F440041

General Info

Members Datasets Scaffolds Average Seq Length
421 240 416 319

Family's Representative Sequence

Representative Sequence 3300035241|Ga0373961_0033037|Ga0373961_0033037_133_1149
Length 338
Sequence MKTTKLLALASLLAASSAMAQQYPTHAVTLMVPFAPGPTDTVARVIAQSMQKPLGQSIVVENRPSAGGILAPELVKNAKPDGYTILIHHIGMATTPALYRQLRFNPLTDFEYIGLINTVPMTLIGKQNLPPKNFKELLDYIKKNKDKVSLANAGIGAASHLCGMLFMSAIQTDLLTVPYKGTGPAMNDLIGGQVDLLCDQTTNTTGHIKGGKVKAYAVTTKQRVASLPDLPTLDEQGLKGFEVSIWHGLYAPKGTPKAAIDKLVAALQSGVKDEEVKKRFADLGATTYPPEQATPAALQAMVKSEIEKWTPLIKKAGVYADKKKQENKKAAHGRLFFG

Samples

Sample ID Description Type Environment
1 2721755523 Delftia sp. HK171 Isolate Unclassified
2 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
3 2855730933 Achromobacter sp. HZ28 Isolate Nodule
4 2855767633 Achromobacter sp. HZ34 Isolate Nodule
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
206 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0.95
Rhizoplane 0.95
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10125558 3300005289 Bacteria 1701
2 Ga0065707_10101908 3300005295 Bacteria 2838
3 Ga0070658_10145288 3300005327 Bacteria 1983
4 Ga0070690_100018246 3300005330 Bacteria 4234
5 Ga0070690_100059078 3300005330 Bacteria 2464
6 Ga0068869_100000502 3300005334 Bacteria 21805
7 Ga0068869_100218511 3300005334 Bacteria 1509
8 Ga0068869_100337675 3300005334 Bacteria 1225
9 Ga0070666_10074638 3300005335 Bacteria 2312
10 Ga0070680_100000089 3300005336 Bacteria 51222
11 Ga0070680_100023752 3300005336 Bacteria 4893
12 Ga0070680_100165724 3300005336 Bacteria 1858
13 Ga0070682_100002252 3300005337 Bacteria 10695
14 Ga0068868_100211937 3300005338 Bacteria 1619
15 Ga0070689_100002936 3300005340 Bacteria 11212
16 Ga0070691_10000090 3300005341 Bacteria 25810
17 Ga0070687_100060478 3300005343 Bacteria 1998
18 Ga0070668_100012128 3300005347 Bacteria 6419
19 Ga0070669_100002477 3300005353 Bacteria 13373
20 Ga0070675_100265170 3300005354 Bacteria 1506
21 Ga0070675_100314745 3300005354 Bacteria 1382
22 Ga0070674_100036956 3300005356 Bacteria 3282
23 Ga0070673_100309226 3300005364 Bacteria 1394
24 Ga0070688_100035013 3300005365 Bacteria 3047
25 Ga0070714_100147710 3300005435 Bacteria 2116
26 Ga0070710_10034758 3300005437 Bacteria 2744
27 Ga0070701_10000812 3300005438 Bacteria 11149
28 Ga0070701_10003664 3300005438 Bacteria 6121
29 Ga0070701_10094633 3300005438 Bacteria 1643
30 Ga0070701_10110247 3300005438 Bacteria 1537
31 Ga0070705_100021947 3300005440 Bacteria 3403
32 Ga0070700_100001359 3300005441 Bacteria 12155
33 Ga0070700_100007592 3300005441 Bacteria 5865
34 Ga0070700_100186456 3300005441 Bacteria 1447
35 Ga0070694_100035228 3300005444 Bacteria 3307
36 Ga0070694_100038194 3300005444 Bacteria 3189
37 Ga0070694_100133944 3300005444 Bacteria 1793
38 Ga0070694_100209294 3300005444 Bacteria 1458
39 Ga0070708_100356251 3300005445 Bacteria 1379
40 Ga0070662_100208214 3300005457 Bacteria 1555
41 Ga0070681_10000283 3300005458 Bacteria 40794
42 Ga0068867_100001413 3300005459 Bacteria 16602
43 Ga0068867_100003697 3300005459 Bacteria 10763
44 Ga0070706_100415711 3300005467 Bacteria 1252
45 Ga0070707_100476182 3300005468 Bacteria 1210
46 Ga0070698_100592249 3300005471 Bacteria 1049
47 Ga0070679_100066906 3300005530 Bacteria 3583
48 Ga0070679_100072090 3300005530 Bacteria 3446
49 Ga0070679_100085010 3300005530 Bacteria 3151
50 Ga0070697_100011628 3300005536 Bacteria 6879
51 Ga0070697_100026559 3300005536 Bacteria 4627
52 Ga0068853_100073699 3300005539 Bacteria 2977
53 Ga0070672_100447304 3300005543 Bacteria 1112
54 Ga0070686_100150481 3300005544 Bacteria 1629
55 Ga0070695_100002400 3300005545 Bacteria 10764
56 Ga0070695_100014134 3300005545 Bacteria 4808
57 Ga0070696_100002203 3300005546 Bacteria 12849
58 Ga0070696_100010522 3300005546 Bacteria 6200
59 Ga0070696_100086641 3300005546 Bacteria 2224
60 Ga0070693_100000477 3300005547 Bacteria 17942
61 Ga0070693_100084737 3300005547 Bacteria 1897
62 Ga0070704_100000091 3300005549 Bacteria 31281
63 Ga0070704_100016050 3300005549 Bacteria 4723
64 Ga0070704_100103958 3300005549 Bacteria 2147
65 Ga0070704_100299382 3300005549 Bacteria 1339
66 Ga0068855_100006008 3300005563 Bacteria 14806
67 Ga0068855_100096204 3300005563 Bacteria 3412
68 Ga0068855_100220413 3300005563 Bacteria 2127
69 Ga0068854_100010099 3300005578 Bacteria 6116
70 Ga0068856_100224781 3300005614 Bacteria 1892
71 Ga0070702_100015381 3300005615 Bacteria 3906
72 Ga0070702_100207491 3300005615 Bacteria 1301
73 Ga0068852_100022271 3300005616 Bacteria 5079
74 Ga0068859_100053262 3300005617 Bacteria 4069
75 Ga0068859_100064703 3300005617 Bacteria 3690
76 Ga0068859_100109634 3300005617 Bacteria 2822
77 Ga0068859_100269579 3300005617 Bacteria 1794
78 Ga0068866_10000144 3300005718 Bacteria 32128
79 Ga0068861_100002139 3300005719 Bacteria 12782
80 Ga0068861_100125159 3300005719 Bacteria 2079
81 Ga0068861_100193593 3300005719 Bacteria 1702
82 Ga0068861_100346539 3300005719 Bacteria 1301
83 Ga0068870_10103824 3300005840 Bacteria 1611
84 Ga0068858_100005045 3300005842 Bacteria 12942
85 Ga0068858_100130674 3300005842 Bacteria 2354
86 Ga0068860_100168771 3300005843 Bacteria 2113
87 Ga0068860_100238734 3300005843 Bacteria 1768
88 Ga0068862_100003743 3300005844 Bacteria 12974
89 Ga0068862_100038361 3300005844 Bacteria 4063
90 Ga0068862_100065330 3300005844 Bacteria 3133
91 Ga0068862_100133574 3300005844 Bacteria 2197
92 Ga0068862_100214369 3300005844 Bacteria 1741
93 Ga0068862_100490369 3300005844 Bacteria 1165
94 Ga0081539_10013580 3300005985 Bacteria 6124
95 Ga0075363_100048165 3300006048 Bacteria 2265
96 Ga0075367_10002211 3300006178 Bacteria 8773
97 Ga0068871_100000744 3300006358 Bacteria 22076
98 Ga0068871_100040766 3300006358 Bacteria 3720
99 Ga0075428_100007605 3300006844 Bacteria 12011
100 Ga0075428_100052577 3300006844 Bacteria 4464
101 Ga0075428_100064946 3300006844 Bacteria 3997
102 Ga0075430_100008291 3300006846 Bacteria 8777
103 Ga0075431_100002501 3300006847 Bacteria 17729
104 Ga0075431_100098911 3300006847 Bacteria 3011
105 Ga0075431_100217597 3300006847 Bacteria 1949
106 Ga0075431_100308625 3300006847 Bacteria 1597
107 Ga0075433_10001605 3300006852 Bacteria 16762
108 Ga0075433_10126086 3300006852 Bacteria 2273
109 Ga0075434_100000002 3300006871 Bacteria 135661
110 Ga0075434_100000018 3300006871 Bacteria 73715
111 Ga0075434_100019670 3300006871 Bacteria 6534
112 Ga0075434_100024723 3300006871 Bacteria 5874
113 Ga0075434_100028968 3300006871 Bacteria 5446
114 Ga0075434_100031752 3300006871 Bacteria 5207
115 Ga0075429_100000175 3300006880 Bacteria 41423
116 Ga0075429_100015900 3300006880 Bacteria 6515
117 Ga0075429_100018749 3300006880 Bacteria 5992
118 Ga0075429_100200652 3300006880 Bacteria 1747
119 Ga0068865_100000710 3300006881 Bacteria 18708
120 Ga0068865_100001000 3300006881 Bacteria 16237
121 Ga0068865_100163935 3300006881 Bacteria 1698
122 Ga0075436_100000048 3300006914 Bacteria 72013
123 Ga0075436_100000651 3300006914 Bacteria 22851
124 Ga0075436_100002045 3300006914 Bacteria 13910
125 Ga0075436_100019957 3300006914 Bacteria 4598
126 Ga0075436_100031098 3300006914 Bacteria 3674
127 Ga0075436_100104651 3300006914 Bacteria 1973
128 Ga0097620_100053258 3300006931 Bacteria 4069
129 Ga0097620_100064705 3300006931 Bacteria 3690
130 Ga0097620_100109629 3300006931 Bacteria 2822
131 Ga0097620_100269599 3300006931 Bacteria 1794
132 Ga0079104_1000020 3300006946 Bacteria 256848
133 Ga0075435_100002074 3300007076 Bacteria 13145
134 Ga0075435_100003818 3300007076 Bacteria 10280
135 Ga0075435_100045325 3300007076 Bacteria 3525
136 Ga0075435_100089166 3300007076 Bacteria 2542
137 Ga0099794_10010056 3300007265 Bacteria 4006
138 Ga0105250_10001151 3300009092 Bacteria 14863
139 Ga0105240_10111676 3300009093 Bacteria 3306
140 Ga0111539_10012223 3300009094 Bacteria 10767
141 Ga0111539_10022400 3300009094 Bacteria 7764
142 Ga0111539_10085218 3300009094 Bacteria 3714
143 Ga0111539_10101494 3300009094 Bacteria 3378
144 Ga0105245_10115514 3300009098 Bacteria 2501
145 Ga0105245_10141091 3300009098 Bacteria 2269
146 Ga0114129_10090272 3300009147 Bacteria 4247
147 Ga0114129_10124555 3300009147 Bacteria 3544
148 Ga0114129_10167428 3300009147 Bacteria 2998
149 Ga0105243_10007953 3300009148 Bacteria 8145
150 Ga0105243_10012332 3300009148 Bacteria 6463
151 Ga0105243_10024763 3300009148 Bacteria 4581
152 Ga0105243_10109425 3300009148 Bacteria 2308
153 Ga0105241_10008217 3300009174 Bacteria 7684
154 Ga0105242_10001851 3300009176 Bacteria 16595
155 Ga0105242_10004701 3300009176 Bacteria 10570
156 Ga0105242_10053206 3300009176 Bacteria 3305
157 Ga0105248_10310534 3300009177 Bacteria 1776
158 Ga0105238_10302891 3300009551 Bacteria 1582
159 Ga0105238_10326800 3300009551 Bacteria 1520
160 Ga0105249_10000917 3300009553 Bacteria 26070
161 Ga0105249_10019752 3300009553 Bacteria 6016
162 Ga0157369_10039287 3300013105 Bacteria 5171
163 Ga0157378_10003846 3300013297 Bacteria 13282
164 Ga0163162_10193361 3300013306 Bacteria 2162
165 Ga0163162_10598055 3300013306 Bacteria 1229
166 Ga0157372_10011322 3300013307 Bacteria 9485
167 Ga0157372_10276253 3300013307 Bacteria 1953
168 Ga0157380_10018792 3300014326 Bacteria 5139
169 Ga0157380_10090997 3300014326 Bacteria 2518
170 Ga0157377_10068774 3300014745 Bacteria 2041
171 Ga0157379_10017026 3300014968 Bacteria 6398
172 Ga0157376_10004616 3300014969 Bacteria 9595
173 Ga0157376_10057308 3300014969 Bacteria 3258
174 Ga0207642_10003770 3300025899 Bacteria 4824
175 Ga0207688_10137690 3300025901 Bacteria 1435
176 Ga0207643_10060785 3300025908 Bacteria 2157
177 Ga0207705_10028530 3300025909 Bacteria 3980
178 Ga0207705_10174717 3300025909 Bacteria 1618
179 Ga0207684_10393137 3300025910 Bacteria 1192
180 Ga0207654_10047529 3300025911 Bacteria 2452
181 Ga0207707_10000946 3300025912 Bacteria 27996
182 Ga0207707_10087581 3300025912 Bacteria 2720
183 Ga0207695_10135404 3300025913 Bacteria 2417
184 Ga0207660_10002436 3300025917 Bacteria 12221
185 Ga0207662_10001703 3300025918 Bacteria 10769
186 Ga0207662_10085374 3300025918 Bacteria 1933
187 Ga0207652_10045929 3300025921 Bacteria 3725
188 Ga0207652_10052696 3300025921 Bacteria 3493
189 Ga0207652_10166428 3300025921 Bacteria 1977
190 Ga0207652_10254287 3300025921 Bacteria 1584
191 Ga0207646_10148966 3300025922 Bacteria 2110
192 Ga0207681_10000560 3300025923 Bacteria 25447
193 Ga0207681_10362096 3300025923 Bacteria 1163
194 Ga0207694_10138555 3300025924 Bacteria 1955
195 Ga0207694_10150915 3300025924 Bacteria 1872
196 Ga0207659_10254141 3300025926 Bacteria 1427
197 Ga0207659_10349507 3300025926 Bacteria 1226
198 Ga0207687_10032123 3300025927 Bacteria 3553
199 Ga0207687_10169528 3300025927 Bacteria 1682
200 Ga0207664_10103618 3300025929 Bacteria 2355
201 Ga0207664_10131527 3300025929 Bacteria 2107
202 Ga0207690_10050338 3300025932 Bacteria 2781
203 Ga0207706_10032207 3300025933 Bacteria 4669
204 Ga0207686_10021005 3300025934 Bacteria 3739
205 Ga0207686_10107283 3300025934 Bacteria 1876
206 Ga0207709_10000055 3300025935 Bacteria 222373
207 Ga0207709_10001315 3300025935 Bacteria 17635
208 Ga0207709_10006652 3300025935 Bacteria 6486
209 Ga0207670_10180339 3300025936 Bacteria 1590
210 Ga0207670_10345340 3300025936 Bacteria 1177
211 Ga0207704_10000483 3300025938 Bacteria 17756
212 Ga0207704_10005835 3300025938 Bacteria 5698
213 Ga0207691_10301948 3300025940 Bacteria 1375
214 Ga0207711_10452859 3300025941 Bacteria 1195
215 Ga0207689_10000544 3300025942 Bacteria 35849
216 Ga0207689_10226505 3300025942 Bacteria 1545
217 Ga0207667_10008307 3300025949 Bacteria 12352
218 Ga0207667_10151663 3300025949 Bacteria 2385
219 Ga0207667_10433110 3300025949 Bacteria 1337
220 Ga0207712_10009220 3300025961 Bacteria 6248
221 Ga0207668_10008527 3300025972 Bacteria 6114
222 Ga0207658_10188378 3300025986 Bacteria 1713
223 Ga0207677_10003254 3300026023 Bacteria 8578
224 Ga0207703_10490266 3300026035 Bacteria 1152
225 Ga0207639_10070031 3300026041 Bacteria 2738
226 Ga0207639_10175025 3300026041 Bacteria 1821
227 Ga0207708_10000417 3300026075 Bacteria 33347
228 Ga0207708_10001699 3300026075 Bacteria 16293
229 Ga0207708_10446243 3300026075 Bacteria 1077
230 Ga0207702_10073158 3300026078 Bacteria 2955
231 Ga0207702_10183810 3300026078 Bacteria 1927
232 Ga0207702_10195396 3300026078 Bacteria 1872
233 Ga0207702_10552167 3300026078 Bacteria 1127
234 Ga0207641_10242265 3300026088 Bacteria 1681
235 Ga0207648_10000135 3300026089 Bacteria 73544
236 Ga0207648_10007396 3300026089 Bacteria 10809
237 Ga0207648_10315605 3300026089 Bacteria 1404
238 Ga0207675_100000825 3300026118 Bacteria 30861
239 Ga0207675_100004922 3300026118 Bacteria 12870
240 Ga0207675_100107279 3300026118 Bacteria 2633
241 Ga0207675_100234989 3300026118 Bacteria 1769
242 Ga0207698_10061372 3300026142 Bacteria 2929
243 Ga0209281_1000002 3300027111 Bacteria 1924012
244 Ga0209981_1008566 3300027378 Bacteria 1390
245 Ga0210000_1009180 3300027462 Bacteria 1454
246 Ga0209999_1007387 3300027543 Bacteria 1979
247 Ga0207428_10088842 3300027907 Bacteria 2403
248 Ga0207428_10204260 3300027907 Bacteria 1486
249 Ga0207428_10220634 3300027907 Bacteria 1421
250 Ga0268265_10001299 3300028380 Bacteria 21420
251 Ga0268265_10002564 3300028380 Bacteria 13587
252 Ga0268265_10040465 3300028380 Bacteria 3443
253 Ga0268265_10166676 3300028380 Bacteria 1878
254 Ga0268264_10112365 3300028381 Bacteria 2388
255 Ga0307408_100158517 3300031548 Bacteria 1795
256 Ga0307408_100212431 3300031548 Bacteria 1573
257 Ga0307410_10037078 3300031852 Bacteria 3181
258 Ga0307410_10131230 3300031852 Bacteria 1841
259 Ga0307406_10091825 3300031901 Bacteria 2046
260 Ga0307409_100008371 3300031995 Bacteria 6272
261 Ga0307409_100101388 3300031995 Bacteria 2389
262 Ga0307409_100160367 3300031995 Bacteria 1966
263 Ga0307416_100040135 3300032002 Bacteria 3633
264 Ga0307416_100088314 3300032002 Bacteria 2650
265 Ga0307416_100257839 3300032002 Bacteria 1702
266 Ga0373926_0020142 3300035083 Bacteria 2303
267 Ga0373934_0018376 3300035086 Bacteria 2674
268 Ga0373944_0004604 3300035089 Bacteria 3600
269 Ga0373953_0004053 3300035117 Bacteria 4632
270 Ga0373954_0000002 3300035118 Bacteria 147478
271 Ga0373954_0009550 3300035118 Bacteria 4268
272 Ga0373960_0007090 3300035121 Bacteria 2646
273 Ga0373946_0060644 3300035171 Bacteria 1608
274 Ga0373955_0004737 3300035172 Bacteria 6051
275 Ga0373942_0004077 3300035207 Bacteria 3407
276 Ga0373942_0036035 3300035207 Bacteria 1330
277 Ga0373961_0033037 3300035241 Bacteria 1455
278 Ga0373924_0005706 3300035410 Bacteria 4419
279 Ga0373924_0015060 3300035410 Bacteria 2932
280 Ga0373924_0019445 3300035410 Bacteria 2631
281 Ga0373931_0102466 3300035691 Bacteria 1612
282 Ga0373927_0004990 3300035695 Bacteria 9193
283 Ga0373933_0002915 3300035724 Bacteria 9553
284 Ga0373933_0014814 3300035724 Bacteria 4338
285 Ga0373933_0074896 3300035724 Bacteria 2066
286 Ga0373933_0272410 3300035724 Bacteria 1093
287 Ga0373937_0000775 3300036401 Bacteria 27575
288 Ga0373937_0005397 3300036401 Bacteria 10937
289 Ga0373937_0092361 3300036401 Bacteria 2805
290 Ga0373925_0014061 3300037068 Bacteria 5792
291 Ga0373925_0131079 3300037068 Bacteria 1955
292 Ga0395900_0039408 3300037418 Bacteria 4868
293 Ga0395905_0016916 3300037471 Bacteria 6928
294 Ga0439441_001479 3300042001 Bacteria 3085
295 Ga0439441_003362 3300042001 Bacteria 2353
296 Ga0450893_0005239 3300042532 Bacteria 2076
297 Ga0453683_0138840 3300044673 Bacteria 1533
298 Ga0451576_0452590 3300045051 Bacteria 1348
299 Ga0466967_0429597 3300045976 Bacteria 1288
300 Ga0495592_0006091 3300046454 Bacteria 8965
301 Ga0495603_0007268 3300046455 Bacteria 6654
302 Ga0495629_0216394 3300046459 Bacteria 1322
303 Ga0495662_0008257 3300046476 Bacteria 5127
304 Ga0495662_0008673 3300046476 Bacteria 4998
305 Ga0495608_0000872 3300046511 Bacteria 21068
306 Ga0495628_0009119 3300046516 Bacteria 8485
307 Ga0495628_0034982 3300046516 Bacteria 4039
308 Ga0495630_0043664 3300046517 Bacteria 3350
309 Ga0495666_0002191 3300046526 Bacteria 9735
310 Ga0495640_0016664 3300046533 Bacteria 5496
311 Ga0495640_0032981 3300046533 Bacteria 3683
312 Ga0495586_0000095 3300046535 Bacteria 53876
313 Ga0495586_0006745 3300046535 Bacteria 6132
314 Ga0495587_0015672 3300046536 Bacteria 4728
315 Ga0495587_0119244 3300046536 Bacteria 1512
316 Ga0495598_0031979 3300046537 Bacteria 1484
317 Ga0495621_0002530 3300046539 Bacteria 4931
318 Ga0495645_0060991 3300046543 Bacteria 2733
319 Ga0495667_0104906 3300046559 Bacteria 1827
320 Ga0495634_0004554 3300046642 Bacteria 10834
321 Ga0495625_0155112 3300046660 Bacteria 1537
322 Ga0495659_0099687 3300046664 Bacteria 1124
323 Ga0495588_0004610 3300046674 Bacteria 6087
324 Ga0495647_0000141 3300046681 Bacteria 18379
325 Ga0495669_0006731 3300046684 Bacteria 4811
326 Ga0495624_0114049 3300046690 Bacteria 1661
327 Ga0495670_0150376 3300046691 Bacteria 1221
328 Ga0495600_0030905 3300046809 Bacteria 3468
329 Ga0495581_0013738 3300047315 Bacteria 4695
330 Ga0495581_0044407 3300047315 Bacteria 2570
331 Ga0495581_0061068 3300047315 Bacteria 2178
332 Ga0495604_0012342 3300047317 Bacteria 6792
333 Ga0495636_0003000 3300047318 Bacteria 6536
334 Ga0495674_0092592 3300047319 Bacteria 2580
335 Ga0495672_0076042 3300047320 Bacteria 1887
336 Ga0495680_0002031 3300047322 Bacteria 21186
337 Ga0495680_0055026 3300047322 Bacteria 3087
338 Ga0495593_0044714 3300047673 Bacteria 2367
339 Ga0496104_0003588 3300048907 Bacteria 13403
340 Ga0496105_0007676 3300048908 Bacteria 8365
341 Ga0496106_0133240 3300048909 Bacteria 1950
342 Ga0496106_0254242 3300048909 Bacteria 1405
343 Ga0496117_0009184 3300048920 Bacteria 9264
344 Ga0496118_0034226 3300048921 Bacteria 4150
345 Ga0496119_0025766 3300048922 Bacteria 4099
346 Ga0496124_0000104 3300048927 Bacteria 177382
347 Ga0496125_0027922 3300048928 Bacteria 5105
348 Ga0496125_0206808 3300048928 Bacteria 1279
349 Ga0501292_012768 3300049515 Bacteria 1286
350 Ga0501298_003686 3300049521 Bacteria 2386
351 Ga0501031_0124255 3300049568 Bacteria 1686
352 Ga0501036_0030889 3300049572 Bacteria 4527
353 Ga0501038_0309716 3300049574 Bacteria 1238
354 Ga0501039_0185451 3300049575 Bacteria 1636
355 Ga0501040_0027433 3300049576 Bacteria 3834
356 Ga0501041_0018195 3300049577 Bacteria 4185
357 Ga0501041_0038024 3300049577 Bacteria 2917
358 Ga0501046_0128695 3300049580 Bacteria 1921
359 Ga0501048_0012576 3300049582 Bacteria 6296
360 Ga0501067_0038149 3300049583 Bacteria 2668
361 Ga0501067_0045539 3300049583 Bacteria 2436
362 Ga0501071_0036845 3300049587 Bacteria 3489
363 Ga0501071_0412793 3300049587 Bacteria 1031
364 Ga0501072_0025746 3300049588 Bacteria 4583
365 Ga0501072_0162535 3300049588 Bacteria 1781
366 Ga0501075_0002559 3300049591 Bacteria 12120
367 Ga0501076_0001216 3300049592 Bacteria 17126
368 Ga0501076_0108829 3300049592 Bacteria 2239
369 Ga0501077_0059122 3300049593 Bacteria 2433
370 Ga0501079_0018141 3300049741 Bacteria 5375
371 Ga0501079_0120179 3300049741 Bacteria 2043
372 Ga0501080_0152798 3300049742 Bacteria 2133
373 Ga0501080_0336860 3300049742 Bacteria 1364
374 Ga0501081_0015886 3300049743 Bacteria 4971
375 Ga0501045_0023747 3300049824 Bacteria 4399
376 nmdc:mga03n38_2941_c1 3300050490 Bacteria 2799
377 nmdc:mga06z11_3297_c1 3300050494 Bacteria 6246
378 nmdc:mga05p37_260850_c1 3300050507 Bacteria 2074
379 nmdc:mga05p37_424596_c1 3300050507 Bacteria 1546
380 nmdc:mga05p37_91263_c1 3300050507 Bacteria 3754
381 nmdc:mga09592_12470_c1 3300050508 Bacteria 6925
382 nmdc:mga09592_16177_c1 3300050508 Bacteria 6098
383 nmdc:mga09592_201508_c1 3300050508 Bacteria 1724
384 nmdc:mga0qj67_121991_c1 3300050509 Bacteria 2109
385 nmdc:mga06r32_1647_c1 3300050510 Bacteria 20161
386 nmdc:mga06r32_167778_c1 3300050510 Bacteria 2178
387 nmdc:mga06r32_23107_c1 3300050510 Bacteria 5753
388 nmdc:mga06r32_291214_c1 3300050510 Bacteria 1620
389 nmdc:mga08y16_12357_c1 3300050511 Bacteria 8979
390 nmdc:mga08y16_134009_c1 3300050511 Bacteria 2575
391 nmdc:mga08y16_25146_c1 3300050511 Bacteria 6280
392 nmdc:mga08y16_485529_c1 3300050511 Bacteria 1257
393 nmdc:mga0n895_100775_c1 3300050512 Bacteria 2897
394 nmdc:mga0n895_1173_c1 3300050512 Bacteria 19209
395 nmdc:mga0n895_1415_c1 3300050512 Bacteria 17921
396 nmdc:mga0n895_1513_c1 3300050512 Bacteria 17434
397 nmdc:mga0n895_153011_c1 3300050512 Bacteria 2337
398 nmdc:mga0n895_192774_c1 3300050512 Bacteria 2069
399 nmdc:mga0n895_206333_c1 3300050512 Bacteria 1996
400 nmdc:mga0rr50_11180_c1 3300050513 Bacteria 5729
401 nmdc:mga0rr50_25095_c1 3300050513 Bacteria 4140
402 nmdc:mga0rr50_331_c1 3300050513 Bacteria 25779
403 nmdc:mga0rr50_337053_c1 3300050513 Bacteria 1267
404 nmdc:mga08x19_10505_c1 3300050514 Bacteria 5560
405 nmdc:mga08x19_1633_c1 3300050514 Bacteria 13880
406 nmdc:mga08x19_31827_c1 3300050514 Bacteria 3322
407 nmdc:mga08x19_348_c1 3300050514 Bacteria 33504
408 nmdc:mga08x19_852_c1 3300050514 Bacteria 19371
409 nmdc:mga0a205_101487_c1 3300050515 Bacteria 2776
410 nmdc:mga0a205_242_c2 3300050515 Bacteria 16279
411 nmdc:mga0a205_68568_c1 3300050515 Bacteria 3425
412 Ga0495601_0025966 3300053077 Bacteria 3614
413 Ga0500614_060416 3300053123 Bacteria 1018
414 Ga0501082_0015865 3300060353 Bacteria 6477
415 Ga0501082_0292785 3300060353 Bacteria 1417
416 Ga0530510_0002366 3300061734 Bacteria 12953

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_192774_c1 nmdc:mga0n895_192774_c1_19_861 263
2 3300046664 Ga0495659_0099687 Ga0495659_0099687_14_832 272
3 3300047318 Ga0495636_0003000 Ga0495636_0003000_5706_6524 272
4 3300049587 Ga0501071_0412793 Ga0501071_0412793_14_832 272
5 3300046691 Ga0495670_0150376 Ga0495670_0150376_361_1203 280
6 3300005844 Ga0068862_100133574 Ga0068862_1001335742 292
7 3300006048 Ga0075363_100048165 Ga0075363_1000481652 292
8 3300006178 Ga0075367_10002211 Ga0075367_100022115 292
9 3300028380 Ga0268265_10040465 Ga0268265_100404652 292
10 3300053123 Ga0500614_060416 Ga0500614_060416_21_998 292
11 3300026078 Ga0207702_10073158 Ga0207702_100731582 293
12 3300035207 Ga0373942_0036035 Ga0373942_0036035_436_1317 293
13 3300035724 Ga0373933_0014814 Ga0373933_0014814_80_961 293
14 3300035724 Ga0373933_0272410 Ga0373933_0272410_19_900 293
15 3300036401 Ga0373937_0092361 Ga0373937_0092361_1443_2324 293
16 3300045051 Ga0451576_0452590 Ga0451576_0452590_32_916 293
17 3300046454 Ga0495592_0006091 Ga0495592_0006091_3783_4664 293
18 3300046476 Ga0495662_0008673 Ga0495662_0008673_843_1724 293
19 3300046511 Ga0495608_0000872 Ga0495608_0000872_19256_20137 293
20 3300046516 Ga0495628_0009119 Ga0495628_0009119_2076_2957 293
21 3300046517 Ga0495630_0043664 Ga0495630_0043664_2055_2936 293
22 3300046533 Ga0495640_0032981 Ga0495640_0032981_2321_3202 293
23 3300046535 Ga0495586_0000095 Ga0495586_0000095_15635_16516 293
24 3300046536 Ga0495587_0015672 Ga0495587_0015672_120_1001 293
25 3300046543 Ga0495645_0060991 Ga0495645_0060991_813_1694 293
26 3300046642 Ga0495634_0004554 Ga0495634_0004554_2438_3319 293
27 3300046690 Ga0495624_0114049 Ga0495624_0114049_87_968 293
28 3300046809 Ga0495600_0030905 Ga0495600_0030905_114_995 293
29 3300047315 Ga0495581_0061068 Ga0495581_0061068_865_1746 293
30 3300047317 Ga0495604_0012342 Ga0495604_0012342_1619_2500 293
31 3300047322 Ga0495680_0002031 Ga0495680_0002031_13237_14118 293
32 3300047673 Ga0495593_0044714 Ga0495593_0044714_459_1340 293
33 3300050512 nmdc:mga0n895_1415_c1 nmdc:mga0n895_1415_c1_3511_4392 293
34 3300053077 Ga0495601_0025966 Ga0495601_0025966_956_1837 293
35 3300005334 Ga0068869_100337675 Ga0068869_1003376751 298
36 3300046660 Ga0495625_0155112 Ga0495625_0155112_518_1501 298
37 3300006914 Ga0075436_100019957 Ga0075436_1000199571 299
38 3300006946 Ga0079104_1000020 Ga0079104_1000020211 299
39 3300027111 Ga0209281_1000002 Ga0209281_1000002536 299
40 3300009092 Ga0105250_10001151 Ga0105250_1000115113 300
41 3300009148 Ga0105243_10012332 Ga0105243_100123324 300
42 3300025935 Ga0207709_10000055 Ga0207709_10000055100 300
43 3300013306 Ga0163162_10598055 Ga0163162_105980552 302
44 3300050494 nmdc:mga06z11_3297_c1 nmdc:mga06z11_3297_c1_4137_5108 302
45 3300006852 Ga0075433_10126086 Ga0075433_101260862 303
46 3300006871 Ga0075434_100000002 Ga0075434_10000000210 303
47 3300007076 Ga0075435_100002074 Ga0075435_1000020746 303
48 3300050512 nmdc:mga0n895_1173_c1 nmdc:mga0n895_1173_c1_17066_18034 303
49 3300050513 nmdc:mga0rr50_331_c1 nmdc:mga0rr50_331_c1_23440_24408 303
50 3300050515 nmdc:mga0a205_68568_c1 nmdc:mga0a205_68568_c1_553_1521 303
51 3300026142 Ga0207698_10061372 Ga0207698_100613722 306
52 3300032002 Ga0307416_100088314 Ga0307416_1000883142 306
53 3300006914 Ga0075436_100000048 Ga0075436_10000004865 308
54 3300031852 Ga0307410_10037078 Ga0307410_100370781 308
55 3300031901 Ga0307406_10091825 Ga0307406_100918252 308
56 3300031995 Ga0307409_100008371 Ga0307409_1000083716 308
57 3300050514 nmdc:mga08x19_348_c1 nmdc:mga08x19_348_c1_13977_14945 308
58 3300006871 Ga0075434_100031752 Ga0075434_1000317523 309
59 3300006914 Ga0075436_100002045 Ga0075436_1000020453 309
60 3300009551 Ga0105238_10302891 Ga0105238_103028912 309
61 3300025924 Ga0207694_10150915 Ga0207694_101509152 309
62 3300031548 Ga0307408_100158517 Ga0307408_1001585172 309
63 3300050512 nmdc:mga0n895_153011_c1 nmdc:mga0n895_153011_c1_1356_2327 309
64 3300050514 nmdc:mga08x19_1633_c1 nmdc:mga08x19_1633_c1_10870_11883 309
65 3300031548 Ga0307408_100212431 Ga0307408_1002124311 310
66 3300005437 Ga0070710_10034758 Ga0070710_100347584 312
67 3300009176 Ga0105242_10053206 Ga0105242_100532062 312
68 3300005354 Ga0070675_100265170 Ga0070675_1002651701 313
69 3300005843 Ga0068860_100238734 Ga0068860_1002387341 313
70 3300005844 Ga0068862_100214369 Ga0068862_1002143691 313
71 3300006871 Ga0075434_100028968 Ga0075434_1000289682 313
72 3300005546 Ga0070696_100086641 Ga0070696_1000866412 314
73 3300005615 Ga0070702_100015381 Ga0070702_1000153812 314
74 3300009098 Ga0105245_10115514 Ga0105245_101155142 314
75 3300009176 Ga0105242_10004701 Ga0105242_100047015 314
76 3300025927 Ga0207687_10169528 Ga0207687_101695281 314
77 3300025934 Ga0207686_10021005 Ga0207686_100210053 314
78 3300046537 Ga0495598_0031979 Ga0495598_0031979_13_969 314
79 3300005330 Ga0070690_100018246 Ga0070690_1000182463 315
80 3300006358 Ga0068871_100040766 Ga0068871_1000407664 315
81 3300009177 Ga0105248_10310534 Ga0105248_103105343 315
82 3300014969 Ga0157376_10004616 Ga0157376_100046168 315
83 3300025941 Ga0207711_10452859 Ga0207711_104528591 315
84 3300025986 Ga0207658_10188378 Ga0207658_101883783 315
85 3300044673 Ga0453683_0138840 Ga0453683_0138840_121_1083 315
86 3300050514 nmdc:mga08x19_10505_c1 nmdc:mga08x19_10505_c1_2646_3596 316
87 3300048920 Ga0496117_0009184 Ga0496117_0009184_1778_2755 317
88 3300048921 Ga0496118_0034226 Ga0496118_0034226_1901_2878 317
89 3300048922 Ga0496119_0025766 Ga0496119_0025766_904_1881 317
90 3300048927 Ga0496124_0000104 Ga0496124_0000104_72469_73446 317
91 3300048928 Ga0496125_0027922 Ga0496125_0027922_775_1752 317
92 3300048928 Ga0496125_0206808 Ga0496125_0206808_264_1241 317
93 iso_pu_bacteria 2855730933 2855736085 317
94 iso_pu_bacteria 2855767633 2855773022 317
95 3300005295 Ga0065707_10101908 Ga0065707_101019083 318
96 3300006847 Ga0075431_100308625 Ga0075431_1003086252 318
97 3300006880 Ga0075429_100015900 Ga0075429_1000159002 318
98 3300009147 Ga0114129_10124555 Ga0114129_101245553 318
99 3300025912 Ga0207707_10000946 Ga0207707_1000094614 318
100 3300025921 Ga0207652_10052696 Ga0207652_100526965 318
101 3300048907 Ga0496104_0003588 Ga0496104_0003588_189_1148 318
102 3300048908 Ga0496105_0007676 Ga0496105_0007676_5064_6023 318
103 3300048909 Ga0496106_0254242 Ga0496106_0254242_273_1232 318
104 3300049583 Ga0501067_0038149 Ga0501067_0038149_1141_2097 318
105 3300050507 nmdc:mga05p37_260850_c1 nmdc:mga05p37_260850_c1_188_1150 318
106 3300027543 Ga0209999_1007387 Ga0209999_10073872 319
107 3300035207 Ga0373942_0004077 Ga0373942_0004077_1722_2690 319
108 3300005336 Ga0070680_100023752 Ga0070680_1000237522 320
109 3300005444 Ga0070694_100209294 Ga0070694_1002092942 320
110 3300005545 Ga0070695_100014134 Ga0070695_1000141343 320
111 3300005549 Ga0070704_100103958 Ga0070704_1001039582 320
112 3300005549 Ga0070704_100299382 Ga0070704_1002993822 320
113 3300005617 Ga0068859_100109634 Ga0068859_1001096342 320
114 3300006931 Ga0097620_100109629 Ga0097620_1001096292 320
115 3300013306 Ga0163162_10193361 Ga0163162_101933613 320
116 3300031995 Ga0307409_100160367 Ga0307409_1001603673 320
117 3300042001 Ga0439441_003362 Ga0439441_003362_152_1120 320
118 3300047320 Ga0495672_0076042 Ga0495672_0076042_18_980 320
119 3300049575 Ga0501039_0185451 Ga0501039_0185451_183_1151 320
120 3300049741 Ga0501079_0120179 Ga0501079_0120179_760_1728 320
121 3300060353 Ga0501082_0292785 Ga0501082_0292785_310_1278 320
122 iso_pu_bacteria 2721755523 2722885987 320
123 iso_pu_bacteria 2839138175 2839142697 320
124 3300005330 Ga0070690_100059078 Ga0070690_1000590782 321
125 3300005334 Ga0068869_100000502 Ga0068869_10000050221 321
126 3300005335 Ga0070666_10074638 Ga0070666_100746382 321
127 3300005336 Ga0070680_100000089 Ga0070680_10000008939 321
128 3300005337 Ga0070682_100002252 Ga0070682_10000225211 321
129 3300005338 Ga0068868_100211937 Ga0068868_1002119372 321
130 3300005340 Ga0070689_100002936 Ga0070689_1000029363 321
131 3300005341 Ga0070691_10000090 Ga0070691_1000009013 321
132 3300005354 Ga0070675_100314745 Ga0070675_1003147451 321
133 3300005364 Ga0070673_100309226 Ga0070673_1003092262 321
134 3300005365 Ga0070688_100035013 Ga0070688_1000350131 321
135 3300005435 Ga0070714_100147710 Ga0070714_1001477102 321
136 3300005438 Ga0070701_10000812 Ga0070701_1000081210 321
137 3300005440 Ga0070705_100021947 Ga0070705_1000219473 321
138 3300005441 Ga0070700_100007592 Ga0070700_1000075927 321
139 3300005444 Ga0070694_100038194 Ga0070694_1000381943 321
140 3300005444 Ga0070694_100133944 Ga0070694_1001339441 321
141 3300005445 Ga0070708_100356251 Ga0070708_1003562512 321
142 3300005457 Ga0070662_100208214 Ga0070662_1002082142 321
143 3300005458 Ga0070681_10000283 Ga0070681_1000028326 321
144 3300005459 Ga0068867_100001413 Ga0068867_10000141319 321
145 3300005467 Ga0070706_100415711 Ga0070706_1004157111 321
146 3300005530 Ga0070679_100066906 Ga0070679_1000669064 321
147 3300005530 Ga0070679_100085010 Ga0070679_1000850101 321
148 3300005536 Ga0070697_100026559 Ga0070697_1000265594 321
149 3300005539 Ga0068853_100073699 Ga0068853_1000736993 321
150 3300005545 Ga0070695_100002400 Ga0070695_1000024003 321
151 3300005546 Ga0070696_100002203 Ga0070696_10000220312 321
152 3300005546 Ga0070696_100010522 Ga0070696_1000105227 321
153 3300005547 Ga0070693_100000477 Ga0070693_10000047719 321
154 3300005549 Ga0070704_100000091 Ga0070704_10000009137 321
155 3300005563 Ga0068855_100006008 Ga0068855_10000600814 321
156 3300005563 Ga0068855_100096204 Ga0068855_1000962045 321
157 3300005578 Ga0068854_100010099 Ga0068854_1000100992 321
158 3300005615 Ga0070702_100207491 Ga0070702_1002074911 321
159 3300005616 Ga0068852_100022271 Ga0068852_1000222713 321
160 3300005617 Ga0068859_100269579 Ga0068859_1002695792 321
161 3300005718 Ga0068866_10000144 Ga0068866_1000014438 321
162 3300005719 Ga0068861_100346539 Ga0068861_1003465391 321
163 3300005842 Ga0068858_100005045 Ga0068858_1000050452 321
164 3300005843 Ga0068860_100168771 Ga0068860_1001687711 321
165 3300005844 Ga0068862_100038361 Ga0068862_1000383613 321
166 3300006358 Ga0068871_100000744 Ga0068871_10000074413 321
167 3300006844 Ga0075428_100007605 Ga0075428_10000760510 321
168 3300006844 Ga0075428_100064946 Ga0075428_1000649463 321
169 3300006846 Ga0075430_100008291 Ga0075430_1000082912 321
170 3300006847 Ga0075431_100098911 Ga0075431_1000989113 321
171 3300006871 Ga0075434_100024723 Ga0075434_1000247232 321
172 3300006880 Ga0075429_100018749 Ga0075429_1000187497 321
173 3300006880 Ga0075429_100200652 Ga0075429_1002006522 321
174 3300006881 Ga0068865_100000710 Ga0068865_10000071018 321
175 3300006914 Ga0075436_100104651 Ga0075436_1001046512 321
176 3300006931 Ga0097620_100269599 Ga0097620_1002695992 321
177 3300007076 Ga0075435_100045325 Ga0075435_1000453254 321
178 3300009093 Ga0105240_10111676 Ga0105240_101116763 321
179 3300009094 Ga0111539_10012223 Ga0111539_1001222312 321
180 3300009098 Ga0105245_10141091 Ga0105245_101410912 321
181 3300009147 Ga0114129_10090272 Ga0114129_100902723 321
182 3300009148 Ga0105243_10024763 Ga0105243_100247635 321
183 3300009174 Ga0105241_10008217 Ga0105241_100082177 321
184 3300009176 Ga0105242_10001851 Ga0105242_100018513 321
185 3300009551 Ga0105238_10326800 Ga0105238_103268001 321
186 3300009553 Ga0105249_10000917 Ga0105249_100009173 321
187 3300013105 Ga0157369_10039287 Ga0157369_100392875 321
188 3300013297 Ga0157378_10003846 Ga0157378_1000384612 321
189 3300013307 Ga0157372_10011322 Ga0157372_100113229 321
190 3300014968 Ga0157379_10017026 Ga0157379_100170262 321
191 3300014969 Ga0157376_10057308 Ga0157376_100573082 321
192 3300025899 Ga0207642_10003770 Ga0207642_100037705 321
193 3300025909 Ga0207705_10174717 Ga0207705_101747171 321
194 3300025910 Ga0207684_10393137 Ga0207684_103931372 321
195 3300025911 Ga0207654_10047529 Ga0207654_100475292 321
196 3300025913 Ga0207695_10135404 Ga0207695_101354041 321
197 3300025917 Ga0207660_10002436 Ga0207660_100024362 321
198 3300025918 Ga0207662_10001703 Ga0207662_1000170312 321
199 3300025921 Ga0207652_10166428 Ga0207652_101664283 321
200 3300025921 Ga0207652_10254287 Ga0207652_102542872 321
201 3300025923 Ga0207681_10362096 Ga0207681_103620961 321
202 3300025924 Ga0207694_10138555 Ga0207694_101385552 321
203 3300025926 Ga0207659_10254141 Ga0207659_102541412 321
204 3300025927 Ga0207687_10032123 Ga0207687_100321231 321
205 3300025929 Ga0207664_10103618 Ga0207664_101036182 321
206 3300025929 Ga0207664_10131527 Ga0207664_101315272 321
207 3300025932 Ga0207690_10050338 Ga0207690_100503382 321
208 3300025934 Ga0207686_10107283 Ga0207686_101072832 321
209 3300025935 Ga0207709_10001315 Ga0207709_1000131513 321
210 3300025938 Ga0207704_10000483 Ga0207704_100004833 321
211 3300025942 Ga0207689_10000544 Ga0207689_1000054438 321
212 3300025949 Ga0207667_10008307 Ga0207667_100083073 321
213 3300025949 Ga0207667_10151663 Ga0207667_101516631 321
214 3300026023 Ga0207677_10003254 Ga0207677_100032548 321
215 3300026041 Ga0207639_10070031 Ga0207639_100700312 321
216 3300026041 Ga0207639_10175025 Ga0207639_101750251 321
217 3300026075 Ga0207708_10000417 Ga0207708_100004174 321
218 3300026078 Ga0207702_10195396 Ga0207702_101953961 321
219 3300026078 Ga0207702_10552167 Ga0207702_105521671 321
220 3300026089 Ga0207648_10000135 Ga0207648_1000013538 321
221 3300026118 Ga0207675_100000825 Ga0207675_10000082536 321
222 3300027462 Ga0210000_1009180 Ga0210000_10091801 321
223 3300028380 Ga0268265_10002564 Ga0268265_1000256415 321
224 3300028381 Ga0268264_10112365 Ga0268264_101123651 321
225 3300031852 Ga0307410_10131230 Ga0307410_101312301 321
226 3300031995 Ga0307409_100101388 Ga0307409_1001013882 321
227 3300035117 Ga0373953_0004053 Ga0373953_0004053_612_1583 321
228 3300035118 Ga0373954_0009550 Ga0373954_0009550_1117_2088 321
229 3300035172 Ga0373955_0004737 Ga0373955_0004737_3205_4176 321
230 3300035241 Ga0373961_0033037 Ga0373961_0033037_133_1149 321
231 3300035410 Ga0373924_0005706 Ga0373924_0005706_503_1510 321
232 3300035410 Ga0373924_0015060 Ga0373924_0015060_208_1179 321
233 3300035724 Ga0373933_0002915 Ga0373933_0002915_2304_3275 321
234 3300035724 Ga0373933_0074896 Ga0373933_0074896_42_1049 321
235 3300036401 Ga0373937_0005397 Ga0373937_0005397_1306_2277 321
236 3300037418 Ga0395900_0039408 Ga0395900_0039408_3173_4138 321
237 3300037471 Ga0395905_0016916 Ga0395905_0016916_3094_4059 321
238 3300042001 Ga0439441_001479 Ga0439441_001479_1979_2950 321
239 3300042532 Ga0450893_0005239 Ga0450893_0005239_833_1810 321
240 3300046559 Ga0495667_0104906 Ga0495667_0104906_637_1608 321
241 3300047322 Ga0495680_0055026 Ga0495680_0055026_1640_2647 321
242 3300048909 Ga0496106_0133240 Ga0496106_0133240_608_1582 321
243 3300049574 Ga0501038_0309716 Ga0501038_0309716_75_1040 321
244 3300049577 Ga0501041_0038024 Ga0501041_0038024_1530_2495 321
245 3300049580 Ga0501046_0128695 Ga0501046_0128695_798_1763 321
246 3300049582 Ga0501048_0012576 Ga0501048_0012576_3975_4940 321
247 3300049587 Ga0501071_0036845 Ga0501071_0036845_401_1366 321
248 3300049588 Ga0501072_0025746 Ga0501072_0025746_1577_2542 321
249 3300049588 Ga0501072_0162535 Ga0501072_0162535_401_1366 321
250 3300049591 Ga0501075_0002559 Ga0501075_0002559_3323_4288 321
251 3300049592 Ga0501076_0001216 Ga0501076_0001216_2614_3579 321
252 3300049592 Ga0501076_0108829 Ga0501076_0108829_129_1094 321
253 3300049593 Ga0501077_0059122 Ga0501077_0059122_1174_2139 321
254 3300049741 Ga0501079_0018141 Ga0501079_0018141_825_1790 321
255 3300049742 Ga0501080_0152798 Ga0501080_0152798_476_1441 321
256 3300049742 Ga0501080_0336860 Ga0501080_0336860_49_1020 321
257 3300049743 Ga0501081_0015886 Ga0501081_0015886_87_1052 321
258 3300049824 Ga0501045_0023747 Ga0501045_0023747_3219_4184 321
259 3300050490 nmdc:mga03n38_2941_c1 nmdc:mga03n38_2941_c1_698_1699 321
260 3300050508 nmdc:mga09592_16177_c1 nmdc:mga09592_16177_c1_442_1413 321
261 3300050509 nmdc:mga0qj67_121991_c1 nmdc:mga0qj67_121991_c1_940_1911 321
262 3300050510 nmdc:mga06r32_23107_c1 nmdc:mga06r32_23107_c1_2658_3629 321
263 3300050511 nmdc:mga08y16_25146_c1 nmdc:mga08y16_25146_c1_5215_6186 321
264 3300050511 nmdc:mga08y16_485529_c1 nmdc:mga08y16_485529_c1_133_1098 321
265 3300050512 nmdc:mga0n895_100775_c1 nmdc:mga0n895_100775_c1_1065_2030 321
266 3300050512 nmdc:mga0n895_1513_c1 nmdc:mga0n895_1513_c1_12027_12992 321
267 3300050512 nmdc:mga0n895_206333_c1 nmdc:mga0n895_206333_c1_327_1292 321
268 3300050513 nmdc:mga0rr50_11180_c1 nmdc:mga0rr50_11180_c1_4685_5650 321
269 3300050513 nmdc:mga0rr50_337053_c1 nmdc:mga0rr50_337053_c1_123_1088 321
270 3300050514 nmdc:mga08x19_852_c1 nmdc:mga08x19_852_c1_9048_10013 321
271 3300050515 nmdc:mga0a205_101487_c1 nmdc:mga0a205_101487_c1_1300_2265 321
272 3300050515 nmdc:mga0a205_242_c2 nmdc:mga0a205_242_c2_3983_4948 321
273 3300060353 Ga0501082_0015865 Ga0501082_0015865_859_1824 321
274 3300061734 Ga0530510_0002366 Ga0530510_0002366_8066_9031 321
275 3300005327 Ga0070658_10145288 Ga0070658_101452882 322
276 3300005334 Ga0068869_100218511 Ga0068869_1002185111 322
277 3300005336 Ga0070680_100165724 Ga0070680_1001657242 322
278 3300005343 Ga0070687_100060478 Ga0070687_1000604783 322
279 3300005347 Ga0070668_100012128 Ga0070668_1000121283 322
280 3300005353 Ga0070669_100002477 Ga0070669_10000247710 322
281 3300005356 Ga0070674_100036956 Ga0070674_1000369564 322
282 3300005438 Ga0070701_10003664 Ga0070701_100036642 322
283 3300005438 Ga0070701_10094633 Ga0070701_100946331 322
284 3300005438 Ga0070701_10110247 Ga0070701_101102472 322
285 3300005441 Ga0070700_100001359 Ga0070700_1000013592 322
286 3300005441 Ga0070700_100186456 Ga0070700_1001864562 322
287 3300005444 Ga0070694_100035228 Ga0070694_1000352282 322
288 3300005459 Ga0068867_100003697 Ga0068867_1000036972 322
289 3300005471 Ga0070698_100592249 Ga0070698_1005922491 322
290 3300005530 Ga0070679_100072090 Ga0070679_1000720903 322
291 3300005536 Ga0070697_100011628 Ga0070697_1000116282 322
292 3300005543 Ga0070672_100447304 Ga0070672_1004473041 322
293 3300005544 Ga0070686_100150481 Ga0070686_1001504811 322
294 3300005547 Ga0070693_100084737 Ga0070693_1000847372 322
295 3300005563 Ga0068855_100220413 Ga0068855_1002204132 322
296 3300005614 Ga0068856_100224781 Ga0068856_1002247812 322
297 3300005617 Ga0068859_100053262 Ga0068859_1000532623 322
298 3300005617 Ga0068859_100064703 Ga0068859_1000647031 322
299 3300005719 Ga0068861_100002139 Ga0068861_10000213911 322
300 3300005719 Ga0068861_100125159 Ga0068861_1001251592 322
301 3300005719 Ga0068861_100193593 Ga0068861_1001935932 322
302 3300005840 Ga0068870_10103824 Ga0068870_101038241 322
303 3300005842 Ga0068858_100130674 Ga0068858_1001306743 322
304 3300005844 Ga0068862_100003743 Ga0068862_1000037432 322
305 3300005844 Ga0068862_100065330 Ga0068862_1000653302 322
306 3300005844 Ga0068862_100490369 Ga0068862_1004903691 322
307 3300005985 Ga0081539_10013580 Ga0081539_100135803 322
308 3300006847 Ga0075431_100217597 Ga0075431_1002175972 322
309 3300006852 Ga0075433_10001605 Ga0075433_100016054 322
310 3300006871 Ga0075434_100000018 Ga0075434_10000001871 322
311 3300006871 Ga0075434_100019670 Ga0075434_1000196704 322
312 3300006881 Ga0068865_100001000 Ga0068865_1000010003 322
313 3300006881 Ga0068865_100163935 Ga0068865_1001639352 322
314 3300006914 Ga0075436_100000651 Ga0075436_10000065112 322
315 3300006914 Ga0075436_100031098 Ga0075436_1000310982 322
316 3300006931 Ga0097620_100053258 Ga0097620_1000532583 322
317 3300006931 Ga0097620_100064705 Ga0097620_1000647054 322
318 3300007076 Ga0075435_100003818 Ga0075435_1000038183 322
319 3300007076 Ga0075435_100089166 Ga0075435_1000891664 322
320 3300007265 Ga0099794_10010056 Ga0099794_100100563 322
321 3300009094 Ga0111539_10022400 Ga0111539_100224004 322
322 3300009094 Ga0111539_10085218 Ga0111539_100852183 322
323 3300009094 Ga0111539_10101494 Ga0111539_101014942 322
324 3300009148 Ga0105243_10007953 Ga0105243_100079537 322
325 3300009553 Ga0105249_10019752 Ga0105249_100197524 322
326 3300013307 Ga0157372_10276253 Ga0157372_102762532 322
327 3300014326 Ga0157380_10018792 Ga0157380_100187923 322
328 3300014326 Ga0157380_10090997 Ga0157380_100909972 322
329 3300014745 Ga0157377_10068774 Ga0157377_100687743 322
330 3300025901 Ga0207688_10137690 Ga0207688_101376901 322
331 3300025908 Ga0207643_10060785 Ga0207643_100607853 322
332 3300025909 Ga0207705_10028530 Ga0207705_100285304 322
333 3300025912 Ga0207707_10087581 Ga0207707_100875813 322
334 3300025918 Ga0207662_10085374 Ga0207662_100853742 322
335 3300025921 Ga0207652_10045929 Ga0207652_100459292 322
336 3300025923 Ga0207681_10000560 Ga0207681_100005607 322
337 3300025926 Ga0207659_10349507 Ga0207659_103495071 322
338 3300025933 Ga0207706_10032207 Ga0207706_100322074 322
339 3300025935 Ga0207709_10006652 Ga0207709_100066523 322
340 3300025936 Ga0207670_10180339 Ga0207670_101803392 322
341 3300025936 Ga0207670_10345340 Ga0207670_103453401 322
342 3300025938 Ga0207704_10005835 Ga0207704_100058354 322
343 3300025940 Ga0207691_10301948 Ga0207691_103019483 322
344 3300025942 Ga0207689_10226505 Ga0207689_102265053 322
345 3300025949 Ga0207667_10433110 Ga0207667_104331102 322
346 3300025961 Ga0207712_10009220 Ga0207712_100092203 322
347 3300025972 Ga0207668_10008527 Ga0207668_100085273 322
348 3300026035 Ga0207703_10490266 Ga0207703_104902662 322
349 3300026075 Ga0207708_10001699 Ga0207708_100016997 322
350 3300026075 Ga0207708_10446243 Ga0207708_104462431 322
351 3300026078 Ga0207702_10183810 Ga0207702_101838102 322
352 3300026088 Ga0207641_10242265 Ga0207641_102422652 322
353 3300026089 Ga0207648_10007396 Ga0207648_100073967 322
354 3300026089 Ga0207648_10315605 Ga0207648_103156052 322
355 3300026118 Ga0207675_100004922 Ga0207675_1000049222 322
356 3300026118 Ga0207675_100107279 Ga0207675_1001072792 322
357 3300026118 Ga0207675_100234989 Ga0207675_1002349891 322
358 3300027378 Ga0209981_1008566 Ga0209981_10085662 322
359 3300027907 Ga0207428_10088842 Ga0207428_100888422 322
360 3300027907 Ga0207428_10204260 Ga0207428_102042602 322
361 3300027907 Ga0207428_10220634 Ga0207428_102206342 322
362 3300028380 Ga0268265_10001299 Ga0268265_100012993 322
363 3300028380 Ga0268265_10166676 Ga0268265_101666762 322
364 3300032002 Ga0307416_100040135 Ga0307416_1000401353 322
365 3300032002 Ga0307416_100257839 Ga0307416_1002578392 322
366 3300035083 Ga0373926_0020142 Ga0373926_0020142_825_1799 322
367 3300035086 Ga0373934_0018376 Ga0373934_0018376_1033_2007 322
368 3300035089 Ga0373944_0004604 Ga0373944_0004604_483_1457 322
369 3300035118 Ga0373954_0000002 Ga0373954_0000002_4969_5943 322
370 3300035121 Ga0373960_0007090 Ga0373960_0007090_1154_2125 322
371 3300035171 Ga0373946_0060644 Ga0373946_0060644_491_1465 322
372 3300035410 Ga0373924_0019445 Ga0373924_0019445_26_1000 322
373 3300035691 Ga0373931_0102466 Ga0373931_0102466_339_1307 322
374 3300035695 Ga0373927_0004990 Ga0373927_0004990_3499_4473 322
375 3300036401 Ga0373937_0000775 Ga0373937_0000775_9612_10586 322
376 3300037068 Ga0373925_0014061 Ga0373925_0014061_802_1776 322
377 3300037068 Ga0373925_0131079 Ga0373925_0131079_145_1113 322
378 3300045976 Ga0466967_0429597 Ga0466967_0429597_62_1036 322
379 3300046455 Ga0495603_0007268 Ga0495603_0007268_1022_1996 322
380 3300046459 Ga0495629_0216394 Ga0495629_0216394_308_1282 322
381 3300046476 Ga0495662_0008257 Ga0495662_0008257_1111_2085 322
382 3300046516 Ga0495628_0034982 Ga0495628_0034982_467_1441 322
383 3300046526 Ga0495666_0002191 Ga0495666_0002191_994_1968 322
384 3300046533 Ga0495640_0016664 Ga0495640_0016664_792_1766 322
385 3300046535 Ga0495586_0006745 Ga0495586_0006745_4480_5454 322
386 3300046536 Ga0495587_0119244 Ga0495587_0119244_183_1157 322
387 3300046539 Ga0495621_0002530 Ga0495621_0002530_52_1020 322
388 3300046674 Ga0495588_0004610 Ga0495588_0004610_2016_2990 322
389 3300046681 Ga0495647_0000141 Ga0495647_0000141_12231_13205 322
390 3300046684 Ga0495669_0006731 Ga0495669_0006731_904_1872 322
391 3300047315 Ga0495581_0013738 Ga0495581_0013738_1825_2799 322
392 3300047315 Ga0495581_0044407 Ga0495581_0044407_287_1261 322
393 3300047319 Ga0495674_0092592 Ga0495674_0092592_116_1090 322
394 3300049515 Ga0501292_012768 Ga0501292_012768_115_1086 322
395 3300049521 Ga0501298_003686 Ga0501298_003686_785_1756 322
396 3300049568 Ga0501031_0124255 Ga0501031_0124255_305_1279 322
397 3300049572 Ga0501036_0030889 Ga0501036_0030889_2115_3086 322
398 3300049576 Ga0501040_0027433 Ga0501040_0027433_198_1169 322
399 3300049577 Ga0501041_0018195 Ga0501041_0018195_3128_4099 322
400 3300050507 nmdc:mga05p37_424596_c1 nmdc:mga05p37_424596_c1_273_1247 322
401 3300050508 nmdc:mga09592_201508_c1 nmdc:mga09592_201508_c1_467_1441 322
402 3300050510 nmdc:mga06r32_167778_c1 nmdc:mga06r32_167778_c1_1101_2069 322
403 3300050510 nmdc:mga06r32_291214_c1 nmdc:mga06r32_291214_c1_605_1579 322
404 3300050511 nmdc:mga08y16_12357_c1 nmdc:mga08y16_12357_c1_1324_2298 322
405 3300050511 nmdc:mga08y16_134009_c1 nmdc:mga08y16_134009_c1_1499_2473 322
406 3300050513 nmdc:mga0rr50_25095_c1 nmdc:mga0rr50_25095_c1_2533_3501 322
407 3300050514 nmdc:mga08x19_31827_c1 nmdc:mga08x19_31827_c1_2210_3178 322
408 3300005468 Ga0070707_100476182 Ga0070707_1004761821 323
409 3300049583 Ga0501067_0045539 Ga0501067_0045539_696_1679 323
410 iso_pu_bacteria 8001845381 8001849722 323
411 3300005289 Ga0065704_10125558 Ga0065704_101255583 324
412 3300005549 Ga0070704_100016050 Ga0070704_1000160501 324
413 3300006844 Ga0075428_100052577 Ga0075428_1000525775 324
414 3300006847 Ga0075431_100002501 Ga0075431_10000250117 324
415 3300006880 Ga0075429_100000175 Ga0075429_10000017543 324
416 3300009147 Ga0114129_10167428 Ga0114129_101674284 324
417 3300009148 Ga0105243_10109425 Ga0105243_101094254 324
418 3300025922 Ga0207646_10148966 Ga0207646_101489663 324
419 3300050507 nmdc:mga05p37_91263_c1 nmdc:mga05p37_91263_c1_1390_2364 324
420 3300050508 nmdc:mga09592_12470_c1 nmdc:mga09592_12470_c1_4210_5184 324
421 3300050510 nmdc:mga06r32_1647_c1 nmdc:mga06r32_1647_c1_11545_12519 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

42

318

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9827 25 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9794 25 324
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9672 25 316
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9576 25 316
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9573 25 324
ID Description Score Start End Superfamily
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.978 125 246 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9771 124 246 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.962 125 246 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9617 124 246 3.40.190.10
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9433 25 324 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A4Q3MH39-F1-model_v4 deleted 0.9882 23 223
AF-V8QRH9-F1-model_v4 ABC transporter substrate-binding protein 0.9807 18 322
AF-A0A1H8YFB1-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9802 18 324
AF-A0A257K6Z4-F1-model_v4 Caspase family p20 domain-containing protein 0.9799 23 226 GO:0004197
GO:0006508
AF-A0A1B2QZA4-F1-model_v4 ABC transporter substrate-binding protein 0.9767 23 324

Feature Viewer

pLDDT pTM Quality
91.7 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map