0207641_10151692 3300026088 Bacteria 2099
243 Ga0207648_10000001 3300026089 Bacteria 427499
244 Ga0207648_10375614 3300026089 Bacteria 1285
245 Ga0207676_10015768 3300026095 Bacteria 5462
246 Ga0207674_10009584 3300026116 Bacteria 11048
247 Ga0207674_10024053 3300026116 Bacteria 6515
248 Ga0207674_10088087 3300026116 Bacteria 3098
249 Ga0207675_100000196 3300026118 Bacteria 55631
250 Ga0207675_100000358 3300026118 Bacteria 43765
251 Ga0207675_100121773 3300026118 Bacteria 2469
252 Ga0207698_10000130 3300026142 Bacteria 47043
253 Ga0209281_1015295 3300027111 Bacteria 1603
254 Ga0209813_10000075 3300027866 Bacteria 36981
255 Ga0268265_10000045 3300028380 Bacteria 180378
256 Ga0268265_10000339 3300028380 Bacteria 50894
257 Ga0268265_10316515 3300028380 Bacteria 1411
258 Ga0268264_10000010 3300028381 Bacteria 596543
259 Ga0268264_10004259 3300028381 Bacteria 12215
260 Ga0268264_10012577 3300028381 Bacteria 6971
261 Ga0268264_10025057 3300028381 Bacteria 4875
262 Ga0307513_10028045 3300031456 Bacteria 6449
263 Ga0307408_100090798 3300031548 Bacteria 2305
264 Ga0307408_100165945 3300031548 Bacteria 1758
265 Ga0307408_100306305 3300031548 Bacteria 1333
266 Ga0307405_10012300 3300031731 Bacteria 4522
267 Ga0307413_10174840 3300031824 Bacteria 1524
268 Ga0307410_10118754 3300031852 Bacteria 1925
269 Ga0307410_10206636 3300031852 Bacteria 1502
270 Ga0307406_10227908 3300031901 Bacteria 1389
271 Ga0307414_10091196 3300032004 Bacteria 2264
272 Ga0307414_10210331 3300032004 Bacteria 1589
273 Ga0307411_10132294 3300032005 Bacteria 1825
274 Ga0307411_10159569 3300032005 Bacteria 1687
275 Ga0395899_0001521 3300037312 Bacteria 19608
276 Ga0395900_0009291 3300037418 Bacteria 10081
277 Ga0395905_0018211 3300037471 Bacteria 6667
278 Ga0395905_0068601 3300037471 Bacteria 3321
279 Ga0395901_0073008 3300038443 Bacteria 3578
280 Ga0395901_0102947 3300038443 Bacteria 2996
281 Ga0439436_0020394 3300041404 Bacteria 1974
282 Ga0439461_0000498 3300041410 Bacteria 5666
283 Ga0439466_0018888 3300041411 Bacteria 2469
284 Ga0439465_0005658 3300041413 Bacteria 3978
285 Ga0451806_402659 3300041462 Bacteria 6155
286 Ga0451807_0382179 3300041486 Bacteria 6263
287 Ga0451853_2806299 3300041512 Bacteria 3032
288 Ga0439431_0000140 3300041997 Bacteria 13006
289 Ga0439431_0006887 3300041997 Bacteria 2525
290 Ga0439445_0004325 3300042004 Bacteria 3214
291 Ga0439448_0001939 3300042005 Bacteria 5514
292 Ga0439448_0009693 3300042005 Bacteria 2843
293 Ga0439448_0012547 3300042005 Bacteria 2537
294 Ga0439432_000640 3300042006 Bacteria 13098
295 Ga0439450_022012 3300042008 Bacteria 1373
296 Ga0439455_0014742 3300042012 Bacteria 1788
297 Ga0439455_0030935 3300042012 Bacteria 1330
298 Ga0439462_0014100 3300042015 Bacteria 2051
299 Ga0439462_0015361 3300042015 Bacteria 1973
300 Ga0439446_0018750 3300042156 Bacteria 1942
301 Ga0439458_0000137 3300042157 Bacteria 15585
302 Ga0439458_0002735 3300042157 Bacteria 4248
303 Ga0439458_0003196 3300042157 Bacteria 3881
304 Ga0439434_0001016 3300042435 Bacteria 8109
305 Ga0439434_0041366 3300042435 Bacteria 1416
306 Ga0466972_0000826 3300044658 Bacteria 14820
307 Ga0466966_0115314 3300044684 Bacteria 1654
308 Ga0466961_0036040 3300044693 Bacteria 3176
309 Ga0466961_0101880 3300044693 Bacteria 1808
310 Ga0466963_0005815 3300044694 Bacteria 7256
311 Ga0466964_0000258 3300044706 Bacteria 15333
312 Ga0466971_0005805 3300044719 Bacteria 5372
313 Ga0466970_0010990 3300044765 Bacteria 4606
314 Ga0466960_0004100 3300044901 Bacteria 5665
315 Ga0451576_0000393 3300045051 Bacteria 101814
316 Ga0451576_0259850 3300045051 Bacteria 1815
317 Ga0466958_0017628 3300045836 Bacteria 4132
318 Ga0466958_0042889 3300045836 Bacteria 2724
319 Ga0495627_000024 3300046453 Bacteria 250480
320 Ga0495627_003970 3300046453 Bacteria 6315
321 Ga0495650_0001027 3300046471 Bacteria 31380
322 Ga0495583_0000218 3300046506 Bacteria 96349
323 Ga0495606_0000710 3300046507 Bacteria 51532
324 Ga0495610_0000053 3300046512 Bacteria 142545
325 Ga0495616_0001456 3300046513 Bacteria 16481
326 Ga0495637_0003303 3300046520 Bacteria 8576
327 Ga0495637_0008486 3300046520 Bacteria 5045
328 Ga0495643_0000030 3300046522 Bacteria 260229
329 Ga0495648_0001960 3300046524 Bacteria 19584
330 Ga0495648_0006668 3300046524 Bacteria 9351
331 Ga0495654_0032421 3300046530 Bacteria 2649
332 Ga0495633_0002794 3300046558 Bacteria 12067
333 Ga0495668_0002221 3300046616 Bacteria 16492
334 Ga0495668_0048576 3300046616 Bacteria 2354
335 Ga0495611_0082245 3300046648 Bacteria 1482
336 Ga0495625_0035851 3300046660 Bacteria 3652
337 Ga0495670_0000002 3300046691 Bacteria 601814
338 Ga0495670_0010027 3300046691 Bacteria 4659
339 Ga0495671_0000072 3300046692 Bacteria 97315
340 Ga0495671_0045784 3300046692 Bacteria 2189
341 Ga0495649_0112123 3300046694 Bacteria 1446
342 Ga0495649_0237353 3300046694 Bacteria 939
343 Ga0495683_0131132 3300047323 Bacteria 1182
344 Ga0495681_0000099 3300047470 Bacteria 75808
345 Ga0495681_0000858 3300047470 Bacteria 23365
346 Ga0495686_0008783 3300047472 Bacteria 7363
347 Ga0496100_0400741 3300048903 Bacteria 1045
348 Ga0496103_0131073 3300048906 Bacteria 1601
349 Ga0496104_0018392 3300048907 Bacteria 6376
350 Ga0496105_0276148 3300048908 Bacteria 1356
351 Ga0496106_0001994 3300048909 Bacteria 15358
352 Ga0496107_0006186 3300048910 Bacteria 8223
353 Ga0496108_0060537 3300048911 Bacteria 3186
354 Ga0496109_0315756 3300048912 Bacteria 1474
355 Ga0496110_0028842 3300048913 Bacteria 4770
356 Ga0496111_0344978 3300048914 Bacteria 1102
357 Ga0496112_0356615 3300048915 Bacteria 1405
358 Ga0496113_0000998 3300048916 Bacteria 15153
359 Ga0496115_0001129 3300048918 Bacteria 19266
360 Ga0496116_0037014 3300048919 Bacteria 3408
361 Ga0496117_0033071 3300048920 Bacteria 3916
362 Ga0496117_0040966 3300048920 Bacteria 3400
363 Ga0496118_0075722 3300048921 Bacteria 2398
364 Ga0496119_0112234 3300048922 Bacteria 1511
365 Ga0496121_0000087 3300048924 Bacteria 222451
366 Ga0496121_0015601 3300048924 Bacteria 7936
367 Ga0496122_0000603 3300048925 Bacteria 73878
368 Ga0496122_0009099 3300048925 Bacteria 10531
369 Ga0496123_0000155 3300048926 Bacteria 139646
370 Ga0496123_0011287 3300048926 Bacteria 7763
371 Ga0496123_0062259 3300048926 Bacteria 2392
372 Ga0496124_0043851 3300048927 Bacteria 3841
373 Ga0496125_0015219 3300048928 Bacteria 7449
374 Ga0496125_0033431 3300048928 Bacteria 4551
375 Ga0496125_0126610 3300048928 Bacteria 1809
376 Ga0496126_0028348 3300048929 Bacteria 5338
377 Ga0496126_0126594 3300048929 Bacteria 2211
378 Ga0501298_033098 3300049521 Bacteria 1023
379 Ga0501300_004776 3300049523 Bacteria 2003
380 Ga0501034_0198046 3300049571 Bacteria 1968
381 Ga0501223_000039 3300049663 Bacteria 45537
382 Ga0501257_000039 3300049686 Bacteria 37011
383 Ga0501225_0000010 3300049705 Bacteria 82395
384 Ga0501225_0004272 3300049705 Bacteria 4269
385 nmdc:mga06z11_17_c1 3300050494 Bacteria 79602
386 nmdc:mga04h51_23_c1 3300050495 Bacteria 63511
387 nmdc:mga07m45_60295_c1 3300050496 Bacteria 2147
388 nmdc:mga0qj67_23949_c2 3300050509 Bacteria 4112
389 nmdc:mga0n895_148538_c1 3300050512 Bacteria 2373
390 Ga0500643_000268 3300053087 Bacteria 45965
391 Ga0500643_002015 3300053087 Bacteria 10931
392 Ga0500643_002195 3300053087 Bacteria 10317
393 Ga0500643_002236 3300053087 Bacteria 10213
394 Ga0500643_016815 3300053087 Bacteria 2467
395 Ga0500566_0004538 3300053094 Bacteria 8291
396 Ga0500641_0007461 3300053096 Bacteria 3901
397 Ga0500555_000575 3300053103 Bacteria 14512
398 Ga0500556_0000197 3300053104 Bacteria 49633
399 Ga0500592_000182 3300053116 Bacteria 12130
400 Ga0500595_000572 3300053119 Bacteria 21961
401 Ga0500642_0000011 3300053130 Bacteria 215963
402 Ga0500658_0009412 3300053134 Bacteria 3604
403 Ga0500658_0024665 3300053134 Bacteria 2305
404 Ga0500573_0000114 3300053140 Bacteria 32888
405 Ga0500573_0076881 3300053140 Bacteria 1900
406 Ga0500577_0068226 3300053142 Bacteria 1388
407 Ga0500604_0000025 3300053151 Bacteria 68203
408 Ga0500604_0001841 3300053151 Bacteria 5890
409 Ga0500604_0046596 3300053151 Bacteria 1327
410 Ga0500616_0000254 3300053153 Bacteria 82664
411 Ga0500616_0008241 3300053153 Bacteria 6496
412 Ga0500624_000002 3300053157 Bacteria 257900
413 Ga0500627_0000208 3300053158 Bacteria 16936
414 Ga0500627_0000332 3300053158 Bacteria 12851
415 Ga0500627_0124036 3300053158 Bacteria 1166
416 Ga0500645_001488 3300053730 Bacteria 11755
417 Ga0466962_0005694 3300061719 Bacteria 5986
418 2600202841 2599185354 Bacteria 4398675
419 2644126042 2643221622 Bacteria 4212502
420 2919139228 2919138771 Bacteria 5281312
421 2919712717 2919709256 Bacteria 4318106
422 8057101260 8057101203 Bacteria 5034064
423 Ga0209565_1000134
424 JGI24740J21852_10003247
425 JGI24739J22299_10010647
426 JGI24737J22298_10002289
427 JGI24737J22298_10012312
428 JGI24737J22298_10033410
429 JGI24735J21928_10000590
430 JGI24735J21928_10001504
431 JGI24735J21928_10001790
432 JGI24735J21928_10004614
433 JGI24735J21928_10018807
434 JGI24735J21928_10018837
435 JGI24738J21930_10000184
436 JGI24744J21845_10008674
437 JGI24751J29686_10000660
438 JGI25150J39212_1002047
439 JGI25153J46596_10000395
440 JGI25153J46596_10002504
441 rootH1_10055751
442 rootH1_10100018
443 rootH1_10122197
444 rootH2_10001791
445 rootL2_10247348
446 rootH1_10035136
447 Ga0055526_1004784
448 Ga0055537_1001358
449 Ga0055537_1002042
450 Ga0055524_1000056
451 Ga0055530_10000931
452 Ga0055530_10020923
453 Ga0055540_1002064
454 Ga0055531_10000013
455 Ga0065165_1002739
456 Ga0065165_1003272
457 Ga0065165_1009273
458 Ga0065165_1011299
459 Ga0065165_1035594
460 Ga0070658_10000479
461 Ga0070658_10102032
462 Ga0070676_10000230
463 Ga0070676_10044427
464 Ga0070683_100387006
465 Ga0070670_100130729
466 Ga0068869_100000200
467 Ga0070666_10000234
468 Ga0068868_100001398
469 Ga0070660_100004174
470 Ga0070660_100004583
471 Ga0070660_100075067
472 Ga0070660_100192891
473 Ga0070668_100000047
474 Ga0070668_100005498
475 Ga0070668_100038200
476 Ga0070668_100199554
477 Ga0070669_100000008
478 Ga0070669_100000437
479 Ga0070669_100119035
480 Ga0070675_100006627
481 Ga0070671_100000010
482 Ga0070671_100000169
483 Ga0070671_100017053
484 Ga0070674_100051002
485 Ga0070673_100000006
486 Ga0070667_100000030
487 Ga0070663_100004887
488 Ga0070662_100007108
489 Ga0068867_100000001
490 Ga0068853_100161610
491 Ga0070686_100000352
492 Ga0070686_100085533
493 Ga0068855_100010482
494 Ga0068855_100105901
495 Ga0068855_100244870
496 Ga0068855_100244978
497 Ga0068857_100233163
498 Ga0068856_100240799
499 Ga0068852_100003329
500 Ga0068852_100185302
501 Ga0068852_100419042
502 Ga0068859_100002317
503 Ga0068859_100005156
504 Ga0068859_100103882
505 Ga0068859_100260377
506 Ga0068864_100023017
507 Ga0068861_100000001
508 Ga0068851_10007559
509 Ga0068851_10142290
510 Ga0068863_100000001
511 Ga0068863_100000093
512 Ga0068863_100000582
513 Ga0068863_100065620
514 Ga0068858_100006839
515 Ga0068858_100010200
516 Ga0068858_100036302
517 Ga0068860_100002229
518 Ga0068860_100003988
519 Ga0068860_100017800
520 Ga0068860_100629906
521 Ga0068862_100001451
522 Ga0068862_100011082
523 Ga0068862_100091483
524 Ga0075363_100182305
525 Ga0075367_10000607
526 Ga0075370_10036426
527 Ga0075370_10040892
528 Ga0075430_100229937
529 Ga0075434_100198543
530 Ga0068865_100000003
531 Ga0097620_100002317
532 Ga0097620_100005156
533 Ga0097620_100103880
534 Ga0097620_100260385
535 Ga0079104_1007109
536 Ga0105240_10091793
537 Ga0105245_10000113
538 Ga0105247_10000673
539 Ga0105247_10012233
540 Ga0105243_10000373
541 Ga0105243_10060689
542 Ga0105242_10010122
543 Ga0105248_10001758
544 Ga0105248_10004862
545 Ga0105248_10014065
546 Ga0105237_10005899
547 Ga0105238_10574796
548 Ga0105249_10000045
549 Ga0105249_10037210
550 Ga0105249_10084345
551 Ga0105239_10012172
552 Ga0105239_10129322
553 Ga0105246_10001620
554 Ga0157373_10004770
555 Ga0157373_10074190
556 Ga0157371_10208590
557 Ga0157371_10361403
558 Ga0157370_10000069
559 Ga0157370_10018262
560 Ga0157369_10173906
561 Ga0157369_10345800
562 Ga0157374_10057699
563 Ga0157378_10002300
564 Ga0163162_10012502
565 Ga0163162_10054234
566 Ga0157372_10059842
567 Ga0157372_10113522
568 Ga0157372_10118609
569 Ga0157372_10141635
570 Ga0157380_10008488
571 Ga0157376_10000089
572 Ga0163161_10019426
573 Ga0207425_1000041
574 Ga0209148_1000238
575 Ga0209129_1002094
576 Ga0209565_1000008
577 Ga0209455_1000952
578 Ga0209673_1002352
579 Ga0209675_1015089
580 Ga0209676_1016916
581 Ga0209025_1000068
582 Ga0209564_1012455
583 Ga0209758_1000004
584 Ga0209758_1005937
585 Ga0209050_1000001
586 Ga0209050_1000581
587 Ga0209050_1005993
588 Ga0209050_1014296
589 Ga0209256_1000009
590 Ga0209256_1000010
591 Ga0209051_1000191
592 Ga0209257_1000876
593 Ga0209257_1002898
594 Ga0209257_1003401
595 Ga0209257_1003674
596 Ga0209257_1014986
597 Ga0207697_10000036
598 Ga0207656_10076003
599 Ga0207710_10024250
600 Ga0207680_10000097
601 Ga0207680_10037307
602 Ga0207647_10001988
603 Ga0207647_10002647
604 Ga0207647_10007503
605 Ga0207647_10032481
606 Ga0207645_10003616
607 Ga0207645_10082030
608 Ga0207705_10000121
609 Ga0207705_10000365
610 Ga0207705_10053618
611 Ga0207695_10077775
612 Ga0207657_10015487
613 Ga0207657_10026870
614 Ga0207657_10027486
615 Ga0207657_10180243
616 Ga0207681_10000002
617 Ga0207681_10000463
618 Ga0207681_10027175
619 Ga0207650_10104123
620 Ga0207687_10000225
621 Ga0207644_10000002
622 Ga0207644_10000012
623 Ga0207644_10069262
624 Ga0207644_10136303
625 Ga0207644_10380165
626 Ga0207690_10368792
627 Ga0207706_10008805
628 Ga0207706_10026490
629 Ga0207706_10033279
630 Ga0207706_10211000
631 Ga0207686_10005107
632 Ga0207709_10000173
633 Ga0207704_10000001
634 Ga0207691_10009162
635 Ga0207711_10000852
636 Ga0207711_10113796
637 Ga0207689_10000744
638 Ga0207667_10000016
639 Ga0207667_10167891
640 Ga0207667_10276112
641 Ga0207651_10000002
642 Ga0207712_10000174
643 Ga0207668_10000066
644 Ga0207668_10000304
645 Ga0207668_10001421
646 Ga0207668_10003796
647 Ga0207640_10021246
648 Ga0207658_10000019
649 Ga0207658_10003580
650 Ga0207677_10000030
651 Ga0207703_10001492
652 Ga0207703_10006199
653 Ga0207703_10042647
654 Ga0207639_10008795
655 Ga0207639_10023944
656 Ga0207639_10122498
657 Ga0207678_10000857
658 Ga0207702_10002945
659 Ga0207641_10000001
660 Ga0207641_10000029
661 Ga0207641_10002512
662 Ga0207641_10091771
663 Ga0207641_10151692
664 Ga0207648_10000001
665 Ga0207648_10375614
666 Ga0207676_10015768
667 Ga0207674_10009584
668 Ga0207674_10024053
669 Ga0207674_10088087
670 Ga0207675_100000196
671 Ga0207675_100000358
672 Ga0207675_100121773
673 Ga0207698_10000130
674 Ga0209281_1015295
675 Ga0209813_10000075
676 Ga0268265_10000045
677 Ga0268265_10000339
678 Ga0268265_10316515
679 Ga0268264_10000010
680 Ga0268264_10004259
681 Ga0268264_10012577
682 Ga0268264_10025057
683 Ga0307513_10028045
684 Ga0307408_100090798
685 Ga0307408_100165945
686 Ga0307408_100306305
687 Ga0307405_10012300
688 Ga0307413_10174840
689 Ga0307410_10118754
690 Ga0307410_10206636
691 Ga0307406_10227908
692 Ga0307414_10091196
693 Ga0307414_10210331
694 Ga0307411_10132294
695 Ga0307411_10159569
696 Ga0395899_0001521
697 Ga0395900_0009291
698 Ga0395905_0018211
699 Ga0395905_0068601
700 Ga0395901_0073008
701 Ga0395901_0102947
702 Ga0439436_0020394
703 Ga0439461_0000498
704 Ga0439466_0018888
705 Ga0439465_0005658
706 Ga0451806_402659
707 Ga0451807_0382179
708 Ga0451853_2806299
709 Ga0439431_0000140
710 Ga0439431_0006887
711 Ga0439445_0004325
712 Ga0439448_0001939
713 Ga0439448_0009693
714 Ga0439448_0012547
715 Ga0439432_000640
716 Ga0439450_022012
717 Ga0439455_0014742
718 Ga0439455_0030935
719 Ga0439462_0014100
720 Ga0439462_0015361
721 Ga0439446_0018750
722 Ga0439458_0000137
723 Ga0439458_0002735
724 Ga0439458_0003196
725 Ga0439434_0001016
726 Ga0439434_0041366
727 Ga0466972_0000826
728 Ga0466966_0115314
729 Ga0466961_0036040
730 Ga0466961_0101880
731 Ga0466963_0005815
732 Ga0466964_0000258
733 Ga0466971_0005805
734 Ga0466970_0010990
735 Ga0466960_0004100
736 Ga0451576_0000393
737 Ga0451576_0259850
738 Ga0466958_0017628
739 Ga0466958_0042889
740 Ga0495627_000024
741 Ga0495627_003970
742 Ga0495650_0001027
743 Ga0495583_0000218
744 Ga0495606_0000710
745 Ga0495610_0000053
746 Ga0495616_0001456
747 Ga0495637_0003303
748 Ga0495637_0008486
749 Ga0495643_0000030
750 Ga0495648_0001960
751 Ga0495648_0006668
752 Ga0495654_0032421
753 Ga0495633_0002794
754 Ga0495668_0002221
755 Ga0495668_0048576
756 Ga0495611_0082245
757 Ga0495625_0035851
758 Ga0495670_0000002
759 Ga0495670_0010027
760 Ga0495671_0000072
761 Ga0495671_0045784
762 Ga0495649_0112123
763 Ga0495649_0237353
764 Ga0495683_0131132
765 Ga0495681_0000099
766 Ga0495681_0000858
767 Ga0495686_0008783
768 Ga0496100_0400741
769 Ga0496103_0131073
770 Ga0496104_0018392
771 Ga0496105_0276148
772 Ga0496106_0001994
773 Ga0496107_0006186
774 Ga0496108_0060537
775 Ga0496109_0315756
776 Ga0496110_0028842
777 Ga0496111_0344978
778 Ga0496112_0356615
779 Ga0496113_0000998
780 Ga0496115_0001129
781 Ga0496116_0037014
782 Ga0496117_0033071
783 Ga0496117_0040966
784 Ga0496118_0075722
785 Ga0496119_0112234
786 Ga0496121_0000087
787 Ga0496121_0015601
788 Ga0496122_0000603
789 Ga0496122_0009099
790 Ga0496123_0000155
791 Ga0496123_0011287
792 Ga0496123_0062259
793 Ga0496124_0043851
794 Ga0496125_0015219
795 Ga0496125_0033431
796 Ga0496125_0126610
797 Ga0496126_0028348
798 Ga0496126_0126594
799 Ga0501298_033098
800 Ga0501300_004776
801 Ga0501034_0198046
802 Ga0501223_000039
803 Ga0501257_000039
804 Ga0501225_0000010
805 Ga0501225_0004272
806 nmdc:mga06z11_17_c1
807 nmdc:mga04h51_23_c1
808 nmdc:mga07m45_60295_c1
809 nmdc:mga0qj67_23949_c2
810 nmdc:mga0n895_148538_c1
811 Ga0500643_000268
812 Ga0500643_002015
813 Ga0500643_002195
814 Ga0500643_002236
815 Ga0500643_016815
816 Ga0500566_0004538
817 Ga0500641_0007461
818 Ga0500555_000575
819 Ga0500556_0000197
820 Ga0500592_000182
821 Ga0500595_000572
822 Ga0500642_0000011
823 Ga0500658_0009412
824 Ga0500658_0024665
825 Ga0500573_0000114
826 Ga0500573_0076881
827 Ga0500577_0068226
828 Ga0500604_0000025
829 Ga0500604_0001841
830 Ga0500604_0046596
831 Ga0500616_0000254
832 Ga0500616_0008241
833 Ga0500624_000002
834 Ga0500627_0000208
835 Ga0500627_0000332
836 Ga0500627_0124036
837 Ga0500645_001488
838 Ga0466962_0005694
839 2600202841
840 2644126042
841 2919139228
842 2919712717
843 8057101260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

257

301

0.98

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

47

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.868 225 292
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8536 225 291
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8422 225 292
1xmk-assembly1.cif.gz_A the crystal structure of the zb domain from the rna editing enzyme adar1 0.8352 225 291
5u8o-assembly2.cif.gz_D crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.8345 10 291
ID Description Score Start End Superfamily
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9095 226 291 1.10.10.10
af_Q99KR3_205_288_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9035 219 291 1.10.10.10
af_Q6NYF0_205_289_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8852 219 291 1.10.10.10
af_Q95Q18_202_279_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8731 219 292 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8684 226 292 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A526XMU4-F1-model_v4 MBL fold metallo-hydrolase 0.9818 11 84 GO:0016787
AF-A0A848TXB8-F1-model_v4 MBL fold metallo-hydrolase 0.9792 11 98 GO:0016787
GO:0046872
AF-A0A2E6X934-F1-model_v4 MBL fold metallo-hydrolase 0.9741 21 105 GO:0016787
AF-A0A526XMU4-F1-model_v4 MBL fold metallo-hydrolase 0.9689 11 84 GO:0016787
AF-A0A352KMR6-F1-model_v4 MBL fold metallo-hydrolase 0.9658 10 79 GO:0016787

Map