F440041
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 421 | 240 | 416 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300035241|Ga0373961_0033037|Ga0373961_0033037_133_1149 |
| Length | 338 |
| Sequence | MKTTKLLALASLLAASSAMAQQYPTHAVTLMVPFAPGPTDTVARVIAQSMQKPLGQSIVVENRPSAGGILAPELVKNAKPDGYTILIHHIGMATTPALYRQLRFNPLTDFEYIGLINTVPMTLIGKQNLPPKNFKELLDYIKKNKDKVSLANAGIGAASHLCGMLFMSAIQTDLLTVPYKGTGPAMNDLIGGQVDLLCDQTTNTTGHIKGGKVKAYAVTTKQRVASLPDLPTLDEQGLKGFEVSIWHGLYAPKGTPKAAIDKLVAALQSGVKDEEVKKRFADLGATTYPPEQATPAALQAMVKSEIEKWTPLIKKAGVYADKKKQENKKAAHGRLFFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 2 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 3 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 4 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 162 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 163 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 198 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 203 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 204 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 205 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 206 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 207 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 226 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 227 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 238 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 240 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 0 |
| Isolates | 1.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.19 |
| Nodule | 0.95 |
| Rhizoplane | 0.95 |
| Rhizosphere | 95.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10125558 | 3300005289 | Bacteria | 1701 |
| 2 | Ga0065707_10101908 | 3300005295 | Bacteria | 2838 |
| 3 | Ga0070658_10145288 | 3300005327 | Bacteria | 1983 |
| 4 | Ga0070690_100018246 | 3300005330 | Bacteria | 4234 |
| 5 | Ga0070690_100059078 | 3300005330 | Bacteria | 2464 |
| 6 | Ga0068869_100000502 | 3300005334 | Bacteria | 21805 |
| 7 | Ga0068869_100218511 | 3300005334 | Bacteria | 1509 |
| 8 | Ga0068869_100337675 | 3300005334 | Bacteria | 1225 |
| 9 | Ga0070666_10074638 | 3300005335 | Bacteria | 2312 |
| 10 | Ga0070680_100000089 | 3300005336 | Bacteria | 51222 |
| 11 | Ga0070680_100023752 | 3300005336 | Bacteria | 4893 |
| 12 | Ga0070680_100165724 | 3300005336 | Bacteria | 1858 |
| 13 | Ga0070682_100002252 | 3300005337 | Bacteria | 10695 |
| 14 | Ga0068868_100211937 | 3300005338 | Bacteria | 1619 |
| 15 | Ga0070689_100002936 | 3300005340 | Bacteria | 11212 |
| 16 | Ga0070691_10000090 | 3300005341 | Bacteria | 25810 |
| 17 | Ga0070687_100060478 | 3300005343 | Bacteria | 1998 |
| 18 | Ga0070668_100012128 | 3300005347 | Bacteria | 6419 |
| 19 | Ga0070669_100002477 | 3300005353 | Bacteria | 13373 |
| 20 | Ga0070675_100265170 | 3300005354 | Bacteria | 1506 |
| 21 | Ga0070675_100314745 | 3300005354 | Bacteria | 1382 |
| 22 | Ga0070674_100036956 | 3300005356 | Bacteria | 3282 |
| 23 | Ga0070673_100309226 | 3300005364 | Bacteria | 1394 |
| 24 | Ga0070688_100035013 | 3300005365 | Bacteria | 3047 |
| 25 | Ga0070714_100147710 | 3300005435 | Bacteria | 2116 |
| 26 | Ga0070710_10034758 | 3300005437 | Bacteria | 2744 |
| 27 | Ga0070701_10000812 | 3300005438 | Bacteria | 11149 |
| 28 | Ga0070701_10003664 | 3300005438 | Bacteria | 6121 |
| 29 | Ga0070701_10094633 | 3300005438 | Bacteria | 1643 |
| 30 | Ga0070701_10110247 | 3300005438 | Bacteria | 1537 |
| 31 | Ga0070705_100021947 | 3300005440 | Bacteria | 3403 |
| 32 | Ga0070700_100001359 | 3300005441 | Bacteria | 12155 |
| 33 | Ga0070700_100007592 | 3300005441 | Bacteria | 5865 |
| 34 | Ga0070700_100186456 | 3300005441 | Bacteria | 1447 |
| 35 | Ga0070694_100035228 | 3300005444 | Bacteria | 3307 |
| 36 | Ga0070694_100038194 | 3300005444 | Bacteria | 3189 |
| 37 | Ga0070694_100133944 | 3300005444 | Bacteria | 1793 |
| 38 | Ga0070694_100209294 | 3300005444 | Bacteria | 1458 |
| 39 | Ga0070708_100356251 | 3300005445 | Bacteria | 1379 |
| 40 | Ga0070662_100208214 | 3300005457 | Bacteria | 1555 |
| 41 | Ga0070681_10000283 | 3300005458 | Bacteria | 40794 |
| 42 | Ga0068867_100001413 | 3300005459 | Bacteria | 16602 |
| 43 | Ga0068867_100003697 | 3300005459 | Bacteria | 10763 |
| 44 | Ga0070706_100415711 | 3300005467 | Bacteria | 1252 |
| 45 | Ga0070707_100476182 | 3300005468 | Bacteria | 1210 |
| 46 | Ga0070698_100592249 | 3300005471 | Bacteria | 1049 |
| 47 | Ga0070679_100066906 | 3300005530 | Bacteria | 3583 |
| 48 | Ga0070679_100072090 | 3300005530 | Bacteria | 3446 |
| 49 | Ga0070679_100085010 | 3300005530 | Bacteria | 3151 |
| 50 | Ga0070697_100011628 | 3300005536 | Bacteria | 6879 |
| 51 | Ga0070697_100026559 | 3300005536 | Bacteria | 4627 |
| 52 | Ga0068853_100073699 | 3300005539 | Bacteria | 2977 |
| 53 | Ga0070672_100447304 | 3300005543 | Bacteria | 1112 |
| 54 | Ga0070686_100150481 | 3300005544 | Bacteria | 1629 |
| 55 | Ga0070695_100002400 | 3300005545 | Bacteria | 10764 |
| 56 | Ga0070695_100014134 | 3300005545 | Bacteria | 4808 |
| 57 | Ga0070696_100002203 | 3300005546 | Bacteria | 12849 |
| 58 | Ga0070696_100010522 | 3300005546 | Bacteria | 6200 |
| 59 | Ga0070696_100086641 | 3300005546 | Bacteria | 2224 |
| 60 | Ga0070693_100000477 | 3300005547 | Bacteria | 17942 |
| 61 | Ga0070693_100084737 | 3300005547 | Bacteria | 1897 |
| 62 | Ga0070704_100000091 | 3300005549 | Bacteria | 31281 |
| 63 | Ga0070704_100016050 | 3300005549 | Bacteria | 4723 |
| 64 | Ga0070704_100103958 | 3300005549 | Bacteria | 2147 |
| 65 | Ga0070704_100299382 | 3300005549 | Bacteria | 1339 |
| 66 | Ga0068855_100006008 | 3300005563 | Bacteria | 14806 |
| 67 | Ga0068855_100096204 | 3300005563 | Bacteria | 3412 |
| 68 | Ga0068855_100220413 | 3300005563 | Bacteria | 2127 |
| 69 | Ga0068854_100010099 | 3300005578 | Bacteria | 6116 |
| 70 | Ga0068856_100224781 | 3300005614 | Bacteria | 1892 |
| 71 | Ga0070702_100015381 | 3300005615 | Bacteria | 3906 |
| 72 | Ga0070702_100207491 | 3300005615 | Bacteria | 1301 |
| 73 | Ga0068852_100022271 | 3300005616 | Bacteria | 5079 |
| 74 | Ga0068859_100053262 | 3300005617 | Bacteria | 4069 |
| 75 | Ga0068859_100064703 | 3300005617 | Bacteria | 3690 |
| 76 | Ga0068859_100109634 | 3300005617 | Bacteria | 2822 |
| 77 | Ga0068859_100269579 | 3300005617 | Bacteria | 1794 |
| 78 | Ga0068866_10000144 | 3300005718 | Bacteria | 32128 |
| 79 | Ga0068861_100002139 | 3300005719 | Bacteria | 12782 |
| 80 | Ga0068861_100125159 | 3300005719 | Bacteria | 2079 |
| 81 | Ga0068861_100193593 | 3300005719 | Bacteria | 1702 |
| 82 | Ga0068861_100346539 | 3300005719 | Bacteria | 1301 |
| 83 | Ga0068870_10103824 | 3300005840 | Bacteria | 1611 |
| 84 | Ga0068858_100005045 | 3300005842 | Bacteria | 12942 |
| 85 | Ga0068858_100130674 | 3300005842 | Bacteria | 2354 |
| 86 | Ga0068860_100168771 | 3300005843 | Bacteria | 2113 |
| 87 | Ga0068860_100238734 | 3300005843 | Bacteria | 1768 |
| 88 | Ga0068862_100003743 | 3300005844 | Bacteria | 12974 |
| 89 | Ga0068862_100038361 | 3300005844 | Bacteria | 4063 |
| 90 | Ga0068862_100065330 | 3300005844 | Bacteria | 3133 |
| 91 | Ga0068862_100133574 | 3300005844 | Bacteria | 2197 |
| 92 | Ga0068862_100214369 | 3300005844 | Bacteria | 1741 |
| 93 | Ga0068862_100490369 | 3300005844 | Bacteria | 1165 |
| 94 | Ga0081539_10013580 | 3300005985 | Bacteria | 6124 |
| 95 | Ga0075363_100048165 | 3300006048 | Bacteria | 2265 |
| 96 | Ga0075367_10002211 | 3300006178 | Bacteria | 8773 |
| 97 | Ga0068871_100000744 | 3300006358 | Bacteria | 22076 |
| 98 | Ga0068871_100040766 | 3300006358 | Bacteria | 3720 |
| 99 | Ga0075428_100007605 | 3300006844 | Bacteria | 12011 |
| 100 | Ga0075428_100052577 | 3300006844 | Bacteria | 4464 |
| 101 | Ga0075428_100064946 | 3300006844 | Bacteria | 3997 |
| 102 | Ga0075430_100008291 | 3300006846 | Bacteria | 8777 |
| 103 | Ga0075431_100002501 | 3300006847 | Bacteria | 17729 |
| 104 | Ga0075431_100098911 | 3300006847 | Bacteria | 3011 |
| 105 | Ga0075431_100217597 | 3300006847 | Bacteria | 1949 |
| 106 | Ga0075431_100308625 | 3300006847 | Bacteria | 1597 |
| 107 | Ga0075433_10001605 | 3300006852 | Bacteria | 16762 |
| 108 | Ga0075433_10126086 | 3300006852 | Bacteria | 2273 |
| 109 | Ga0075434_100000002 | 3300006871 | Bacteria | 135661 |
| 110 | Ga0075434_100000018 | 3300006871 | Bacteria | 73715 |
| 111 | Ga0075434_100019670 | 3300006871 | Bacteria | 6534 |
| 112 | Ga0075434_100024723 | 3300006871 | Bacteria | 5874 |
| 113 | Ga0075434_100028968 | 3300006871 | Bacteria | 5446 |
| 114 | Ga0075434_100031752 | 3300006871 | Bacteria | 5207 |
| 115 | Ga0075429_100000175 | 3300006880 | Bacteria | 41423 |
| 116 | Ga0075429_100015900 | 3300006880 | Bacteria | 6515 |
| 117 | Ga0075429_100018749 | 3300006880 | Bacteria | 5992 |
| 118 | Ga0075429_100200652 | 3300006880 | Bacteria | 1747 |
| 119 | Ga0068865_100000710 | 3300006881 | Bacteria | 18708 |
| 120 | Ga0068865_100001000 | 3300006881 | Bacteria | 16237 |
| 121 | Ga0068865_100163935 | 3300006881 | Bacteria | 1698 |
| 122 | Ga0075436_100000048 | 3300006914 | Bacteria | 72013 |
| 123 | Ga0075436_100000651 | 3300006914 | Bacteria | 22851 |
| 124 | Ga0075436_100002045 | 3300006914 | Bacteria | 13910 |
| 125 | Ga0075436_100019957 | 3300006914 | Bacteria | 4598 |
| 126 | Ga0075436_100031098 | 3300006914 | Bacteria | 3674 |
| 127 | Ga0075436_100104651 | 3300006914 | Bacteria | 1973 |
| 128 | Ga0097620_100053258 | 3300006931 | Bacteria | 4069 |
| 129 | Ga0097620_100064705 | 3300006931 | Bacteria | 3690 |
| 130 | Ga0097620_100109629 | 3300006931 | Bacteria | 2822 |
| 131 | Ga0097620_100269599 | 3300006931 | Bacteria | 1794 |
| 132 | Ga0079104_1000020 | 3300006946 | Bacteria | 256848 |
| 133 | Ga0075435_100002074 | 3300007076 | Bacteria | 13145 |
| 134 | Ga0075435_100003818 | 3300007076 | Bacteria | 10280 |
| 135 | Ga0075435_100045325 | 3300007076 | Bacteria | 3525 |
| 136 | Ga0075435_100089166 | 3300007076 | Bacteria | 2542 |
| 137 | Ga0099794_10010056 | 3300007265 | Bacteria | 4006 |
| 138 | Ga0105250_10001151 | 3300009092 | Bacteria | 14863 |
| 139 | Ga0105240_10111676 | 3300009093 | Bacteria | 3306 |
| 140 | Ga0111539_10012223 | 3300009094 | Bacteria | 10767 |
| 141 | Ga0111539_10022400 | 3300009094 | Bacteria | 7764 |
| 142 | Ga0111539_10085218 | 3300009094 | Bacteria | 3714 |
| 143 | Ga0111539_10101494 | 3300009094 | Bacteria | 3378 |
| 144 | Ga0105245_10115514 | 3300009098 | Bacteria | 2501 |
| 145 | Ga0105245_10141091 | 3300009098 | Bacteria | 2269 |
| 146 | Ga0114129_10090272 | 3300009147 | Bacteria | 4247 |
| 147 | Ga0114129_10124555 | 3300009147 | Bacteria | 3544 |
| 148 | Ga0114129_10167428 | 3300009147 | Bacteria | 2998 |
| 149 | Ga0105243_10007953 | 3300009148 | Bacteria | 8145 |
| 150 | Ga0105243_10012332 | 3300009148 | Bacteria | 6463 |
| 151 | Ga0105243_10024763 | 3300009148 | Bacteria | 4581 |
| 152 | Ga0105243_10109425 | 3300009148 | Bacteria | 2308 |
| 153 | Ga0105241_10008217 | 3300009174 | Bacteria | 7684 |
| 154 | Ga0105242_10001851 | 3300009176 | Bacteria | 16595 |
| 155 | Ga0105242_10004701 | 3300009176 | Bacteria | 10570 |
| 156 | Ga0105242_10053206 | 3300009176 | Bacteria | 3305 |
| 157 | Ga0105248_10310534 | 3300009177 | Bacteria | 1776 |
| 158 | Ga0105238_10302891 | 3300009551 | Bacteria | 1582 |
| 159 | Ga0105238_10326800 | 3300009551 | Bacteria | 1520 |
| 160 | Ga0105249_10000917 | 3300009553 | Bacteria | 26070 |
| 161 | Ga0105249_10019752 | 3300009553 | Bacteria | 6016 |
| 162 | Ga0157369_10039287 | 3300013105 | Bacteria | 5171 |
| 163 | Ga0157378_10003846 | 3300013297 | Bacteria | 13282 |
| 164 | Ga0163162_10193361 | 3300013306 | Bacteria | 2162 |
| 165 | Ga0163162_10598055 | 3300013306 | Bacteria | 1229 |
| 166 | Ga0157372_10011322 | 3300013307 | Bacteria | 9485 |
| 167 | Ga0157372_10276253 | 3300013307 | Bacteria | 1953 |
| 168 | Ga0157380_10018792 | 3300014326 | Bacteria | 5139 |
| 169 | Ga0157380_10090997 | 3300014326 | Bacteria | 2518 |
| 170 | Ga0157377_10068774 | 3300014745 | Bacteria | 2041 |
| 171 | Ga0157379_10017026 | 3300014968 | Bacteria | 6398 |
| 172 | Ga0157376_10004616 | 3300014969 | Bacteria | 9595 |
| 173 | Ga0157376_10057308 | 3300014969 | Bacteria | 3258 |
| 174 | Ga0207642_10003770 | 3300025899 | Bacteria | 4824 |
| 175 | Ga0207688_10137690 | 3300025901 | Bacteria | 1435 |
| 176 | Ga0207643_10060785 | 3300025908 | Bacteria | 2157 |
| 177 | Ga0207705_10028530 | 3300025909 | Bacteria | 3980 |
| 178 | Ga0207705_10174717 | 3300025909 | Bacteria | 1618 |
| 179 | Ga0207684_10393137 | 3300025910 | Bacteria | 1192 |
| 180 | Ga0207654_10047529 | 3300025911 | Bacteria | 2452 |
| 181 | Ga0207707_10000946 | 3300025912 | Bacteria | 27996 |
| 182 | Ga0207707_10087581 | 3300025912 | Bacteria | 2720 |
| 183 | Ga0207695_10135404 | 3300025913 | Bacteria | 2417 |
| 184 | Ga0207660_10002436 | 3300025917 | Bacteria | 12221 |
| 185 | Ga0207662_10001703 | 3300025918 | Bacteria | 10769 |
| 186 | Ga0207662_10085374 | 3300025918 | Bacteria | 1933 |
| 187 | Ga0207652_10045929 | 3300025921 | Bacteria | 3725 |
| 188 | Ga0207652_10052696 | 3300025921 | Bacteria | 3493 |
| 189 | Ga0207652_10166428 | 3300025921 | Bacteria | 1977 |
| 190 | Ga0207652_10254287 | 3300025921 | Bacteria | 1584 |
| 191 | Ga0207646_10148966 | 3300025922 | Bacteria | 2110 |
| 192 | Ga0207681_10000560 | 3300025923 | Bacteria | 25447 |
| 193 | Ga0207681_10362096 | 3300025923 | Bacteria | 1163 |
| 194 | Ga0207694_10138555 | 3300025924 | Bacteria | 1955 |
| 195 | Ga0207694_10150915 | 3300025924 | Bacteria | 1872 |
| 196 | Ga0207659_10254141 | 3300025926 | Bacteria | 1427 |
| 197 | Ga0207659_10349507 | 3300025926 | Bacteria | 1226 |
| 198 | Ga0207687_10032123 | 3300025927 | Bacteria | 3553 |
| 199 | Ga0207687_10169528 | 3300025927 | Bacteria | 1682 |
| 200 | Ga0207664_10103618 | 3300025929 | Bacteria | 2355 |
| 201 | Ga0207664_10131527 | 3300025929 | Bacteria | 2107 |
| 202 | Ga0207690_10050338 | 3300025932 | Bacteria | 2781 |
| 203 | Ga0207706_10032207 | 3300025933 | Bacteria | 4669 |
| 204 | Ga0207686_10021005 | 3300025934 | Bacteria | 3739 |
| 205 | Ga0207686_10107283 | 3300025934 | Bacteria | 1876 |
| 206 | Ga0207709_10000055 | 3300025935 | Bacteria | 222373 |
| 207 | Ga0207709_10001315 | 3300025935 | Bacteria | 17635 |
| 208 | Ga0207709_10006652 | 3300025935 | Bacteria | 6486 |
| 209 | Ga0207670_10180339 | 3300025936 | Bacteria | 1590 |
| 210 | Ga0207670_10345340 | 3300025936 | Bacteria | 1177 |
| 211 | Ga0207704_10000483 | 3300025938 | Bacteria | 17756 |
| 212 | Ga0207704_10005835 | 3300025938 | Bacteria | 5698 |
| 213 | Ga0207691_10301948 | 3300025940 | Bacteria | 1375 |
| 214 | Ga0207711_10452859 | 3300025941 | Bacteria | 1195 |
| 215 | Ga0207689_10000544 | 3300025942 | Bacteria | 35849 |
| 216 | Ga0207689_10226505 | 3300025942 | Bacteria | 1545 |
| 217 | Ga0207667_10008307 | 3300025949 | Bacteria | 12352 |
| 218 | Ga0207667_10151663 | 3300025949 | Bacteria | 2385 |
| 219 | Ga0207667_10433110 | 3300025949 | Bacteria | 1337 |
| 220 | Ga0207712_10009220 | 3300025961 | Bacteria | 6248 |
| 221 | Ga0207668_10008527 | 3300025972 | Bacteria | 6114 |
| 222 | Ga0207658_10188378 | 3300025986 | Bacteria | 1713 |
| 223 | Ga0207677_10003254 | 3300026023 | Bacteria | 8578 |
| 224 | Ga0207703_10490266 | 3300026035 | Bacteria | 1152 |
| 225 | Ga0207639_10070031 | 3300026041 | Bacteria | 2738 |
| 226 | Ga0207639_10175025 | 3300026041 | Bacteria | 1821 |
| 227 | Ga0207708_10000417 | 3300026075 | Bacteria | 33347 |
| 228 | Ga0207708_10001699 | 3300026075 | Bacteria | 16293 |
| 229 | Ga0207708_10446243 | 3300026075 | Bacteria | 1077 |
| 230 | Ga0207702_10073158 | 3300026078 | Bacteria | 2955 |
| 231 | Ga0207702_10183810 | 3300026078 | Bacteria | 1927 |
| 232 | Ga0207702_10195396 | 3300026078 | Bacteria | 1872 |
| 233 | Ga0207702_10552167 | 3300026078 | Bacteria | 1127 |
| 234 | Ga0207641_10242265 | 3300026088 | Bacteria | 1681 |
| 235 | Ga0207648_10000135 | 3300026089 | Bacteria | 73544 |
| 236 | Ga0207648_10007396 | 3300026089 | Bacteria | 10809 |
| 237 | Ga0207648_10315605 | 3300026089 | Bacteria | 1404 |
| 238 | Ga0207675_100000825 | 3300026118 | Bacteria | 30861 |
| 239 | Ga0207675_100004922 | 3300026118 | Bacteria | 12870 |
| 240 | Ga0207675_100107279 | 3300026118 | Bacteria | 2633 |
| 241 | Ga0207675_100234989 | 3300026118 | Bacteria | 1769 |
| 242 | Ga0207698_10061372 | 3300026142 | Bacteria | 2929 |
| 243 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 244 | Ga0209981_1008566 | 3300027378 | Bacteria | 1390 |
| 245 | Ga0210000_1009180 | 3300027462 | Bacteria | 1454 |
| 246 | Ga0209999_1007387 | 3300027543 | Bacteria | 1979 |
| 247 | Ga0207428_10088842 | 3300027907 | Bacteria | 2403 |
| 248 | Ga0207428_10204260 | 3300027907 | Bacteria | 1486 |
| 249 | Ga0207428_10220634 | 3300027907 | Bacteria | 1421 |
| 250 | Ga0268265_10001299 | 3300028380 | Bacteria | 21420 |
| 251 | Ga0268265_10002564 | 3300028380 | Bacteria | 13587 |
| 252 | Ga0268265_10040465 | 3300028380 | Bacteria | 3443 |
| 253 | Ga0268265_10166676 | 3300028380 | Bacteria | 1878 |
| 254 | Ga0268264_10112365 | 3300028381 | Bacteria | 2388 |
| 255 | Ga0307408_100158517 | 3300031548 | Bacteria | 1795 |
| 256 | Ga0307408_100212431 | 3300031548 | Bacteria | 1573 |
| 257 | Ga0307410_10037078 | 3300031852 | Bacteria | 3181 |
| 258 | Ga0307410_10131230 | 3300031852 | Bacteria | 1841 |
| 259 | Ga0307406_10091825 | 3300031901 | Bacteria | 2046 |
| 260 | Ga0307409_100008371 | 3300031995 | Bacteria | 6272 |
| 261 | Ga0307409_100101388 | 3300031995 | Bacteria | 2389 |
| 262 | Ga0307409_100160367 | 3300031995 | Bacteria | 1966 |
| 263 | Ga0307416_100040135 | 3300032002 | Bacteria | 3633 |
| 264 | Ga0307416_100088314 | 3300032002 | Bacteria | 2650 |
| 265 | Ga0307416_100257839 | 3300032002 | Bacteria | 1702 |
| 266 | Ga0373926_0020142 | 3300035083 | Bacteria | 2303 |
| 267 | Ga0373934_0018376 | 3300035086 | Bacteria | 2674 |
| 268 | Ga0373944_0004604 | 3300035089 | Bacteria | 3600 |
| 269 | Ga0373953_0004053 | 3300035117 | Bacteria | 4632 |
| 270 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 271 | Ga0373954_0009550 | 3300035118 | Bacteria | 4268 |
| 272 | Ga0373960_0007090 | 3300035121 | Bacteria | 2646 |
| 273 | Ga0373946_0060644 | 3300035171 | Bacteria | 1608 |
| 274 | Ga0373955_0004737 | 3300035172 | Bacteria | 6051 |
| 275 | Ga0373942_0004077 | 3300035207 | Bacteria | 3407 |
| 276 | Ga0373942_0036035 | 3300035207 | Bacteria | 1330 |
| 277 | Ga0373961_0033037 | 3300035241 | Bacteria | 1455 |
| 278 | Ga0373924_0005706 | 3300035410 | Bacteria | 4419 |
| 279 | Ga0373924_0015060 | 3300035410 | Bacteria | 2932 |
| 280 | Ga0373924_0019445 | 3300035410 | Bacteria | 2631 |
| 281 | Ga0373931_0102466 | 3300035691 | Bacteria | 1612 |
| 282 | Ga0373927_0004990 | 3300035695 | Bacteria | 9193 |
| 283 | Ga0373933_0002915 | 3300035724 | Bacteria | 9553 |
| 284 | Ga0373933_0014814 | 3300035724 | Bacteria | 4338 |
| 285 | Ga0373933_0074896 | 3300035724 | Bacteria | 2066 |
| 286 | Ga0373933_0272410 | 3300035724 | Bacteria | 1093 |
| 287 | Ga0373937_0000775 | 3300036401 | Bacteria | 27575 |
| 288 | Ga0373937_0005397 | 3300036401 | Bacteria | 10937 |
| 289 | Ga0373937_0092361 | 3300036401 | Bacteria | 2805 |
| 290 | Ga0373925_0014061 | 3300037068 | Bacteria | 5792 |
| 291 | Ga0373925_0131079 | 3300037068 | Bacteria | 1955 |
| 292 | Ga0395900_0039408 | 3300037418 | Bacteria | 4868 |
| 293 | Ga0395905_0016916 | 3300037471 | Bacteria | 6928 |
| 294 | Ga0439441_001479 | 3300042001 | Bacteria | 3085 |
| 295 | Ga0439441_003362 | 3300042001 | Bacteria | 2353 |
| 296 | Ga0450893_0005239 | 3300042532 | Bacteria | 2076 |
| 297 | Ga0453683_0138840 | 3300044673 | Bacteria | 1533 |
| 298 | Ga0451576_0452590 | 3300045051 | Bacteria | 1348 |
| 299 | Ga0466967_0429597 | 3300045976 | Bacteria | 1288 |
| 300 | Ga0495592_0006091 | 3300046454 | Bacteria | 8965 |
| 301 | Ga0495603_0007268 | 3300046455 | Bacteria | 6654 |
| 302 | Ga0495629_0216394 | 3300046459 | Bacteria | 1322 |
| 303 | Ga0495662_0008257 | 3300046476 | Bacteria | 5127 |
| 304 | Ga0495662_0008673 | 3300046476 | Bacteria | 4998 |
| 305 | Ga0495608_0000872 | 3300046511 | Bacteria | 21068 |
| 306 | Ga0495628_0009119 | 3300046516 | Bacteria | 8485 |
| 307 | Ga0495628_0034982 | 3300046516 | Bacteria | 4039 |
| 308 | Ga0495630_0043664 | 3300046517 | Bacteria | 3350 |
| 309 | Ga0495666_0002191 | 3300046526 | Bacteria | 9735 |
| 310 | Ga0495640_0016664 | 3300046533 | Bacteria | 5496 |
| 311 | Ga0495640_0032981 | 3300046533 | Bacteria | 3683 |
| 312 | Ga0495586_0000095 | 3300046535 | Bacteria | 53876 |
| 313 | Ga0495586_0006745 | 3300046535 | Bacteria | 6132 |
| 314 | Ga0495587_0015672 | 3300046536 | Bacteria | 4728 |
| 315 | Ga0495587_0119244 | 3300046536 | Bacteria | 1512 |
| 316 | Ga0495598_0031979 | 3300046537 | Bacteria | 1484 |
| 317 | Ga0495621_0002530 | 3300046539 | Bacteria | 4931 |
| 318 | Ga0495645_0060991 | 3300046543 | Bacteria | 2733 |
| 319 | Ga0495667_0104906 | 3300046559 | Bacteria | 1827 |
| 320 | Ga0495634_0004554 | 3300046642 | Bacteria | 10834 |
| 321 | Ga0495625_0155112 | 3300046660 | Bacteria | 1537 |
| 322 | Ga0495659_0099687 | 3300046664 | Bacteria | 1124 |
| 323 | Ga0495588_0004610 | 3300046674 | Bacteria | 6087 |
| 324 | Ga0495647_0000141 | 3300046681 | Bacteria | 18379 |
| 325 | Ga0495669_0006731 | 3300046684 | Bacteria | 4811 |
| 326 | Ga0495624_0114049 | 3300046690 | Bacteria | 1661 |
| 327 | Ga0495670_0150376 | 3300046691 | Bacteria | 1221 |
| 328 | Ga0495600_0030905 | 3300046809 | Bacteria | 3468 |
| 329 | Ga0495581_0013738 | 3300047315 | Bacteria | 4695 |
| 330 | Ga0495581_0044407 | 3300047315 | Bacteria | 2570 |
| 331 | Ga0495581_0061068 | 3300047315 | Bacteria | 2178 |
| 332 | Ga0495604_0012342 | 3300047317 | Bacteria | 6792 |
| 333 | Ga0495636_0003000 | 3300047318 | Bacteria | 6536 |
| 334 | Ga0495674_0092592 | 3300047319 | Bacteria | 2580 |
| 335 | Ga0495672_0076042 | 3300047320 | Bacteria | 1887 |
| 336 | Ga0495680_0002031 | 3300047322 | Bacteria | 21186 |
| 337 | Ga0495680_0055026 | 3300047322 | Bacteria | 3087 |
| 338 | Ga0495593_0044714 | 3300047673 | Bacteria | 2367 |
| 339 | Ga0496104_0003588 | 3300048907 | Bacteria | 13403 |
| 340 | Ga0496105_0007676 | 3300048908 | Bacteria | 8365 |
| 341 | Ga0496106_0133240 | 3300048909 | Bacteria | 1950 |
| 342 | Ga0496106_0254242 | 3300048909 | Bacteria | 1405 |
| 343 | Ga0496117_0009184 | 3300048920 | Bacteria | 9264 |
| 344 | Ga0496118_0034226 | 3300048921 | Bacteria | 4150 |
| 345 | Ga0496119_0025766 | 3300048922 | Bacteria | 4099 |
| 346 | Ga0496124_0000104 | 3300048927 | Bacteria | 177382 |
| 347 | Ga0496125_0027922 | 3300048928 | Bacteria | 5105 |
| 348 | Ga0496125_0206808 | 3300048928 | Bacteria | 1279 |
| 349 | Ga0501292_012768 | 3300049515 | Bacteria | 1286 |
| 350 | Ga0501298_003686 | 3300049521 | Bacteria | 2386 |
| 351 | Ga0501031_0124255 | 3300049568 | Bacteria | 1686 |
| 352 | Ga0501036_0030889 | 3300049572 | Bacteria | 4527 |
| 353 | Ga0501038_0309716 | 3300049574 | Bacteria | 1238 |
| 354 | Ga0501039_0185451 | 3300049575 | Bacteria | 1636 |
| 355 | Ga0501040_0027433 | 3300049576 | Bacteria | 3834 |
| 356 | Ga0501041_0018195 | 3300049577 | Bacteria | 4185 |
| 357 | Ga0501041_0038024 | 3300049577 | Bacteria | 2917 |
| 358 | Ga0501046_0128695 | 3300049580 | Bacteria | 1921 |
| 359 | Ga0501048_0012576 | 3300049582 | Bacteria | 6296 |
| 360 | Ga0501067_0038149 | 3300049583 | Bacteria | 2668 |
| 361 | Ga0501067_0045539 | 3300049583 | Bacteria | 2436 |
| 362 | Ga0501071_0036845 | 3300049587 | Bacteria | 3489 |
| 363 | Ga0501071_0412793 | 3300049587 | Bacteria | 1031 |
| 364 | Ga0501072_0025746 | 3300049588 | Bacteria | 4583 |
| 365 | Ga0501072_0162535 | 3300049588 | Bacteria | 1781 |
| 366 | Ga0501075_0002559 | 3300049591 | Bacteria | 12120 |
| 367 | Ga0501076_0001216 | 3300049592 | Bacteria | 17126 |
| 368 | Ga0501076_0108829 | 3300049592 | Bacteria | 2239 |
| 369 | Ga0501077_0059122 | 3300049593 | Bacteria | 2433 |
| 370 | Ga0501079_0018141 | 3300049741 | Bacteria | 5375 |
| 371 | Ga0501079_0120179 | 3300049741 | Bacteria | 2043 |
| 372 | Ga0501080_0152798 | 3300049742 | Bacteria | 2133 |
| 373 | Ga0501080_0336860 | 3300049742 | Bacteria | 1364 |
| 374 | Ga0501081_0015886 | 3300049743 | Bacteria | 4971 |
| 375 | Ga0501045_0023747 | 3300049824 | Bacteria | 4399 |
| 376 | nmdc:mga03n38_2941_c1 | 3300050490 | Bacteria | 2799 |
| 377 | nmdc:mga06z11_3297_c1 | 3300050494 | Bacteria | 6246 |
| 378 | nmdc:mga05p37_260850_c1 | 3300050507 | Bacteria | 2074 |
| 379 | nmdc:mga05p37_424596_c1 | 3300050507 | Bacteria | 1546 |
| 380 | nmdc:mga05p37_91263_c1 | 3300050507 | Bacteria | 3754 |
| 381 | nmdc:mga09592_12470_c1 | 3300050508 | Bacteria | 6925 |
| 382 | nmdc:mga09592_16177_c1 | 3300050508 | Bacteria | 6098 |
| 383 | nmdc:mga09592_201508_c1 | 3300050508 | Bacteria | 1724 |
| 384 | nmdc:mga0qj67_121991_c1 | 3300050509 | Bacteria | 2109 |
| 385 | nmdc:mga06r32_1647_c1 | 3300050510 | Bacteria | 20161 |
| 386 | nmdc:mga06r32_167778_c1 | 3300050510 | Bacteria | 2178 |
| 387 | nmdc:mga06r32_23107_c1 | 3300050510 | Bacteria | 5753 |
| 388 | nmdc:mga06r32_291214_c1 | 3300050510 | Bacteria | 1620 |
| 389 | nmdc:mga08y16_12357_c1 | 3300050511 | Bacteria | 8979 |
| 390 | nmdc:mga08y16_134009_c1 | 3300050511 | Bacteria | 2575 |
| 391 | nmdc:mga08y16_25146_c1 | 3300050511 | Bacteria | 6280 |
| 392 | nmdc:mga08y16_485529_c1 | 3300050511 | Bacteria | 1257 |
| 393 | nmdc:mga0n895_100775_c1 | 3300050512 | Bacteria | 2897 |
| 394 | nmdc:mga0n895_1173_c1 | 3300050512 | Bacteria | 19209 |
| 395 | nmdc:mga0n895_1415_c1 | 3300050512 | Bacteria | 17921 |
| 396 | nmdc:mga0n895_1513_c1 | 3300050512 | Bacteria | 17434 |
| 397 | nmdc:mga0n895_153011_c1 | 3300050512 | Bacteria | 2337 |
| 398 | nmdc:mga0n895_192774_c1 | 3300050512 | Bacteria | 2069 |
| 399 | nmdc:mga0n895_206333_c1 | 3300050512 | Bacteria | 1996 |
| 400 | nmdc:mga0rr50_11180_c1 | 3300050513 | Bacteria | 5729 |
| 401 | nmdc:mga0rr50_25095_c1 | 3300050513 | Bacteria | 4140 |
| 402 | nmdc:mga0rr50_331_c1 | 3300050513 | Bacteria | 25779 |
| 403 | nmdc:mga0rr50_337053_c1 | 3300050513 | Bacteria | 1267 |
| 404 | nmdc:mga08x19_10505_c1 | 3300050514 | Bacteria | 5560 |
| 405 | nmdc:mga08x19_1633_c1 | 3300050514 | Bacteria | 13880 |
| 406 | nmdc:mga08x19_31827_c1 | 3300050514 | Bacteria | 3322 |
| 407 | nmdc:mga08x19_348_c1 | 3300050514 | Bacteria | 33504 |
| 408 | nmdc:mga08x19_852_c1 | 3300050514 | Bacteria | 19371 |
| 409 | nmdc:mga0a205_101487_c1 | 3300050515 | Bacteria | 2776 |
| 410 | nmdc:mga0a205_242_c2 | 3300050515 | Bacteria | 16279 |
| 411 | nmdc:mga0a205_68568_c1 | 3300050515 | Bacteria | 3425 |
| 412 | Ga0495601_0025966 | 3300053077 | Bacteria | 3614 |
| 413 | Ga0500614_060416 | 3300053123 | Bacteria | 1018 |
| 414 | Ga0501082_0015865 | 3300060353 | Bacteria | 6477 |
| 415 | Ga0501082_0292785 | 3300060353 | Bacteria | 1417 |
| 416 | Ga0530510_0002366 | 3300061734 | Bacteria | 12953 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_192774_c1 | nmdc:mga0n895_192774_c1_19_861 | 263 |
| 2 | 3300046664 | Ga0495659_0099687 | Ga0495659_0099687_14_832 | 272 |
| 3 | 3300047318 | Ga0495636_0003000 | Ga0495636_0003000_5706_6524 | 272 |
| 4 | 3300049587 | Ga0501071_0412793 | Ga0501071_0412793_14_832 | 272 |
| 5 | 3300046691 | Ga0495670_0150376 | Ga0495670_0150376_361_1203 | 280 |
| 6 | 3300005844 | Ga0068862_100133574 | Ga0068862_1001335742 | 292 |
| 7 | 3300006048 | Ga0075363_100048165 | Ga0075363_1000481652 | 292 |
| 8 | 3300006178 | Ga0075367_10002211 | Ga0075367_100022115 | 292 |
| 9 | 3300028380 | Ga0268265_10040465 | Ga0268265_100404652 | 292 |
| 10 | 3300053123 | Ga0500614_060416 | Ga0500614_060416_21_998 | 292 |
| 11 | 3300026078 | Ga0207702_10073158 | Ga0207702_100731582 | 293 |
| 12 | 3300035207 | Ga0373942_0036035 | Ga0373942_0036035_436_1317 | 293 |
| 13 | 3300035724 | Ga0373933_0014814 | Ga0373933_0014814_80_961 | 293 |
| 14 | 3300035724 | Ga0373933_0272410 | Ga0373933_0272410_19_900 | 293 |
| 15 | 3300036401 | Ga0373937_0092361 | Ga0373937_0092361_1443_2324 | 293 |
| 16 | 3300045051 | Ga0451576_0452590 | Ga0451576_0452590_32_916 | 293 |
| 17 | 3300046454 | Ga0495592_0006091 | Ga0495592_0006091_3783_4664 | 293 |
| 18 | 3300046476 | Ga0495662_0008673 | Ga0495662_0008673_843_1724 | 293 |
| 19 | 3300046511 | Ga0495608_0000872 | Ga0495608_0000872_19256_20137 | 293 |
| 20 | 3300046516 | Ga0495628_0009119 | Ga0495628_0009119_2076_2957 | 293 |
| 21 | 3300046517 | Ga0495630_0043664 | Ga0495630_0043664_2055_2936 | 293 |
| 22 | 3300046533 | Ga0495640_0032981 | Ga0495640_0032981_2321_3202 | 293 |
| 23 | 3300046535 | Ga0495586_0000095 | Ga0495586_0000095_15635_16516 | 293 |
| 24 | 3300046536 | Ga0495587_0015672 | Ga0495587_0015672_120_1001 | 293 |
| 25 | 3300046543 | Ga0495645_0060991 | Ga0495645_0060991_813_1694 | 293 |
| 26 | 3300046642 | Ga0495634_0004554 | Ga0495634_0004554_2438_3319 | 293 |
| 27 | 3300046690 | Ga0495624_0114049 | Ga0495624_0114049_87_968 | 293 |
| 28 | 3300046809 | Ga0495600_0030905 | Ga0495600_0030905_114_995 | 293 |
| 29 | 3300047315 | Ga0495581_0061068 | Ga0495581_0061068_865_1746 | 293 |
| 30 | 3300047317 | Ga0495604_0012342 | Ga0495604_0012342_1619_2500 | 293 |
| 31 | 3300047322 | Ga0495680_0002031 | Ga0495680_0002031_13237_14118 | 293 |
| 32 | 3300047673 | Ga0495593_0044714 | Ga0495593_0044714_459_1340 | 293 |
| 33 | 3300050512 | nmdc:mga0n895_1415_c1 | nmdc:mga0n895_1415_c1_3511_4392 | 293 |
| 34 | 3300053077 | Ga0495601_0025966 | Ga0495601_0025966_956_1837 | 293 |
| 35 | 3300005334 | Ga0068869_100337675 | Ga0068869_1003376751 | 298 |
| 36 | 3300046660 | Ga0495625_0155112 | Ga0495625_0155112_518_1501 | 298 |
| 37 | 3300006914 | Ga0075436_100019957 | Ga0075436_1000199571 | 299 |
| 38 | 3300006946 | Ga0079104_1000020 | Ga0079104_1000020211 | 299 |
| 39 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002536 | 299 |
| 40 | 3300009092 | Ga0105250_10001151 | Ga0105250_1000115113 | 300 |
| 41 | 3300009148 | Ga0105243_10012332 | Ga0105243_100123324 | 300 |
| 42 | 3300025935 | Ga0207709_10000055 | Ga0207709_10000055100 | 300 |
| 43 | 3300013306 | Ga0163162_10598055 | Ga0163162_105980552 | 302 |
| 44 | 3300050494 | nmdc:mga06z11_3297_c1 | nmdc:mga06z11_3297_c1_4137_5108 | 302 |
| 45 | 3300006852 | Ga0075433_10126086 | Ga0075433_101260862 | 303 |
| 46 | 3300006871 | Ga0075434_100000002 | Ga0075434_10000000210 | 303 |
| 47 | 3300007076 | Ga0075435_100002074 | Ga0075435_1000020746 | 303 |
| 48 | 3300050512 | nmdc:mga0n895_1173_c1 | nmdc:mga0n895_1173_c1_17066_18034 | 303 |
| 49 | 3300050513 | nmdc:mga0rr50_331_c1 | nmdc:mga0rr50_331_c1_23440_24408 | 303 |
| 50 | 3300050515 | nmdc:mga0a205_68568_c1 | nmdc:mga0a205_68568_c1_553_1521 | 303 |
| 51 | 3300026142 | Ga0207698_10061372 | Ga0207698_100613722 | 306 |
| 52 | 3300032002 | Ga0307416_100088314 | Ga0307416_1000883142 | 306 |
| 53 | 3300006914 | Ga0075436_100000048 | Ga0075436_10000004865 | 308 |
| 54 | 3300031852 | Ga0307410_10037078 | Ga0307410_100370781 | 308 |
| 55 | 3300031901 | Ga0307406_10091825 | Ga0307406_100918252 | 308 |
| 56 | 3300031995 | Ga0307409_100008371 | Ga0307409_1000083716 | 308 |
| 57 | 3300050514 | nmdc:mga08x19_348_c1 | nmdc:mga08x19_348_c1_13977_14945 | 308 |
| 58 | 3300006871 | Ga0075434_100031752 | Ga0075434_1000317523 | 309 |
| 59 | 3300006914 | Ga0075436_100002045 | Ga0075436_1000020453 | 309 |
| 60 | 3300009551 | Ga0105238_10302891 | Ga0105238_103028912 | 309 |
| 61 | 3300025924 | Ga0207694_10150915 | Ga0207694_101509152 | 309 |
| 62 | 3300031548 | Ga0307408_100158517 | Ga0307408_1001585172 | 309 |
| 63 | 3300050512 | nmdc:mga0n895_153011_c1 | nmdc:mga0n895_153011_c1_1356_2327 | 309 |
| 64 | 3300050514 | nmdc:mga08x19_1633_c1 | nmdc:mga08x19_1633_c1_10870_11883 | 309 |
| 65 | 3300031548 | Ga0307408_100212431 | Ga0307408_1002124311 | 310 |
| 66 | 3300005437 | Ga0070710_10034758 | Ga0070710_100347584 | 312 |
| 67 | 3300009176 | Ga0105242_10053206 | Ga0105242_100532062 | 312 |
| 68 | 3300005354 | Ga0070675_100265170 | Ga0070675_1002651701 | 313 |
| 69 | 3300005843 | Ga0068860_100238734 | Ga0068860_1002387341 | 313 |
| 70 | 3300005844 | Ga0068862_100214369 | Ga0068862_1002143691 | 313 |
| 71 | 3300006871 | Ga0075434_100028968 | Ga0075434_1000289682 | 313 |
| 72 | 3300005546 | Ga0070696_100086641 | Ga0070696_1000866412 | 314 |
| 73 | 3300005615 | Ga0070702_100015381 | Ga0070702_1000153812 | 314 |
| 74 | 3300009098 | Ga0105245_10115514 | Ga0105245_101155142 | 314 |
| 75 | 3300009176 | Ga0105242_10004701 | Ga0105242_100047015 | 314 |
| 76 | 3300025927 | Ga0207687_10169528 | Ga0207687_101695281 | 314 |
| 77 | 3300025934 | Ga0207686_10021005 | Ga0207686_100210053 | 314 |
| 78 | 3300046537 | Ga0495598_0031979 | Ga0495598_0031979_13_969 | 314 |
| 79 | 3300005330 | Ga0070690_100018246 | Ga0070690_1000182463 | 315 |
| 80 | 3300006358 | Ga0068871_100040766 | Ga0068871_1000407664 | 315 |
| 81 | 3300009177 | Ga0105248_10310534 | Ga0105248_103105343 | 315 |
| 82 | 3300014969 | Ga0157376_10004616 | Ga0157376_100046168 | 315 |
| 83 | 3300025941 | Ga0207711_10452859 | Ga0207711_104528591 | 315 |
| 84 | 3300025986 | Ga0207658_10188378 | Ga0207658_101883783 | 315 |
| 85 | 3300044673 | Ga0453683_0138840 | Ga0453683_0138840_121_1083 | 315 |
| 86 | 3300050514 | nmdc:mga08x19_10505_c1 | nmdc:mga08x19_10505_c1_2646_3596 | 316 |
| 87 | 3300048920 | Ga0496117_0009184 | Ga0496117_0009184_1778_2755 | 317 |
| 88 | 3300048921 | Ga0496118_0034226 | Ga0496118_0034226_1901_2878 | 317 |
| 89 | 3300048922 | Ga0496119_0025766 | Ga0496119_0025766_904_1881 | 317 |
| 90 | 3300048927 | Ga0496124_0000104 | Ga0496124_0000104_72469_73446 | 317 |
| 91 | 3300048928 | Ga0496125_0027922 | Ga0496125_0027922_775_1752 | 317 |
| 92 | 3300048928 | Ga0496125_0206808 | Ga0496125_0206808_264_1241 | 317 |
| 93 | iso_pu_bacteria | 2855730933 | 2855736085 | 317 |
| 94 | iso_pu_bacteria | 2855767633 | 2855773022 | 317 |
| 95 | 3300005295 | Ga0065707_10101908 | Ga0065707_101019083 | 318 |
| 96 | 3300006847 | Ga0075431_100308625 | Ga0075431_1003086252 | 318 |
| 97 | 3300006880 | Ga0075429_100015900 | Ga0075429_1000159002 | 318 |
| 98 | 3300009147 | Ga0114129_10124555 | Ga0114129_101245553 | 318 |
| 99 | 3300025912 | Ga0207707_10000946 | Ga0207707_1000094614 | 318 |
| 100 | 3300025921 | Ga0207652_10052696 | Ga0207652_100526965 | 318 |
| 101 | 3300048907 | Ga0496104_0003588 | Ga0496104_0003588_189_1148 | 318 |
| 102 | 3300048908 | Ga0496105_0007676 | Ga0496105_0007676_5064_6023 | 318 |
| 103 | 3300048909 | Ga0496106_0254242 | Ga0496106_0254242_273_1232 | 318 |
| 104 | 3300049583 | Ga0501067_0038149 | Ga0501067_0038149_1141_2097 | 318 |
| 105 | 3300050507 | nmdc:mga05p37_260850_c1 | nmdc:mga05p37_260850_c1_188_1150 | 318 |
| 106 | 3300027543 | Ga0209999_1007387 | Ga0209999_10073872 | 319 |
| 107 | 3300035207 | Ga0373942_0004077 | Ga0373942_0004077_1722_2690 | 319 |
| 108 | 3300005336 | Ga0070680_100023752 | Ga0070680_1000237522 | 320 |
| 109 | 3300005444 | Ga0070694_100209294 | Ga0070694_1002092942 | 320 |
| 110 | 3300005545 | Ga0070695_100014134 | Ga0070695_1000141343 | 320 |
| 111 | 3300005549 | Ga0070704_100103958 | Ga0070704_1001039582 | 320 |
| 112 | 3300005549 | Ga0070704_100299382 | Ga0070704_1002993822 | 320 |
| 113 | 3300005617 | Ga0068859_100109634 | Ga0068859_1001096342 | 320 |
| 114 | 3300006931 | Ga0097620_100109629 | Ga0097620_1001096292 | 320 |
| 115 | 3300013306 | Ga0163162_10193361 | Ga0163162_101933613 | 320 |
| 116 | 3300031995 | Ga0307409_100160367 | Ga0307409_1001603673 | 320 |
| 117 | 3300042001 | Ga0439441_003362 | Ga0439441_003362_152_1120 | 320 |
| 118 | 3300047320 | Ga0495672_0076042 | Ga0495672_0076042_18_980 | 320 |
| 119 | 3300049575 | Ga0501039_0185451 | Ga0501039_0185451_183_1151 | 320 |
| 120 | 3300049741 | Ga0501079_0120179 | Ga0501079_0120179_760_1728 | 320 |
| 121 | 3300060353 | Ga0501082_0292785 | Ga0501082_0292785_310_1278 | 320 |
| 122 | iso_pu_bacteria | 2721755523 | 2722885987 | 320 |
| 123 | iso_pu_bacteria | 2839138175 | 2839142697 | 320 |
| 124 | 3300005330 | Ga0070690_100059078 | Ga0070690_1000590782 | 321 |
| 125 | 3300005334 | Ga0068869_100000502 | Ga0068869_10000050221 | 321 |
| 126 | 3300005335 | Ga0070666_10074638 | Ga0070666_100746382 | 321 |
| 127 | 3300005336 | Ga0070680_100000089 | Ga0070680_10000008939 | 321 |
| 128 | 3300005337 | Ga0070682_100002252 | Ga0070682_10000225211 | 321 |
| 129 | 3300005338 | Ga0068868_100211937 | Ga0068868_1002119372 | 321 |
| 130 | 3300005340 | Ga0070689_100002936 | Ga0070689_1000029363 | 321 |
| 131 | 3300005341 | Ga0070691_10000090 | Ga0070691_1000009013 | 321 |
| 132 | 3300005354 | Ga0070675_100314745 | Ga0070675_1003147451 | 321 |
| 133 | 3300005364 | Ga0070673_100309226 | Ga0070673_1003092262 | 321 |
| 134 | 3300005365 | Ga0070688_100035013 | Ga0070688_1000350131 | 321 |
| 135 | 3300005435 | Ga0070714_100147710 | Ga0070714_1001477102 | 321 |
| 136 | 3300005438 | Ga0070701_10000812 | Ga0070701_1000081210 | 321 |
| 137 | 3300005440 | Ga0070705_100021947 | Ga0070705_1000219473 | 321 |
| 138 | 3300005441 | Ga0070700_100007592 | Ga0070700_1000075927 | 321 |
| 139 | 3300005444 | Ga0070694_100038194 | Ga0070694_1000381943 | 321 |
| 140 | 3300005444 | Ga0070694_100133944 | Ga0070694_1001339441 | 321 |
| 141 | 3300005445 | Ga0070708_100356251 | Ga0070708_1003562512 | 321 |
| 142 | 3300005457 | Ga0070662_100208214 | Ga0070662_1002082142 | 321 |
| 143 | 3300005458 | Ga0070681_10000283 | Ga0070681_1000028326 | 321 |
| 144 | 3300005459 | Ga0068867_100001413 | Ga0068867_10000141319 | 321 |
| 145 | 3300005467 | Ga0070706_100415711 | Ga0070706_1004157111 | 321 |
| 146 | 3300005530 | Ga0070679_100066906 | Ga0070679_1000669064 | 321 |
| 147 | 3300005530 | Ga0070679_100085010 | Ga0070679_1000850101 | 321 |
| 148 | 3300005536 | Ga0070697_100026559 | Ga0070697_1000265594 | 321 |
| 149 | 3300005539 | Ga0068853_100073699 | Ga0068853_1000736993 | 321 |
| 150 | 3300005545 | Ga0070695_100002400 | Ga0070695_1000024003 | 321 |
| 151 | 3300005546 | Ga0070696_100002203 | Ga0070696_10000220312 | 321 |
| 152 | 3300005546 | Ga0070696_100010522 | Ga0070696_1000105227 | 321 |
| 153 | 3300005547 | Ga0070693_100000477 | Ga0070693_10000047719 | 321 |
| 154 | 3300005549 | Ga0070704_100000091 | Ga0070704_10000009137 | 321 |
| 155 | 3300005563 | Ga0068855_100006008 | Ga0068855_10000600814 | 321 |
| 156 | 3300005563 | Ga0068855_100096204 | Ga0068855_1000962045 | 321 |
| 157 | 3300005578 | Ga0068854_100010099 | Ga0068854_1000100992 | 321 |
| 158 | 3300005615 | Ga0070702_100207491 | Ga0070702_1002074911 | 321 |
| 159 | 3300005616 | Ga0068852_100022271 | Ga0068852_1000222713 | 321 |
| 160 | 3300005617 | Ga0068859_100269579 | Ga0068859_1002695792 | 321 |
| 161 | 3300005718 | Ga0068866_10000144 | Ga0068866_1000014438 | 321 |
| 162 | 3300005719 | Ga0068861_100346539 | Ga0068861_1003465391 | 321 |
| 163 | 3300005842 | Ga0068858_100005045 | Ga0068858_1000050452 | 321 |
| 164 | 3300005843 | Ga0068860_100168771 | Ga0068860_1001687711 | 321 |
| 165 | 3300005844 | Ga0068862_100038361 | Ga0068862_1000383613 | 321 |
| 166 | 3300006358 | Ga0068871_100000744 | Ga0068871_10000074413 | 321 |
| 167 | 3300006844 | Ga0075428_100007605 | Ga0075428_10000760510 | 321 |
| 168 | 3300006844 | Ga0075428_100064946 | Ga0075428_1000649463 | 321 |
| 169 | 3300006846 | Ga0075430_100008291 | Ga0075430_1000082912 | 321 |
| 170 | 3300006847 | Ga0075431_100098911 | Ga0075431_1000989113 | 321 |
| 171 | 3300006871 | Ga0075434_100024723 | Ga0075434_1000247232 | 321 |
| 172 | 3300006880 | Ga0075429_100018749 | Ga0075429_1000187497 | 321 |
| 173 | 3300006880 | Ga0075429_100200652 | Ga0075429_1002006522 | 321 |
| 174 | 3300006881 | Ga0068865_100000710 | Ga0068865_10000071018 | 321 |
| 175 | 3300006914 | Ga0075436_100104651 | Ga0075436_1001046512 | 321 |
| 176 | 3300006931 | Ga0097620_100269599 | Ga0097620_1002695992 | 321 |
| 177 | 3300007076 | Ga0075435_100045325 | Ga0075435_1000453254 | 321 |
| 178 | 3300009093 | Ga0105240_10111676 | Ga0105240_101116763 | 321 |
| 179 | 3300009094 | Ga0111539_10012223 | Ga0111539_1001222312 | 321 |
| 180 | 3300009098 | Ga0105245_10141091 | Ga0105245_101410912 | 321 |
| 181 | 3300009147 | Ga0114129_10090272 | Ga0114129_100902723 | 321 |
| 182 | 3300009148 | Ga0105243_10024763 | Ga0105243_100247635 | 321 |
| 183 | 3300009174 | Ga0105241_10008217 | Ga0105241_100082177 | 321 |
| 184 | 3300009176 | Ga0105242_10001851 | Ga0105242_100018513 | 321 |
| 185 | 3300009551 | Ga0105238_10326800 | Ga0105238_103268001 | 321 |
| 186 | 3300009553 | Ga0105249_10000917 | Ga0105249_100009173 | 321 |
| 187 | 3300013105 | Ga0157369_10039287 | Ga0157369_100392875 | 321 |
| 188 | 3300013297 | Ga0157378_10003846 | Ga0157378_1000384612 | 321 |
| 189 | 3300013307 | Ga0157372_10011322 | Ga0157372_100113229 | 321 |
| 190 | 3300014968 | Ga0157379_10017026 | Ga0157379_100170262 | 321 |
| 191 | 3300014969 | Ga0157376_10057308 | Ga0157376_100573082 | 321 |
| 192 | 3300025899 | Ga0207642_10003770 | Ga0207642_100037705 | 321 |
| 193 | 3300025909 | Ga0207705_10174717 | Ga0207705_101747171 | 321 |
| 194 | 3300025910 | Ga0207684_10393137 | Ga0207684_103931372 | 321 |
| 195 | 3300025911 | Ga0207654_10047529 | Ga0207654_100475292 | 321 |
| 196 | 3300025913 | Ga0207695_10135404 | Ga0207695_101354041 | 321 |
| 197 | 3300025917 | Ga0207660_10002436 | Ga0207660_100024362 | 321 |
| 198 | 3300025918 | Ga0207662_10001703 | Ga0207662_1000170312 | 321 |
| 199 | 3300025921 | Ga0207652_10166428 | Ga0207652_101664283 | 321 |
| 200 | 3300025921 | Ga0207652_10254287 | Ga0207652_102542872 | 321 |
| 201 | 3300025923 | Ga0207681_10362096 | Ga0207681_103620961 | 321 |
| 202 | 3300025924 | Ga0207694_10138555 | Ga0207694_101385552 | 321 |
| 203 | 3300025926 | Ga0207659_10254141 | Ga0207659_102541412 | 321 |
| 204 | 3300025927 | Ga0207687_10032123 | Ga0207687_100321231 | 321 |
| 205 | 3300025929 | Ga0207664_10103618 | Ga0207664_101036182 | 321 |
| 206 | 3300025929 | Ga0207664_10131527 | Ga0207664_101315272 | 321 |
| 207 | 3300025932 | Ga0207690_10050338 | Ga0207690_100503382 | 321 |
| 208 | 3300025934 | Ga0207686_10107283 | Ga0207686_101072832 | 321 |
| 209 | 3300025935 | Ga0207709_10001315 | Ga0207709_1000131513 | 321 |
| 210 | 3300025938 | Ga0207704_10000483 | Ga0207704_100004833 | 321 |
| 211 | 3300025942 | Ga0207689_10000544 | Ga0207689_1000054438 | 321 |
| 212 | 3300025949 | Ga0207667_10008307 | Ga0207667_100083073 | 321 |
| 213 | 3300025949 | Ga0207667_10151663 | Ga0207667_101516631 | 321 |
| 214 | 3300026023 | Ga0207677_10003254 | Ga0207677_100032548 | 321 |
| 215 | 3300026041 | Ga0207639_10070031 | Ga0207639_100700312 | 321 |
| 216 | 3300026041 | Ga0207639_10175025 | Ga0207639_101750251 | 321 |
| 217 | 3300026075 | Ga0207708_10000417 | Ga0207708_100004174 | 321 |
| 218 | 3300026078 | Ga0207702_10195396 | Ga0207702_101953961 | 321 |
| 219 | 3300026078 | Ga0207702_10552167 | Ga0207702_105521671 | 321 |
| 220 | 3300026089 | Ga0207648_10000135 | Ga0207648_1000013538 | 321 |
| 221 | 3300026118 | Ga0207675_100000825 | Ga0207675_10000082536 | 321 |
| 222 | 3300027462 | Ga0210000_1009180 | Ga0210000_10091801 | 321 |
| 223 | 3300028380 | Ga0268265_10002564 | Ga0268265_1000256415 | 321 |
| 224 | 3300028381 | Ga0268264_10112365 | Ga0268264_101123651 | 321 |
| 225 | 3300031852 | Ga0307410_10131230 | Ga0307410_101312301 | 321 |
| 226 | 3300031995 | Ga0307409_100101388 | Ga0307409_1001013882 | 321 |
| 227 | 3300035117 | Ga0373953_0004053 | Ga0373953_0004053_612_1583 | 321 |
| 228 | 3300035118 | Ga0373954_0009550 | Ga0373954_0009550_1117_2088 | 321 |
| 229 | 3300035172 | Ga0373955_0004737 | Ga0373955_0004737_3205_4176 | 321 |
| 230 | 3300035241 | Ga0373961_0033037 | Ga0373961_0033037_133_1149 | 321 |
| 231 | 3300035410 | Ga0373924_0005706 | Ga0373924_0005706_503_1510 | 321 |
| 232 | 3300035410 | Ga0373924_0015060 | Ga0373924_0015060_208_1179 | 321 |
| 233 | 3300035724 | Ga0373933_0002915 | Ga0373933_0002915_2304_3275 | 321 |
| 234 | 3300035724 | Ga0373933_0074896 | Ga0373933_0074896_42_1049 | 321 |
| 235 | 3300036401 | Ga0373937_0005397 | Ga0373937_0005397_1306_2277 | 321 |
| 236 | 3300037418 | Ga0395900_0039408 | Ga0395900_0039408_3173_4138 | 321 |
| 237 | 3300037471 | Ga0395905_0016916 | Ga0395905_0016916_3094_4059 | 321 |
| 238 | 3300042001 | Ga0439441_001479 | Ga0439441_001479_1979_2950 | 321 |
| 239 | 3300042532 | Ga0450893_0005239 | Ga0450893_0005239_833_1810 | 321 |
| 240 | 3300046559 | Ga0495667_0104906 | Ga0495667_0104906_637_1608 | 321 |
| 241 | 3300047322 | Ga0495680_0055026 | Ga0495680_0055026_1640_2647 | 321 |
| 242 | 3300048909 | Ga0496106_0133240 | Ga0496106_0133240_608_1582 | 321 |
| 243 | 3300049574 | Ga0501038_0309716 | Ga0501038_0309716_75_1040 | 321 |
| 244 | 3300049577 | Ga0501041_0038024 | Ga0501041_0038024_1530_2495 | 321 |
| 245 | 3300049580 | Ga0501046_0128695 | Ga0501046_0128695_798_1763 | 321 |
| 246 | 3300049582 | Ga0501048_0012576 | Ga0501048_0012576_3975_4940 | 321 |
| 247 | 3300049587 | Ga0501071_0036845 | Ga0501071_0036845_401_1366 | 321 |
| 248 | 3300049588 | Ga0501072_0025746 | Ga0501072_0025746_1577_2542 | 321 |
| 249 | 3300049588 | Ga0501072_0162535 | Ga0501072_0162535_401_1366 | 321 |
| 250 | 3300049591 | Ga0501075_0002559 | Ga0501075_0002559_3323_4288 | 321 |
| 251 | 3300049592 | Ga0501076_0001216 | Ga0501076_0001216_2614_3579 | 321 |
| 252 | 3300049592 | Ga0501076_0108829 | Ga0501076_0108829_129_1094 | 321 |
| 253 | 3300049593 | Ga0501077_0059122 | Ga0501077_0059122_1174_2139 | 321 |
| 254 | 3300049741 | Ga0501079_0018141 | Ga0501079_0018141_825_1790 | 321 |
| 255 | 3300049742 | Ga0501080_0152798 | Ga0501080_0152798_476_1441 | 321 |
| 256 | 3300049742 | Ga0501080_0336860 | Ga0501080_0336860_49_1020 | 321 |
| 257 | 3300049743 | Ga0501081_0015886 | Ga0501081_0015886_87_1052 | 321 |
| 258 | 3300049824 | Ga0501045_0023747 | Ga0501045_0023747_3219_4184 | 321 |
| 259 | 3300050490 | nmdc:mga03n38_2941_c1 | nmdc:mga03n38_2941_c1_698_1699 | 321 |
| 260 | 3300050508 | nmdc:mga09592_16177_c1 | nmdc:mga09592_16177_c1_442_1413 | 321 |
| 261 | 3300050509 | nmdc:mga0qj67_121991_c1 | nmdc:mga0qj67_121991_c1_940_1911 | 321 |
| 262 | 3300050510 | nmdc:mga06r32_23107_c1 | nmdc:mga06r32_23107_c1_2658_3629 | 321 |
| 263 | 3300050511 | nmdc:mga08y16_25146_c1 | nmdc:mga08y16_25146_c1_5215_6186 | 321 |
| 264 | 3300050511 | nmdc:mga08y16_485529_c1 | nmdc:mga08y16_485529_c1_133_1098 | 321 |
| 265 | 3300050512 | nmdc:mga0n895_100775_c1 | nmdc:mga0n895_100775_c1_1065_2030 | 321 |
| 266 | 3300050512 | nmdc:mga0n895_1513_c1 | nmdc:mga0n895_1513_c1_12027_12992 | 321 |
| 267 | 3300050512 | nmdc:mga0n895_206333_c1 | nmdc:mga0n895_206333_c1_327_1292 | 321 |
| 268 | 3300050513 | nmdc:mga0rr50_11180_c1 | nmdc:mga0rr50_11180_c1_4685_5650 | 321 |
| 269 | 3300050513 | nmdc:mga0rr50_337053_c1 | nmdc:mga0rr50_337053_c1_123_1088 | 321 |
| 270 | 3300050514 | nmdc:mga08x19_852_c1 | nmdc:mga08x19_852_c1_9048_10013 | 321 |
| 271 | 3300050515 | nmdc:mga0a205_101487_c1 | nmdc:mga0a205_101487_c1_1300_2265 | 321 |
| 272 | 3300050515 | nmdc:mga0a205_242_c2 | nmdc:mga0a205_242_c2_3983_4948 | 321 |
| 273 | 3300060353 | Ga0501082_0015865 | Ga0501082_0015865_859_1824 | 321 |
| 274 | 3300061734 | Ga0530510_0002366 | Ga0530510_0002366_8066_9031 | 321 |
| 275 | 3300005327 | Ga0070658_10145288 | Ga0070658_101452882 | 322 |
| 276 | 3300005334 | Ga0068869_100218511 | Ga0068869_1002185111 | 322 |
| 277 | 3300005336 | Ga0070680_100165724 | Ga0070680_1001657242 | 322 |
| 278 | 3300005343 | Ga0070687_100060478 | Ga0070687_1000604783 | 322 |
| 279 | 3300005347 | Ga0070668_100012128 | Ga0070668_1000121283 | 322 |
| 280 | 3300005353 | Ga0070669_100002477 | Ga0070669_10000247710 | 322 |
| 281 | 3300005356 | Ga0070674_100036956 | Ga0070674_1000369564 | 322 |
| 282 | 3300005438 | Ga0070701_10003664 | Ga0070701_100036642 | 322 |
| 283 | 3300005438 | Ga0070701_10094633 | Ga0070701_100946331 | 322 |
| 284 | 3300005438 | Ga0070701_10110247 | Ga0070701_101102472 | 322 |
| 285 | 3300005441 | Ga0070700_100001359 | Ga0070700_1000013592 | 322 |
| 286 | 3300005441 | Ga0070700_100186456 | Ga0070700_1001864562 | 322 |
| 287 | 3300005444 | Ga0070694_100035228 | Ga0070694_1000352282 | 322 |
| 288 | 3300005459 | Ga0068867_100003697 | Ga0068867_1000036972 | 322 |
| 289 | 3300005471 | Ga0070698_100592249 | Ga0070698_1005922491 | 322 |
| 290 | 3300005530 | Ga0070679_100072090 | Ga0070679_1000720903 | 322 |
| 291 | 3300005536 | Ga0070697_100011628 | Ga0070697_1000116282 | 322 |
| 292 | 3300005543 | Ga0070672_100447304 | Ga0070672_1004473041 | 322 |
| 293 | 3300005544 | Ga0070686_100150481 | Ga0070686_1001504811 | 322 |
| 294 | 3300005547 | Ga0070693_100084737 | Ga0070693_1000847372 | 322 |
| 295 | 3300005563 | Ga0068855_100220413 | Ga0068855_1002204132 | 322 |
| 296 | 3300005614 | Ga0068856_100224781 | Ga0068856_1002247812 | 322 |
| 297 | 3300005617 | Ga0068859_100053262 | Ga0068859_1000532623 | 322 |
| 298 | 3300005617 | Ga0068859_100064703 | Ga0068859_1000647031 | 322 |
| 299 | 3300005719 | Ga0068861_100002139 | Ga0068861_10000213911 | 322 |
| 300 | 3300005719 | Ga0068861_100125159 | Ga0068861_1001251592 | 322 |
| 301 | 3300005719 | Ga0068861_100193593 | Ga0068861_1001935932 | 322 |
| 302 | 3300005840 | Ga0068870_10103824 | Ga0068870_101038241 | 322 |
| 303 | 3300005842 | Ga0068858_100130674 | Ga0068858_1001306743 | 322 |
| 304 | 3300005844 | Ga0068862_100003743 | Ga0068862_1000037432 | 322 |
| 305 | 3300005844 | Ga0068862_100065330 | Ga0068862_1000653302 | 322 |
| 306 | 3300005844 | Ga0068862_100490369 | Ga0068862_1004903691 | 322 |
| 307 | 3300005985 | Ga0081539_10013580 | Ga0081539_100135803 | 322 |
| 308 | 3300006847 | Ga0075431_100217597 | Ga0075431_1002175972 | 322 |
| 309 | 3300006852 | Ga0075433_10001605 | Ga0075433_100016054 | 322 |
| 310 | 3300006871 | Ga0075434_100000018 | Ga0075434_10000001871 | 322 |
| 311 | 3300006871 | Ga0075434_100019670 | Ga0075434_1000196704 | 322 |
| 312 | 3300006881 | Ga0068865_100001000 | Ga0068865_1000010003 | 322 |
| 313 | 3300006881 | Ga0068865_100163935 | Ga0068865_1001639352 | 322 |
| 314 | 3300006914 | Ga0075436_100000651 | Ga0075436_10000065112 | 322 |
| 315 | 3300006914 | Ga0075436_100031098 | Ga0075436_1000310982 | 322 |
| 316 | 3300006931 | Ga0097620_100053258 | Ga0097620_1000532583 | 322 |
| 317 | 3300006931 | Ga0097620_100064705 | Ga0097620_1000647054 | 322 |
| 318 | 3300007076 | Ga0075435_100003818 | Ga0075435_1000038183 | 322 |
| 319 | 3300007076 | Ga0075435_100089166 | Ga0075435_1000891664 | 322 |
| 320 | 3300007265 | Ga0099794_10010056 | Ga0099794_100100563 | 322 |
| 321 | 3300009094 | Ga0111539_10022400 | Ga0111539_100224004 | 322 |
| 322 | 3300009094 | Ga0111539_10085218 | Ga0111539_100852183 | 322 |
| 323 | 3300009094 | Ga0111539_10101494 | Ga0111539_101014942 | 322 |
| 324 | 3300009148 | Ga0105243_10007953 | Ga0105243_100079537 | 322 |
| 325 | 3300009553 | Ga0105249_10019752 | Ga0105249_100197524 | 322 |
| 326 | 3300013307 | Ga0157372_10276253 | Ga0157372_102762532 | 322 |
| 327 | 3300014326 | Ga0157380_10018792 | Ga0157380_100187923 | 322 |
| 328 | 3300014326 | Ga0157380_10090997 | Ga0157380_100909972 | 322 |
| 329 | 3300014745 | Ga0157377_10068774 | Ga0157377_100687743 | 322 |
| 330 | 3300025901 | Ga0207688_10137690 | Ga0207688_101376901 | 322 |
| 331 | 3300025908 | Ga0207643_10060785 | Ga0207643_100607853 | 322 |
| 332 | 3300025909 | Ga0207705_10028530 | Ga0207705_100285304 | 322 |
| 333 | 3300025912 | Ga0207707_10087581 | Ga0207707_100875813 | 322 |
| 334 | 3300025918 | Ga0207662_10085374 | Ga0207662_100853742 | 322 |
| 335 | 3300025921 | Ga0207652_10045929 | Ga0207652_100459292 | 322 |
| 336 | 3300025923 | Ga0207681_10000560 | Ga0207681_100005607 | 322 |
| 337 | 3300025926 | Ga0207659_10349507 | Ga0207659_103495071 | 322 |
| 338 | 3300025933 | Ga0207706_10032207 | Ga0207706_100322074 | 322 |
| 339 | 3300025935 | Ga0207709_10006652 | Ga0207709_100066523 | 322 |
| 340 | 3300025936 | Ga0207670_10180339 | Ga0207670_101803392 | 322 |
| 341 | 3300025936 | Ga0207670_10345340 | Ga0207670_103453401 | 322 |
| 342 | 3300025938 | Ga0207704_10005835 | Ga0207704_100058354 | 322 |
| 343 | 3300025940 | Ga0207691_10301948 | Ga0207691_103019483 | 322 |
| 344 | 3300025942 | Ga0207689_10226505 | Ga0207689_102265053 | 322 |
| 345 | 3300025949 | Ga0207667_10433110 | Ga0207667_104331102 | 322 |
| 346 | 3300025961 | Ga0207712_10009220 | Ga0207712_100092203 | 322 |
| 347 | 3300025972 | Ga0207668_10008527 | Ga0207668_100085273 | 322 |
| 348 | 3300026035 | Ga0207703_10490266 | Ga0207703_104902662 | 322 |
| 349 | 3300026075 | Ga0207708_10001699 | Ga0207708_100016997 | 322 |
| 350 | 3300026075 | Ga0207708_10446243 | Ga0207708_104462431 | 322 |
| 351 | 3300026078 | Ga0207702_10183810 | Ga0207702_101838102 | 322 |
| 352 | 3300026088 | Ga0207641_10242265 | Ga0207641_102422652 | 322 |
| 353 | 3300026089 | Ga0207648_10007396 | Ga0207648_100073967 | 322 |
| 354 | 3300026089 | Ga0207648_10315605 | Ga0207648_103156052 | 322 |
| 355 | 3300026118 | Ga0207675_100004922 | Ga0207675_1000049222 | 322 |
| 356 | 3300026118 | Ga0207675_100107279 | Ga0207675_1001072792 | 322 |
| 357 | 3300026118 | Ga0207675_100234989 | Ga0207675_1002349891 | 322 |
| 358 | 3300027378 | Ga0209981_1008566 | Ga0209981_10085662 | 322 |
| 359 | 3300027907 | Ga0207428_10088842 | Ga0207428_100888422 | 322 |
| 360 | 3300027907 | Ga0207428_10204260 | Ga0207428_102042602 | 322 |
| 361 | 3300027907 | Ga0207428_10220634 | Ga0207428_102206342 | 322 |
| 362 | 3300028380 | Ga0268265_10001299 | Ga0268265_100012993 | 322 |
| 363 | 3300028380 | Ga0268265_10166676 | Ga0268265_101666762 | 322 |
| 364 | 3300032002 | Ga0307416_100040135 | Ga0307416_1000401353 | 322 |
| 365 | 3300032002 | Ga0307416_100257839 | Ga0307416_1002578392 | 322 |
| 366 | 3300035083 | Ga0373926_0020142 | Ga0373926_0020142_825_1799 | 322 |
| 367 | 3300035086 | Ga0373934_0018376 | Ga0373934_0018376_1033_2007 | 322 |
| 368 | 3300035089 | Ga0373944_0004604 | Ga0373944_0004604_483_1457 | 322 |
| 369 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_4969_5943 | 322 |
| 370 | 3300035121 | Ga0373960_0007090 | Ga0373960_0007090_1154_2125 | 322 |
| 371 | 3300035171 | Ga0373946_0060644 | Ga0373946_0060644_491_1465 | 322 |
| 372 | 3300035410 | Ga0373924_0019445 | Ga0373924_0019445_26_1000 | 322 |
| 373 | 3300035691 | Ga0373931_0102466 | Ga0373931_0102466_339_1307 | 322 |
| 374 | 3300035695 | Ga0373927_0004990 | Ga0373927_0004990_3499_4473 | 322 |
| 375 | 3300036401 | Ga0373937_0000775 | Ga0373937_0000775_9612_10586 | 322 |
| 376 | 3300037068 | Ga0373925_0014061 | Ga0373925_0014061_802_1776 | 322 |
| 377 | 3300037068 | Ga0373925_0131079 | Ga0373925_0131079_145_1113 | 322 |
| 378 | 3300045976 | Ga0466967_0429597 | Ga0466967_0429597_62_1036 | 322 |
| 379 | 3300046455 | Ga0495603_0007268 | Ga0495603_0007268_1022_1996 | 322 |
| 380 | 3300046459 | Ga0495629_0216394 | Ga0495629_0216394_308_1282 | 322 |
| 381 | 3300046476 | Ga0495662_0008257 | Ga0495662_0008257_1111_2085 | 322 |
| 382 | 3300046516 | Ga0495628_0034982 | Ga0495628_0034982_467_1441 | 322 |
| 383 | 3300046526 | Ga0495666_0002191 | Ga0495666_0002191_994_1968 | 322 |
| 384 | 3300046533 | Ga0495640_0016664 | Ga0495640_0016664_792_1766 | 322 |
| 385 | 3300046535 | Ga0495586_0006745 | Ga0495586_0006745_4480_5454 | 322 |
| 386 | 3300046536 | Ga0495587_0119244 | Ga0495587_0119244_183_1157 | 322 |
| 387 | 3300046539 | Ga0495621_0002530 | Ga0495621_0002530_52_1020 | 322 |
| 388 | 3300046674 | Ga0495588_0004610 | Ga0495588_0004610_2016_2990 | 322 |
| 389 | 3300046681 | Ga0495647_0000141 | Ga0495647_0000141_12231_13205 | 322 |
| 390 | 3300046684 | Ga0495669_0006731 | Ga0495669_0006731_904_1872 | 322 |
| 391 | 3300047315 | Ga0495581_0013738 | Ga0495581_0013738_1825_2799 | 322 |
| 392 | 3300047315 | Ga0495581_0044407 | Ga0495581_0044407_287_1261 | 322 |
| 393 | 3300047319 | Ga0495674_0092592 | Ga0495674_0092592_116_1090 | 322 |
| 394 | 3300049515 | Ga0501292_012768 | Ga0501292_012768_115_1086 | 322 |
| 395 | 3300049521 | Ga0501298_003686 | Ga0501298_003686_785_1756 | 322 |
| 396 | 3300049568 | Ga0501031_0124255 | Ga0501031_0124255_305_1279 | 322 |
| 397 | 3300049572 | Ga0501036_0030889 | Ga0501036_0030889_2115_3086 | 322 |
| 398 | 3300049576 | Ga0501040_0027433 | Ga0501040_0027433_198_1169 | 322 |
| 399 | 3300049577 | Ga0501041_0018195 | Ga0501041_0018195_3128_4099 | 322 |
| 400 | 3300050507 | nmdc:mga05p37_424596_c1 | nmdc:mga05p37_424596_c1_273_1247 | 322 |
| 401 | 3300050508 | nmdc:mga09592_201508_c1 | nmdc:mga09592_201508_c1_467_1441 | 322 |
| 402 | 3300050510 | nmdc:mga06r32_167778_c1 | nmdc:mga06r32_167778_c1_1101_2069 | 322 |
| 403 | 3300050510 | nmdc:mga06r32_291214_c1 | nmdc:mga06r32_291214_c1_605_1579 | 322 |
| 404 | 3300050511 | nmdc:mga08y16_12357_c1 | nmdc:mga08y16_12357_c1_1324_2298 | 322 |
| 405 | 3300050511 | nmdc:mga08y16_134009_c1 | nmdc:mga08y16_134009_c1_1499_2473 | 322 |
| 406 | 3300050513 | nmdc:mga0rr50_25095_c1 | nmdc:mga0rr50_25095_c1_2533_3501 | 322 |
| 407 | 3300050514 | nmdc:mga08x19_31827_c1 | nmdc:mga08x19_31827_c1_2210_3178 | 322 |
| 408 | 3300005468 | Ga0070707_100476182 | Ga0070707_1004761821 | 323 |
| 409 | 3300049583 | Ga0501067_0045539 | Ga0501067_0045539_696_1679 | 323 |
| 410 | iso_pu_bacteria | 8001845381 | 8001849722 | 323 |
| 411 | 3300005289 | Ga0065704_10125558 | Ga0065704_101255583 | 324 |
| 412 | 3300005549 | Ga0070704_100016050 | Ga0070704_1000160501 | 324 |
| 413 | 3300006844 | Ga0075428_100052577 | Ga0075428_1000525775 | 324 |
| 414 | 3300006847 | Ga0075431_100002501 | Ga0075431_10000250117 | 324 |
| 415 | 3300006880 | Ga0075429_100000175 | Ga0075429_10000017543 | 324 |
| 416 | 3300009147 | Ga0114129_10167428 | Ga0114129_101674284 | 324 |
| 417 | 3300009148 | Ga0105243_10109425 | Ga0105243_101094254 | 324 |
| 418 | 3300025922 | Ga0207646_10148966 | Ga0207646_101489663 | 324 |
| 419 | 3300050507 | nmdc:mga05p37_91263_c1 | nmdc:mga05p37_91263_c1_1390_2364 | 324 |
| 420 | 3300050508 | nmdc:mga09592_12470_c1 | nmdc:mga09592_12470_c1_4210_5184 | 324 |
| 421 | 3300050510 | nmdc:mga06r32_1647_c1 | nmdc:mga06r32_1647_c1_11545_12519 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9827 | 25 | 324 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9794 | 25 | 324 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9672 | 25 | 316 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9576 | 25 | 316 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9573 | 25 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.978 | 125 | 246 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9771 | 124 | 246 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.962 | 125 | 246 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9617 | 124 | 246 | 3.40.190.10 |
| 2f5xC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9433 | 25 | 324 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3MH39-F1-model_v4 | deleted | 0.9882 | 23 | 223 |
|
| AF-V8QRH9-F1-model_v4 | ABC transporter substrate-binding protein | 0.9807 | 18 | 322 |
|
| AF-A0A1H8YFB1-F1-model_v4 | Tripartite-type tricarboxylate transporter, receptor component TctC | 0.9802 | 18 | 324 |
|
| AF-A0A257K6Z4-F1-model_v4 | Caspase family p20 domain-containing protein | 0.9799 | 23 | 226 |
GO:0004197
GO:0006508 |
| AF-A0A1B2QZA4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9767 | 23 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar