F440063

General Info

Members Datasets Scaffolds Average Seq Length
421 278 399 275

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0236091|Ga0466958_0236091_102_1058
Length 318
Sequence MIVITSINELRAELAKRRKLAPEGRIGFVPTMGYLHEGHASLMRRAKQECGFAVLSVFVNPLQFGPNEDFDRYPRDFERDRALAESCGVDVMFMPSVQEMYPKKPLTTVRIEGLTDRLCGASRPGHFDGVGTVVSKLFHIVQPDRAYFGLKDAQQIAVIRRMVDDLNIPVEIVPCDTVREPDGLAKSSRNVYLNDEERRQAVILAQTLEAAGRWLTEPGTTGPRLAAKIRGMIAEAPLAEIDYAEVLEYPDLERPADSADLFGHSHDLIVALAVKFGRTRLIDNRIFSKHGGEKRVQNDDEVEAAPRYRDGSELELCR

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
3 2671180694 Paenibacillus sp. A3 Isolate Unclassified
4 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
5 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
6 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
7 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
8 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
9 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
10 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
11 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
12 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
13 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
14 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
15 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
16 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
17 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
18 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
19 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
20 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
21 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.82
Metatranscriptomes 0.95
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 3.56
Rhizosphere 90.74
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10005200 3300003187 Bacteria 6748
2 rootH2_10031334 3300003320 Bacteria 5553
3 Ga0055532_1000064 3300003758 Bacteria 143144
4 Ga0055532_1000216 3300003758 Bacteria 45278
5 Ga0055541_1009378 3300003841 Bacteria 1516
6 Ga0065704_10152088 3300005289 Bacteria 1419
7 Ga0065707_10096095 3300005295 Bacteria 3305
8 Ga0070676_10105050 3300005328 Unclassified 1751
9 Ga0070683_100034031 3300005329 Bacteria 4652
10 Ga0070670_100001860 3300005331 Bacteria 17200
11 Ga0070670_100012602 3300005331 Bacteria 7240
12 Ga0070670_100041025 3300005331 Bacteria 3977
13 Ga0070670_100185319 3300005331 Bacteria 1807
14 Ga0068869_100008059 3300005334 Bacteria 6770
15 Ga0068869_100407128 3300005334 Bacteria 1120
16 Ga0068869_100416586 3300005334 Bacteria 1108
17 Ga0070680_100003697 3300005336 Bacteria 11428
18 Ga0070682_100003788 3300005337 Bacteria 8407
19 Ga0068868_100058483 3300005338 Bacteria 3047
20 Ga0070660_100016760 3300005339 Bacteria 5328
21 Ga0070660_100164596 3300005339 Bacteria 1789
22 Ga0070689_100107864 3300005340 Bacteria 2211
23 Ga0070687_100096176 3300005343 Bacteria 1648
24 Ga0070661_100007432 3300005344 Bacteria 7554
25 Ga0070661_100273295 3300005344 Bacteria 1309
26 Ga0070668_100135376 3300005347 Bacteria 1981
27 Ga0070675_100006099 3300005354 Bacteria 9243
28 Ga0070675_100061763 3300005354 Unclassified 3095
29 Ga0070675_100147905 3300005354 Bacteria 2012
30 Ga0070675_100156355 3300005354 Unclassified 1958
31 Ga0070673_100061328 3300005364 Bacteria 2984
32 Ga0070688_100032871 3300005365 Bacteria 3132
33 Ga0070659_100004529 3300005366 Bacteria 9928
34 Ga0070659_100108168 3300005366 Bacteria 2243
35 Ga0070667_100058340 3300005367 Viruses 3263
36 Ga0070705_100415245 3300005440 Bacteria 1000
37 Ga0070700_100215424 3300005441 Bacteria 1357
38 Ga0070694_100024610 3300005444 Bacteria 3887
39 Ga0070708_100133330 3300005445 Bacteria 2300
40 Ga0070685_10099762 3300005466 Bacteria 1772
41 Ga0070706_100000664 3300005467 Bacteria 39200
42 Ga0070706_100004046 3300005467 Bacteria 14241
43 Ga0070706_100009421 3300005467 Bacteria 9092
44 Ga0070706_100015981 3300005467 Bacteria 6932
45 Ga0070706_100043167 3300005467 Bacteria 4165
46 Ga0070706_100133604 3300005467 Bacteria 2316
47 Ga0070706_100158392 3300005467 Bacteria 2114
48 Ga0070698_100002624 3300005471 Bacteria 19806
49 Ga0070698_100020098 3300005471 Bacteria 7000
50 Ga0070698_100092849 3300005471 Bacteria 2999
51 Ga0070698_100098033 3300005471 Bacteria 2906
52 Ga0070698_100422308 3300005471 Bacteria 1268
53 Ga0070699_100043101 3300005518 Bacteria 3907
54 Ga0070699_100052362 3300005518 Bacteria 3533
55 Ga0070699_100189905 3300005518 Bacteria 1825
56 Ga0070679_100040637 3300005530 Bacteria 4628
57 Ga0070684_100017053 3300005535 Bacteria 5953
58 Ga0070684_100017794 3300005535 Bacteria 5840
59 Ga0070684_100241438 3300005535 Bacteria 1651
60 Ga0070697_100002705 3300005536 Bacteria 13654
61 Ga0070697_100010414 3300005536 Bacteria 7256
62 Ga0070697_100230030 3300005536 Bacteria 1581
63 Ga0068853_100068463 3300005539 Bacteria 3086
64 Ga0070672_100019528 3300005543 Bacteria 4920
65 Ga0070672_100194042 3300005543 Bacteria 1696
66 Ga0070672_100218304 3300005543 Unclassified 1599
67 Ga0070696_100164935 3300005546 Bacteria 1634
68 Ga0070693_100002448 3300005547 Bacteria 8555
69 Ga0070665_100156841 3300005548 Bacteria 2278
70 Ga0070704_100013777 3300005549 Bacteria 5031
71 Ga0070664_100082119 3300005564 Bacteria 2779
72 Ga0070664_100223642 3300005564 Bacteria 1685
73 Ga0068854_100121734 3300005578 Bacteria 1982
74 Ga0068856_100008305 3300005614 Bacteria 10120
75 Ga0070702_100000440 3300005615 Bacteria 14799
76 Ga0070702_100464818 3300005615 Bacteria 921
77 Ga0068852_100024807 3300005616 Bacteria 4850
78 Ga0068859_100004054 3300005617 Bacteria 14935
79 Ga0068859_100033331 3300005617 Bacteria 5172
80 Ga0068859_100102932 3300005617 Bacteria 2913
81 Ga0068864_100084928 3300005618 Bacteria 2782
82 Ga0068864_100255484 3300005618 Bacteria 1628
83 Ga0068864_100529953 3300005618 Bacteria 1136
84 Ga0068861_100035776 3300005719 Bacteria 3681
85 Ga0068861_100420346 3300005719 Bacteria 1191
86 Ga0068870_10018621 3300005840 Bacteria 3356
87 Ga0068870_10186630 3300005840 Bacteria 1248
88 Ga0068863_100039882 3300005841 Bacteria 4466
89 Ga0068863_100054556 3300005841 Bacteria 3786
90 Ga0068860_100016782 3300005843 Bacteria 7137
91 Ga0068862_100036815 3300005844 Bacteria 4147
92 Ga0081455_10145733 3300005937 Bacteria 1832
93 Ga0081538_10075456 3300005981 Bacteria 1829
94 Ga0070717_10030858 3300006028 Bacteria 4307
95 Ga0075432_10075857 3300006058 Bacteria 1213
96 Ga0070715_10037255 3300006163 Bacteria 2012
97 Ga0070716_100004491 3300006173 Bacteria 6676
98 Ga0070712_100002472 3300006175 Bacteria 11391
99 Ga0097621_100030424 3300006237 Bacteria 4273
100 Ga0097621_100089357 3300006237 Bacteria 2576
101 Ga0068871_100042992 3300006358 Bacteria 3629
102 Ga0068871_100043164 3300006358 Bacteria 3622
103 Ga0068871_100085254 3300006358 Bacteria 2623
104 Ga0075428_100000001 3300006844 Bacteria 772630
105 Ga0075428_100256740 3300006844 Bacteria 1883
106 Ga0075428_100534127 3300006844 Bacteria 1254
107 Ga0075431_100089218 3300006847 Bacteria 3183
108 Ga0075433_10030382 3300006852 Bacteria 4609
109 Ga0075433_10082499 3300006852 Bacteria 2835
110 Ga0075434_100277498 3300006871 Bacteria 1695
111 Ga0075436_100003415 3300006914 Bacteria 10893
112 Ga0075436_100017929 3300006914 Bacteria 4848
113 Ga0075436_100074984 3300006914 Bacteria 2342
114 Ga0075436_100315474 3300006914 Bacteria 1122
115 Ga0075436_100319397 3300006914 Bacteria 1115
116 Ga0097620_100004054 3300006931 Bacteria 14935
117 Ga0097620_100033332 3300006931 Bacteria 5172
118 Ga0097620_100102941 3300006931 Bacteria 2913
119 Ga0075435_100013387 3300007076 Bacteria 6100
120 Ga0075435_100355015 3300007076 Bacteria 1257
121 Ga0111539_10022447 3300009094 Bacteria 7754
122 Ga0111539_10126778 3300009094 Bacteria 2990
123 Ga0111539_10145137 3300009094 Bacteria 2779
124 Ga0111539_10255637 3300009094 Bacteria 2040
125 Ga0105245_10057797 3300009098 Bacteria 3490
126 Ga0105245_10525147 3300009098 Bacteria 1203
127 Ga0105245_10741229 3300009098 Bacteria 1018
128 Ga0114129_10118441 3300009147 Bacteria 3648
129 Ga0105241_10008080 3300009174 Bacteria 7741
130 Ga0105242_10835493 3300009176 Bacteria 915
131 Ga0105248_10006308 3300009177 Bacteria 13009
132 Ga0105248_10501259 3300009177 Bacteria 1369
133 Ga0105237_10649403 3300009545 Bacteria 1062
134 Ga0105238_10124894 3300009551 Unclassified 2553
135 Ga0105249_10006106 3300009553 Bacteria 10446
136 Ga0105249_10023073 3300009553 Archaea 5580
137 Ga0105239_10037563 3300010375 Bacteria 5307
138 Ga0105246_10003338 3300011119 Bacteria 9710
139 Ga0105246_10327120 3300011119 Bacteria 1248
140 Ga0157371_10012125 3300013102 Bacteria 6603
141 Ga0157370_10157118 3300013104 Bacteria 2116
142 Ga0157369_10288424 3300013105 Bacteria 1709
143 Ga0157369_10496863 3300013105 Bacteria 1262
144 Ga0157374_10010852 3300013296 Bacteria 7860
145 Ga0157378_10071765 3300013297 Bacteria 3110
146 Ga0163162_10008335 3300013306 Bacteria 10110
147 Ga0157372_10004305 3300013307 Bacteria 15217
148 Ga0157372_10035128 3300013307 Bacteria 5516
149 Ga0157375_10062572 3300013308 Unclassified 3699
150 Ga0163163_10004805 3300014325 Bacteria 11601
151 Ga0163163_10107322 3300014325 Archaea 2819
152 Ga0163163_10128422 3300014325 Bacteria 2574
153 Ga0163163_10259075 3300014325 Bacteria 1790
154 Ga0157380_10011464 3300014326 Bacteria 6407
155 Ga0157380_10055343 3300014326 Unclassified 3150
156 Ga0157380_10571356 3300014326 Unclassified 1113
157 Ga0157377_10008650 3300014745 Bacteria 4970
158 Ga0157379_10545852 3300014968 Bacteria 1078
159 Ga0157376_10013762 3300014969 Bacteria 6049
160 Ga0157376_10066259 3300014969 Bacteria 3053
161 Ga0163161_10001581 3300017792 Bacteria 16785
162 Ga0209566_100090 3300025225 Bacteria 141829
163 Ga0209147_100014 3300025229 Bacteria 597841
164 Ga0209025_1001116 3300025294 Bacteria 38478
165 Ga0207697_10084125 3300025315 Bacteria 1343
166 Ga0207653_10001394 3300025885 Bacteria 7831
167 Ga0207688_10158763 3300025901 Unclassified 1339
168 Ga0207685_10029908 3300025905 Bacteria 1933
169 Ga0207645_10168323 3300025907 Bacteria 1435
170 Ga0207643_10098668 3300025908 Bacteria 1711
171 Ga0207643_10162829 3300025908 Bacteria 1343
172 Ga0207684_10000429 3300025910 Bacteria 55793
173 Ga0207684_10003909 3300025910 Bacteria 14280
174 Ga0207684_10140150 3300025910 Bacteria 2078
175 Ga0207684_10386201 3300025910 Bacteria 1204
176 Ga0207654_10010643 3300025911 Bacteria 4685
177 Ga0207693_10000038 3300025915 Bacteria 109225
178 Ga0207693_10002143 3300025915 Bacteria 17220
179 Ga0207663_10038621 3300025916 Bacteria 2887
180 Ga0207660_10031662 3300025917 Bacteria 3645
181 Ga0207662_10119828 3300025918 Bacteria 1649
182 Ga0207657_10030605 3300025919 Bacteria 4883
183 Ga0207649_10023165 3300025920 Bacteria 3593
184 Ga0207649_10194982 3300025920 Bacteria 1427
185 Ga0207652_10001972 3300025921 Bacteria 17745
186 Ga0207646_10000051 3300025922 Bacteria 170502
187 Ga0207646_10036343 3300025922 Bacteria 4446
188 Ga0207646_10113522 3300025922 Bacteria 2432
189 Ga0207646_10445290 3300025922 Bacteria 1169
190 Ga0207694_10070062 3300025924 Unclassified 2740
191 Ga0207650_10026294 3300025925 Bacteria 4150
192 Ga0207650_10157078 3300025925 Bacteria 1799
193 Ga0207659_10031553 3300025926 Bacteria 3628
194 Ga0207659_10111558 3300025926 Bacteria 2080
195 Ga0207659_10140791 3300025926 Bacteria 1872
196 Ga0207687_10401099 3300025927 Bacteria 1128
197 Ga0207700_10013866 3300025928 Bacteria 5263
198 Ga0207664_10144912 3300025929 Bacteria 2013
199 Ga0207664_10201355 3300025929 Bacteria 1719
200 Ga0207690_10024276 3300025932 Bacteria 3796
201 Ga0207706_10033137 3300025933 Bacteria 4599
202 Ga0207670_10166013 3300025936 Bacteria 1652
203 Ga0207704_10337881 3300025938 Bacteria 1168
204 Ga0207665_10008394 3300025939 Bacteria 6814
205 Ga0207691_10016863 3300025940 Archaea 6930
206 Ga0207691_10085553 3300025940 Bacteria 2830
207 Ga0207711_10006303 3300025941 Bacteria 10005
208 Ga0207711_10226538 3300025941 Bacteria 1711
209 Ga0207711_10581998 3300025941 Bacteria 1044
210 Ga0207689_10002055 3300025942 Bacteria 18994
211 Ga0207689_10061554 3300025942 Bacteria 3087
212 Ga0207689_10459753 3300025942 Bacteria 1064
213 Ga0207661_10018293 3300025944 Bacteria 5205
214 Ga0207661_10035221 3300025944 Bacteria 3898
215 Ga0207661_10117684 3300025944 Bacteria 2258
216 Ga0207679_10004895 3300025945 Bacteria 8349
217 Ga0207679_10247171 3300025945 Bacteria 1514
218 Ga0207667_10091292 3300025949 Bacteria 3146
219 Ga0207651_10100509 3300025960 Bacteria 2144
220 Ga0207712_10114947 3300025961 Bacteria 2025
221 Ga0207712_10115852 3300025961 Bacteria 2018
222 Ga0207668_10022730 3300025972 Bacteria 4020
223 Ga0207668_10157477 3300025972 Bacteria 1766
224 Ga0207677_10017674 3300026023 Bacteria 4260
225 Ga0207703_10115091 3300026035 Viruses 2301
226 Ga0207703_10530043 3300026035 Bacteria 1109
227 Ga0207639_10053159 3300026041 Bacteria 3089
228 Ga0207678_10115949 3300026067 Bacteria 2285
229 Ga0207702_10042121 3300026078 Bacteria 3829
230 Ga0207641_10024641 3300026088 Bacteria 4958
231 Ga0207641_10048511 3300026088 Bacteria 3584
232 Ga0207641_10115076 3300026088 Bacteria 2391
233 Ga0207676_10009808 3300026095 Bacteria 6810
234 Ga0207676_10108883 3300026095 Bacteria 2314
235 Ga0207676_10137865 3300026095 Bacteria 2084
236 Ga0207676_10357477 3300026095 Bacteria 1352
237 Ga0207674_10000387 3300026116 Bacteria 57349
238 Ga0207675_100116446 3300026118 Bacteria 2525
239 Ga0207675_100157715 3300026118 Bacteria 2163
240 Ga0207675_100394694 3300026118 Bacteria 1362
241 Ga0207675_100529184 3300026118 Bacteria 1176
242 Ga0207683_10064087 3300026121 Unclassified 3238
243 Ga0207698_10145562 3300026142 Bacteria 2049
244 Ga0207428_10016512 3300027907 Bacteria 6347
245 Ga0268265_10065930 3300028380 Bacteria 2797
246 Ga0268265_10343075 3300028380 Bacteria 1361
247 Ga0265319_1009098 3300028563 Bacteria 4272
248 Ga0265338_10159742 3300028800 Bacteria 1742
249 Ga0265331_10026647 3300031250 Bacteria 2903
250 Ga0265316_10066823 3300031344 Bacteria 2781
251 Ga0307408_100110500 3300031548 Bacteria 2111
252 Ga0265313_10077865 3300031595 Unclassified 1513
253 Ga0265313_10132607 3300031595 Bacteria 1078
254 Ga0307413_10175536 3300031824 Bacteria 1522
255 Ga0307410_10009124 3300031852 Bacteria 5548
256 Ga0307410_10042105 3300031852 Bacteria 3016
257 Ga0307406_10004225 3300031901 Bacteria 7815
258 Ga0307407_10006367 3300031903 Bacteria 5235
259 Ga0307407_10188866 3300031903 Bacteria 1371
260 Ga0307412_10150772 3300031911 Bacteria 1715
261 Ga0307409_100001866 3300031995 Bacteria 10727
262 Ga0307409_100037487 3300031995 Bacteria 3575
263 Ga0307416_100014348 3300032002 Bacteria 5426
264 Ga0307411_10013373 3300032005 Bacteria 4527
265 Ga0307411_10033951 3300032005 Bacteria 3170
266 Ga0307415_100024531 3300032126 Bacteria 3767
267 Ga0373958_0004757 3300034819 Bacteria 2025
268 Ga0373940_0006724 3300035088 Bacteria 2566
269 Ga0373949_0012729 3300035090 Bacteria 1862
270 Ga0373951_0003092 3300035091 Bacteria 4105
271 Ga0373952_0024861 3300035092 Bacteria 1289
272 Ga0373936_0234769 3300035113 Bacteria 816
273 Ga0373941_0005235 3300035115 Bacteria 3041
274 Ga0373960_0008886 3300035121 Bacteria 2420
275 Ga0373955_0046807 3300035172 Bacteria 2340
276 Ga0373962_0002872 3300035242 Bacteria 4127
277 Ga0373931_0016695 3300035691 Bacteria 3617
278 Ga0373937_0592930 3300036401 Bacteria 1052
279 Ga0395899_0098950 3300037312 Bacteria 2107
280 Ga0395899_0141691 3300037312 Bacteria 1710
281 Ga0395901_0015456 3300038443 Bacteria 7772
282 Ga0439461_0010575 3300041410 Bacteria 1697
283 Ga0451577_0000059 3300042876 Bacteria 271425
284 Ga0451577_0000616 3300042876 Bacteria 57266
285 Ga0451577_0118271 3300042876 Bacteria 2374
286 Ga0451577_0654698 3300042876 Bacteria 952
287 Ga0453683_0000492 3300044673 Bacteria 45269
288 Ga0453684_0000019 3300044712 Bacteria 908702
289 Ga0453684_0001864 3300044712 Bacteria 54966
290 Ga0453684_0173867 3300044712 Bacteria 2535
291 Ga0453684_0199565 3300044712 Bacteria 2333
292 Ga0466960_0084718 3300044901 Bacteria 1604
293 Ga0451576_0157173 3300045051 Bacteria 2372
294 Ga0466958_0236091 3300045836 Bacteria 1168
295 Ga0466967_0164231 3300045976 Bacteria 2086
296 Ga0495641_0003258 3300046461 Bacteria 12277
297 Ga0495596_0020608 3300046500 Bacteria 2698
298 Ga0495608_0088686 3300046511 Bacteria 2002
299 Ga0495620_0015516 3300046515 Bacteria 3844
300 Ga0495644_0003343 3300046523 Bacteria 6341
301 Ga0495609_0140495 3300046538 Bacteria 1031
302 Ga0495656_0040109 3300046615 Bacteria 1950
303 Ga0495668_0003407 3300046616 Bacteria 11940
304 Ga0495657_0121803 3300046675 Bacteria 1642
305 Ga0495658_0074592 3300046683 Bacteria 1977
306 Ga0495600_0148013 3300046809 Bacteria 1521
307 Ga0495686_0000008 3300047472 Bacteria 727479
308 Ga0495686_0078054 3300047472 Bacteria 2027
309 Ga0495686_0108858 3300047472 Bacteria 1664
310 Ga0496101_0002075 3300048904 Bacteria 12204
311 Ga0496102_0424075 3300048905 Bacteria 1249
312 Ga0496104_0141602 3300048907 Bacteria 2310
313 Ga0496105_0021107 3300048908 Bacteria 5268
314 Ga0496105_0273878 3300048908 Bacteria 1362
315 Ga0496106_0045744 3300048909 Bacteria 3288
316 Ga0496106_0080494 3300048909 Bacteria 2501
317 Ga0496107_0035793 3300048910 Bacteria 3560
318 Ga0496109_0210265 3300048912 Bacteria 1829
319 Ga0496109_0469933 3300048912 Bacteria 1188
320 Ga0496112_0084652 3300048915 Bacteria 3137
321 Ga0496113_0295506 3300048916 Bacteria 1296
322 Ga0496114_0007259 3300048917 Bacteria 8752
323 Ga0496115_0155302 3300048918 Bacteria 1890
324 Ga0496116_0022123 3300048919 Bacteria 4777
325 Ga0496119_0067849 3300048922 Bacteria 2102
326 Ga0496119_0169289 3300048922 Bacteria 1155
327 Ga0496121_0195071 3300048924 Bacteria 1448
328 Ga0496122_0012337 3300048925 Bacteria 8528
329 Ga0496123_0002924 3300048926 Bacteria 19985
330 Ga0496124_0001026 3300048927 Bacteria 44181
331 Ga0496125_0001387 3300048928 Bacteria 35448
332 Ga0501305_001848 3300049161 Bacteria 2169
333 Ga0501311_001172 3300049527 Bacteria 2197
334 Ga0501312_010208 3300049528 Bacteria 1253
335 Ga0501031_0004242 3300049568 Bacteria 9256
336 Ga0501033_0059449 3300049570 Bacteria 2822
337 Ga0501033_0077065 3300049570 Bacteria 2447
338 Ga0501034_0431587 3300049571 Bacteria 1237
339 Ga0501036_0007239 3300049572 Bacteria 9034
340 Ga0501037_0056410 3300049573 Bacteria 2869
341 Ga0501038_0039004 3300049574 Bacteria 4157
342 Ga0501038_0230144 3300049574 Bacteria 1475
343 Ga0501039_0007074 3300049575 Bacteria 8547
344 Ga0501040_0019981 3300049576 Bacteria 4459
345 Ga0501040_0153369 3300049576 Bacteria 1626
346 Ga0501040_0167053 3300049576 Bacteria 1557
347 Ga0501041_0006796 3300049577 Bacteria 6703
348 Ga0501042_0004585 3300049578 Bacteria 8821
349 Ga0501046_0006306 3300049580 Bacteria 10514
350 Ga0501046_0149417 3300049580 Bacteria 1763
351 Ga0501047_0220427 3300049581 Bacteria 1753
352 Ga0501048_0002095 3300049582 Bacteria 15206
353 Ga0501067_0234096 3300049583 Bacteria 1022
354 Ga0501068_0165938 3300049584 Bacteria 1393
355 Ga0501070_0095668 3300049586 Bacteria 2457
356 Ga0501071_0003920 3300049587 Bacteria 9380
357 Ga0501071_0111277 3300049587 Bacteria 2024
358 Ga0501072_0003243 3300049588 Bacteria 12219
359 Ga0501072_0008175 3300049588 Bacteria 7942
360 Ga0501074_0069810 3300049590 Bacteria 2526
361 Ga0501074_0200774 3300049590 Bacteria 1421
362 Ga0501074_0386983 3300049590 Bacteria 992
363 Ga0501075_0001625 3300049591 Bacteria 14750
364 Ga0501075_0372940 3300049591 Bacteria 1088
365 Ga0501076_0015739 3300049592 Bacteria 5720
366 Ga0501079_0028642 3300049741 Bacteria 4274
367 Ga0501081_0006433 3300049743 Bacteria 7622
368 Ga0501081_0134852 3300049743 Bacteria 1767
369 Ga0501081_0196300 3300049743 Bacteria 1463
370 Ga0501083_0252562 3300049744 Bacteria 1148
371 Ga0501083_0298529 3300049744 Bacteria 1048
372 Ga0501035_0022374 3300049822 Bacteria 5805
373 Ga0501044_0012189 3300049823 Bacteria 9306
374 Ga0501045_0003479 3300049824 Bacteria 10773
375 nmdc:mga05p37_95877_c1 3300050507 Bacteria 3655
376 nmdc:mga06r32_77113_c1 3300050510 Bacteria 3237
377 nmdc:mga08y16_35421_c1 3300050511 Bacteria 5241
378 nmdc:mga08y16_61138_c1 3300050511 Bacteria 3933
379 nmdc:mga0n895_62007_c1 3300050512 Bacteria 3694
380 nmdc:mga0rr50_102281_c1 3300050513 Bacteria 2253
381 nmdc:mga0rr50_11558_c1 3300050513 Bacteria 5658
382 nmdc:mga0rr50_39281_c1 3300050513 Bacteria 3432
383 nmdc:mga08x19_113209_c1 3300050514 Bacteria 1812
384 nmdc:mga08x19_152885_c1 3300050514 Bacteria 1564
385 nmdc:mga08x19_277003_c1 3300050514 Bacteria 1162
386 nmdc:mga08x19_39458_c1 3300050514 Bacteria 3002
387 nmdc:mga08x19_43605_c1 3300050514 Bacteria 2862
388 nmdc:mga08x19_57643_c1 3300050514 Bacteria 2511
389 nmdc:mga0a205_73806_c1 3300050515 Bacteria 3296
390 nmdc:mga0a205_83270_c1 3300050515 Bacteria 3090
391 Ga0495612_0000058 3300053078 Bacteria 49549
392 Ga0495619_0047860 3300053085 Bacteria 2817
393 Ga0500616_0114942 3300053153 Bacteria 1294
394 Ga0501084_0009878 3300054114 Bacteria 7887
395 Ga0501084_0207817 3300054114 Bacteria 1652
396 Ga0587079_024630 3300059647 Bacteria 1111
397 Ga0501082_0028240 3300060353 Bacteria 4834
398 Ga0530510_0011562 3300061734 Bacteria 6195
399 Ga0530510_0114568 3300061734 Bacteria 1976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046500 Ga0495596_0020608 Ga0495596_0020608_236_1144 218
2 3300046515 Ga0495620_0015516 Ga0495620_0015516_761_1669 218
3 3300046523 Ga0495644_0003343 Ga0495644_0003343_329_1237 218
4 3300047472 Ga0495686_0108858 Ga0495686_0108858_215_1150 225
5 3300005471 Ga0070698_100098033 Ga0070698_1000980334 226
6 3300035092 Ga0373952_0024861 Ga0373952_0024861_543_1277 226
7 3300041410 Ga0439461_0010575 Ga0439461_0010575_60_749 226
8 3300046615 Ga0495656_0040109 Ga0495656_0040109_717_1406 226
9 3300048915 Ga0496112_0084652 Ga0496112_0084652_1424_2113 226
10 3300049584 Ga0501068_0165938 Ga0501068_0165938_675_1367 226
11 3300049586 Ga0501070_0095668 Ga0501070_0095668_1709_2401 226
12 3300049590 Ga0501074_0386983 Ga0501074_0386983_242_934 226
13 3300049591 Ga0501075_0372940 Ga0501075_0372940_340_1029 226
14 3300005471 Ga0070698_100002624 Ga0070698_1000026244 227
15 3300050513 nmdc:mga0rr50_102281_c1 nmdc:mga0rr50_102281_c1_456_1229 228
16 3300050514 nmdc:mga08x19_57643_c1 nmdc:mga08x19_57643_c1_292_1065 228
17 3300047472 Ga0495686_0000008 Ga0495686_0000008_309510_310418 232
18 3300049588 Ga0501072_0003243 Ga0501072_0003243_11492_12208 235
19 3300045976 Ga0466967_0164231 Ga0466967_0164231_1253_2035 238
20 3300035113 Ga0373936_0234769 Ga0373936_0234769_36_797 239
21 3300042876 Ga0451577_0654698 Ga0451577_0654698_210_941 242
22 3300046461 Ga0495641_0003258 Ga0495641_0003258_2833_3741 242
23 3300013104 Ga0157370_10157118 Ga0157370_101571183 243
24 3300005445 Ga0070708_100133330 Ga0070708_1001333303 246
25 3300031995 Ga0307409_100037487 Ga0307409_1000374872 246
26 3300005467 Ga0070706_100015981 Ga0070706_1000159812 249
27 3300005536 Ga0070697_100010414 Ga0070697_10001041410 249
28 3300006058 Ga0075432_10075857 Ga0075432_100758572 249
29 3300006847 Ga0075431_100089218 Ga0075431_1000892182 249
30 3300006852 Ga0075433_10082499 Ga0075433_100824992 249
31 3300006871 Ga0075434_100277498 Ga0075434_1002774982 249
32 3300007076 Ga0075435_100013387 Ga0075435_1000133875 249
33 3300009094 Ga0111539_10022447 Ga0111539_100224473 249
34 3300009147 Ga0114129_10118441 Ga0114129_101184413 249
35 3300027907 Ga0207428_10016512 Ga0207428_100165125 249
36 3300044901 Ga0466960_0084718 Ga0466960_0084718_21_788 249
37 3300048922 Ga0496119_0067849 Ga0496119_0067849_1310_2077 249
38 3300050507 nmdc:mga05p37_95877_c1 nmdc:mga05p37_95877_c1_1159_1920 249
39 3300050510 nmdc:mga06r32_77113_c1 nmdc:mga06r32_77113_c1_434_1195 249
40 3300050511 nmdc:mga08y16_35421_c1 nmdc:mga08y16_35421_c1_2813_3574 249
41 3300050512 nmdc:mga0n895_62007_c1 nmdc:mga0n895_62007_c1_2455_3216 249
42 3300050513 nmdc:mga0rr50_39281_c1 nmdc:mga0rr50_39281_c1_242_1003 249
43 3300050514 nmdc:mga08x19_113209_c1 nmdc:mga08x19_113209_c1_899_1660 249
44 3300050515 nmdc:mga0a205_83270_c1 nmdc:mga0a205_83270_c1_38_799 249
45 3300053153 Ga0500616_0114942 Ga0500616_0114942_475_1245 249
46 3300005444 Ga0070694_100024610 Ga0070694_1000246102 250
47 3300005518 Ga0070699_100043101 Ga0070699_1000431014 250
48 3300005546 Ga0070696_100164935 Ga0070696_1001649352 250
49 3300006175 Ga0070712_100002472 Ga0070712_1000024728 250
50 3300006852 Ga0075433_10030382 Ga0075433_100303823 250
51 3300006914 Ga0075436_100017929 Ga0075436_1000179294 250
52 3300009098 Ga0105245_10741229 Ga0105245_107412292 250
53 3300013297 Ga0157378_10071765 Ga0157378_100717654 250
54 3300014969 Ga0157376_10066259 Ga0157376_100662591 250
55 3300025885 Ga0207653_10001394 Ga0207653_100013941 250
56 3300025915 Ga0207693_10002143 Ga0207693_1000214310 250
57 3300025916 Ga0207663_10038621 Ga0207663_100386213 250
58 3300025939 Ga0207665_10008394 Ga0207665_100083946 250
59 3300034819 Ga0373958_0004757 Ga0373958_0004757_790_1758 250
60 3300035088 Ga0373940_0006724 Ga0373940_0006724_94_900 250
61 3300035090 Ga0373949_0012729 Ga0373949_0012729_117_923 250
62 3300035091 Ga0373951_0003092 Ga0373951_0003092_398_1204 250
63 3300035115 Ga0373941_0005235 Ga0373941_0005235_59_865 250
64 3300035121 Ga0373960_0008886 Ga0373960_0008886_1296_2102 250
65 3300035242 Ga0373962_0002872 Ga0373962_0002872_551_1357 250
66 3300035691 Ga0373931_0016695 Ga0373931_0016695_86_892 250
67 3300046538 Ga0495609_0140495 Ga0495609_0140495_186_977 250
68 3300048905 Ga0496102_0424075 Ga0496102_0424075_322_1128 250
69 3300048908 Ga0496105_0273878 Ga0496105_0273878_126_932 250
70 3300048909 Ga0496106_0080494 Ga0496106_0080494_1374_2180 250
71 3300048912 Ga0496109_0210265 Ga0496109_0210265_73_879 250
72 3300048916 Ga0496113_0295506 Ga0496113_0295506_169_975 250
73 3300048918 Ga0496115_0155302 Ga0496115_0155302_318_1124 250
74 3300050513 nmdc:mga0rr50_11558_c1 nmdc:mga0rr50_11558_c1_87_893 250
75 3300050514 nmdc:mga08x19_43605_c1 nmdc:mga08x19_43605_c1_175_981 250
76 3300050515 nmdc:mga0a205_73806_c1 nmdc:mga0a205_73806_c1_357_1163 250
77 3300005440 Ga0070705_100415245 Ga0070705_1004152452 251
78 3300006173 Ga0070716_100004491 Ga0070716_10000449112 251
79 3300046675 Ga0495657_0121803 Ga0495657_0121803_705_1469 251
80 3300005334 Ga0068869_100416586 Ga0068869_1004165862 252
81 3300005354 Ga0070675_100147905 Ga0070675_1001479053 252
82 3300005441 Ga0070700_100215424 Ga0070700_1002154242 252
83 3300005543 Ga0070672_100218304 Ga0070672_1002183042 252
84 3300005548 Ga0070665_100156841 Ga0070665_1001568412 252
85 3300014326 Ga0157380_10011464 Ga0157380_100114647 252
86 3300025901 Ga0207688_10158763 Ga0207688_101587632 252
87 3300025915 Ga0207693_10000038 Ga0207693_1000003858 252
88 3300025926 Ga0207659_10111558 Ga0207659_101115581 252
89 3300025928 Ga0207700_10013866 Ga0207700_100138669 252
90 3300044712 Ga0453684_0199565 Ga0453684_0199565_1515_2279 252
91 3300049568 Ga0501031_0004242 Ga0501031_0004242_3488_4258 252
92 3300049570 Ga0501033_0077065 Ga0501033_0077065_1414_2184 252
93 3300049572 Ga0501036_0007239 Ga0501036_0007239_3459_4229 252
94 3300049573 Ga0501037_0056410 Ga0501037_0056410_1890_2660 252
95 3300049574 Ga0501038_0039004 Ga0501038_0039004_1814_2584 252
96 3300049575 Ga0501039_0007074 Ga0501039_0007074_3024_3794 252
97 3300049576 Ga0501040_0019981 Ga0501040_0019981_1249_2019 252
98 3300049576 Ga0501040_0153369 Ga0501040_0153369_788_1552 252
99 3300049577 Ga0501041_0006796 Ga0501041_0006796_3026_3796 252
100 3300049578 Ga0501042_0004585 Ga0501042_0004585_3016_3786 252
101 3300049580 Ga0501046_0006306 Ga0501046_0006306_4827_5597 252
102 3300049582 Ga0501048_0002095 Ga0501048_0002095_13788_14558 252
103 3300049587 Ga0501071_0003920 Ga0501071_0003920_3983_4753 252
104 3300049587 Ga0501071_0111277 Ga0501071_0111277_1090_1854 252
105 3300049588 Ga0501072_0008175 Ga0501072_0008175_3506_4276 252
106 3300049590 Ga0501074_0069810 Ga0501074_0069810_502_1272 252
107 3300049591 Ga0501075_0001625 Ga0501075_0001625_715_1485 252
108 3300049592 Ga0501076_0015739 Ga0501076_0015739_2897_3667 252
109 3300049741 Ga0501079_0028642 Ga0501079_0028642_1909_2679 252
110 3300049743 Ga0501081_0006433 Ga0501081_0006433_1935_2705 252
111 3300049743 Ga0501081_0134852 Ga0501081_0134852_708_1472 252
112 3300049744 Ga0501083_0252562 Ga0501083_0252562_49_816 252
113 3300049824 Ga0501045_0003479 Ga0501045_0003479_3667_4437 252
114 3300054114 Ga0501084_0009878 Ga0501084_0009878_3217_3987 252
115 3300060353 Ga0501082_0028240 Ga0501082_0028240_393_1163 252
116 3300061734 Ga0530510_0011562 Ga0530510_0011562_5311_6081 252
117 3300061734 Ga0530510_0114568 Ga0530510_0114568_865_1629 252
118 3300049576 Ga0501040_0167053 Ga0501040_0167053_610_1380 253
119 3300049580 Ga0501046_0149417 Ga0501046_0149417_728_1498 253
120 3300049743 Ga0501081_0196300 Ga0501081_0196300_383_1153 253
121 3300054114 Ga0501084_0207817 Ga0501084_0207817_661_1431 253
122 3300049744 Ga0501083_0298529 Ga0501083_0298529_49_825 255
123 3300003320 rootH2_10031334 rootH2_100313344 257
124 3300005467 Ga0070706_100000664 Ga0070706_10000066419 260
125 3300005471 Ga0070698_100020098 Ga0070698_1000200984 260
126 3300025910 Ga0207684_10000429 Ga0207684_100004297 260
127 3300031344 Ga0265316_10066823 Ga0265316_100668232 263
128 3300047472 Ga0495686_0078054 Ga0495686_0078054_455_1396 264
129 3300006844 Ga0075428_100000001 Ga0075428_100000001152 265
130 3300006914 Ga0075436_100003415 Ga0075436_1000034154 265
131 3300006914 Ga0075436_100074984 Ga0075436_1000749842 265
132 3300009098 Ga0105245_10525147 Ga0105245_105251472 265
133 3300025929 Ga0207664_10144912 Ga0207664_101449122 265
134 3300046683 Ga0495658_0074592 Ga0495658_0074592_241_1080 265
135 3300048904 Ga0496101_0002075 Ga0496101_0002075_1220_2059 265
136 3300048907 Ga0496104_0141602 Ga0496104_0141602_601_1440 265
137 3300048908 Ga0496105_0021107 Ga0496105_0021107_653_1492 265
138 3300048909 Ga0496106_0045744 Ga0496106_0045744_463_1302 265
139 3300048910 Ga0496107_0035793 Ga0496107_0035793_1730_2569 265
140 3300048917 Ga0496114_0007259 Ga0496114_0007259_4875_5714 265
141 3300050514 nmdc:mga08x19_152885_c1 nmdc:mga08x19_152885_c1_531_1340 265
142 3300050514 nmdc:mga08x19_39458_c1 nmdc:mga08x19_39458_c1_1194_2003 265
143 3300005467 Ga0070706_100004046 Ga0070706_1000040467 267
144 3300005467 Ga0070706_100043167 Ga0070706_1000431673 267
145 3300005467 Ga0070706_100158392 Ga0070706_1001583922 267
146 3300005471 Ga0070698_100092849 Ga0070698_1000928492 267
147 3300005518 Ga0070699_100052362 Ga0070699_1000523623 267
148 3300005518 Ga0070699_100189905 Ga0070699_1001899052 267
149 3300005536 Ga0070697_100230030 Ga0070697_1002300302 267
150 3300005937 Ga0081455_10145733 Ga0081455_101457332 267
151 3300006028 Ga0070717_10030858 Ga0070717_100308582 267
152 3300006163 Ga0070715_10037255 Ga0070715_100372552 267
153 3300006358 Ga0068871_100085254 Ga0068871_1000852542 267
154 3300006914 Ga0075436_100315474 Ga0075436_1003154741 267
155 3300006914 Ga0075436_100319397 Ga0075436_1003193971 267
156 3300009094 Ga0111539_10145137 Ga0111539_101451374 267
157 3300025905 Ga0207685_10029908 Ga0207685_100299082 267
158 3300025910 Ga0207684_10140150 Ga0207684_101401502 267
159 3300025910 Ga0207684_10386201 Ga0207684_103862012 267
160 3300025922 Ga0207646_10000051 Ga0207646_1000005186 267
161 3300025922 Ga0207646_10036343 Ga0207646_100363434 267
162 3300025922 Ga0207646_10113522 Ga0207646_101135223 267
163 3300025922 Ga0207646_10445290 Ga0207646_104452902 267
164 3300025929 Ga0207664_10201355 Ga0207664_102013552 267
165 3300035172 Ga0373955_0046807 Ga0373955_0046807_1114_1959 267
166 3300036401 Ga0373937_0592930 Ga0373937_0592930_65_910 267
167 3300050514 nmdc:mga08x19_277003_c1 nmdc:mga08x19_277003_c1_258_1073 267
168 3300005334 Ga0068869_100008059 Ga0068869_1000080597 271
169 3300005337 Ga0070682_100003788 Ga0070682_1000037889 271
170 3300005564 Ga0070664_100223642 Ga0070664_1002236422 271
171 3300005340 Ga0070689_100107864 Ga0070689_1001078642 272
172 3300005365 Ga0070688_100032871 Ga0070688_1000328711 272
173 3300005367 Ga0070667_100058340 Ga0070667_1000583405 272
174 3300005466 Ga0070685_10099762 Ga0070685_100997622 272
175 3300005471 Ga0070698_100422308 Ga0070698_1004223081 272
176 3300005617 Ga0068859_100033331 Ga0068859_1000333315 272
177 3300005618 Ga0068864_100084928 Ga0068864_1000849283 272
178 3300005618 Ga0068864_100529953 Ga0068864_1005299531 272
179 3300005719 Ga0068861_100420346 Ga0068861_1004203461 272
180 3300005844 Ga0068862_100036815 Ga0068862_1000368153 272
181 3300006237 Ga0097621_100089357 Ga0097621_1000893574 272
182 3300006931 Ga0097620_100033332 Ga0097620_1000333324 272
183 3300009553 Ga0105249_10023073 Ga0105249_100230734 272
184 3300014325 Ga0163163_10259075 Ga0163163_102590752 272
185 3300025926 Ga0207659_10140791 Ga0207659_101407913 272
186 3300025936 Ga0207670_10166013 Ga0207670_101660132 272
187 3300025941 Ga0207711_10581998 Ga0207711_105819982 272
188 3300025945 Ga0207679_10247171 Ga0207679_102471712 272
189 3300025961 Ga0207712_10115852 Ga0207712_101158522 272
190 3300026035 Ga0207703_10115091 Ga0207703_101150912 272
191 3300026035 Ga0207703_10530043 Ga0207703_105300431 272
192 3300026067 Ga0207678_10115949 Ga0207678_101159493 272
193 3300026088 Ga0207641_10048511 Ga0207641_100485115 272
194 3300026088 Ga0207641_10115076 Ga0207641_101150763 272
195 3300026095 Ga0207676_10108883 Ga0207676_101088833 272
196 3300026095 Ga0207676_10137865 Ga0207676_101378652 272
197 3300031824 Ga0307413_10175536 Ga0307413_101755362 272
198 3300049590 Ga0501074_0200774 Ga0501074_0200774_561_1388 272
199 3300038443 Ga0395901_0015456 Ga0395901_0015456_5652_6521 273
200 iso_pu_bacteria 2883821847 2883825149 273
201 3300031595 Ga0265313_10132607 Ga0265313_101326071 274
202 3300005981 Ga0081538_10075456 Ga0081538_100754562 275
203 3300053085 Ga0495619_0047860 Ga0495619_0047860_891_1790 275
204 3300007076 Ga0075435_100355015 Ga0075435_1003550151 276
205 iso_pu_bacteria 2512564039 2512732570 277
206 iso_pu_bacteria 2593339131 2595087768 277
207 iso_pu_bacteria 2671180694 2673823676 277
208 iso_pu_bacteria 2757320391 2757565754 277
209 iso_pu_bacteria 2775507177 2777761325 277
210 iso_pu_bacteria 2775507192 2777839111 277
211 iso_pu_bacteria 2791355222 2793184445 277
212 iso_pu_bacteria 2864997549 2865001865 277
213 iso_pu_bacteria 2865002811 2865003730 277
214 iso_pu_bacteria 2888578766 2888581209 277
215 iso_pu_bacteria 2889049205 2889050112 277
216 iso_pu_bacteria 2889295896 2889297131 277
217 iso_pu_bacteria 2936340661 2936341628 277
218 iso_pu_bacteria 2956897341 2956898100 277
219 iso_pu_bacteria 2964375228 2964377221 277
220 iso_pu_bacteria 2981289755 2981290557 277
221 iso_pu_bacteria 2981980479 2981980820 277
222 iso_pu_bacteria 2981985349 2981985699 277
223 3300005334 Ga0068869_100407128 Ga0068869_1004071281 278
224 3300005339 Ga0070660_100164596 Ga0070660_1001645962 278
225 3300005366 Ga0070659_100108168 Ga0070659_1001081683 278
226 3300005564 Ga0070664_100082119 Ga0070664_1000821194 278
227 3300005578 Ga0068854_100121734 Ga0068854_1001217342 278
228 3300005615 Ga0070702_100464818 Ga0070702_1004648181 278
229 3300011119 Ga0105246_10327120 Ga0105246_103271201 278
230 3300025920 Ga0207649_10194982 Ga0207649_101949822 278
231 3300025927 Ga0207687_10401099 Ga0207687_104010992 278
232 3300025938 Ga0207704_10337881 Ga0207704_103378812 278
233 3300025942 Ga0207689_10459753 Ga0207689_104597532 278
234 3300026118 Ga0207675_100529184 Ga0207675_1005291841 278
235 3300028563 Ga0265319_1009098 Ga0265319_10090985 278
236 3300031250 Ga0265331_10026647 Ga0265331_100266472 278
237 3300048912 Ga0496109_0469933 Ga0496109_0469933_159_1016 278
238 3300048924 Ga0496121_0195071 Ga0496121_0195071_36_890 278
239 3300028800 Ga0265338_10159742 Ga0265338_101597422 279
240 3300031595 Ga0265313_10077865 Ga0265313_100778652 279
241 3300042876 Ga0451577_0000059 Ga0451577_0000059_230723_231565 279
242 3300044712 Ga0453684_0000019 Ga0453684_0000019_320814_321656 279
243 3300003841 Ga0055541_1009378 Ga0055541_10093782 280
244 3300005329 Ga0070683_100034031 Ga0070683_1000340314 280
245 3300005331 Ga0070670_100001860 Ga0070670_10000186011 280
246 3300005336 Ga0070680_100003697 Ga0070680_1000036976 280
247 3300005338 Ga0068868_100058483 Ga0068868_1000584833 280
248 3300005339 Ga0070660_100016760 Ga0070660_1000167602 280
249 3300005343 Ga0070687_100096176 Ga0070687_1000961762 280
250 3300005344 Ga0070661_100007432 Ga0070661_1000074326 280
251 3300005344 Ga0070661_100273295 Ga0070661_1002732952 280
252 3300005354 Ga0070675_100006099 Ga0070675_1000060996 280
253 3300005364 Ga0070673_100061328 Ga0070673_1000613282 280
254 3300005366 Ga0070659_100004529 Ga0070659_1000045296 280
255 3300005530 Ga0070679_100040637 Ga0070679_1000406372 280
256 3300005535 Ga0070684_100017053 Ga0070684_1000170535 280
257 3300005535 Ga0070684_100017794 Ga0070684_1000177946 280
258 3300005535 Ga0070684_100241438 Ga0070684_1002414382 280
259 3300005539 Ga0068853_100068463 Ga0068853_1000684633 280
260 3300005547 Ga0070693_100002448 Ga0070693_1000024487 280
261 3300005614 Ga0068856_100008305 Ga0068856_1000083053 280
262 3300005615 Ga0070702_100000440 Ga0070702_1000004408 280
263 3300005616 Ga0068852_100024807 Ga0068852_1000248072 280
264 3300005617 Ga0068859_100004054 Ga0068859_10000405411 280
265 3300005840 Ga0068870_10186630 Ga0068870_101866302 280
266 3300005841 Ga0068863_100039882 Ga0068863_1000398823 280
267 3300005843 Ga0068860_100016782 Ga0068860_1000167826 280
268 3300006237 Ga0097621_100030424 Ga0097621_1000304244 280
269 3300006358 Ga0068871_100043164 Ga0068871_1000431643 280
270 3300006931 Ga0097620_100004054 Ga0097620_1000040542 280
271 3300009098 Ga0105245_10057797 Ga0105245_100577972 280
272 3300009174 Ga0105241_10008080 Ga0105241_100080806 280
273 3300009177 Ga0105248_10006308 Ga0105248_100063086 280
274 3300009545 Ga0105237_10649403 Ga0105237_106494031 280
275 3300009551 Ga0105238_10124894 Ga0105238_101248942 280
276 3300010375 Ga0105239_10037563 Ga0105239_100375633 280
277 3300011119 Ga0105246_10003338 Ga0105246_100033386 280
278 3300013102 Ga0157371_10012125 Ga0157371_100121253 280
279 3300013105 Ga0157369_10288424 Ga0157369_102884242 280
280 3300013105 Ga0157369_10496863 Ga0157369_104968632 280
281 3300013296 Ga0157374_10010852 Ga0157374_100108526 280
282 3300013307 Ga0157372_10004305 Ga0157372_1000430511 280
283 3300014325 Ga0163163_10004805 Ga0163163_100048058 280
284 3300014745 Ga0157377_10008650 Ga0157377_100086506 280
285 3300014968 Ga0157379_10545852 Ga0157379_105458521 280
286 3300014969 Ga0157376_10013762 Ga0157376_100137626 280
287 3300025225 Ga0209566_100090 Ga0209566_100090147 280
288 3300025315 Ga0207697_10084125 Ga0207697_100841252 280
289 3300025908 Ga0207643_10162829 Ga0207643_101628292 280
290 3300025911 Ga0207654_10010643 Ga0207654_100106432 280
291 3300025917 Ga0207660_10031662 Ga0207660_100316622 280
292 3300025918 Ga0207662_10119828 Ga0207662_101198282 280
293 3300025919 Ga0207657_10030605 Ga0207657_100306052 280
294 3300025920 Ga0207649_10023165 Ga0207649_100231653 280
295 3300025921 Ga0207652_10001972 Ga0207652_1000197216 280
296 3300025924 Ga0207694_10070062 Ga0207694_100700623 280
297 3300025926 Ga0207659_10031553 Ga0207659_100315534 280
298 3300025932 Ga0207690_10024276 Ga0207690_100242763 280
299 3300025933 Ga0207706_10033137 Ga0207706_100331373 280
300 3300025941 Ga0207711_10006303 Ga0207711_100063037 280
301 3300025942 Ga0207689_10002055 Ga0207689_100020557 280
302 3300025944 Ga0207661_10018293 Ga0207661_100182934 280
303 3300025944 Ga0207661_10035221 Ga0207661_100352212 280
304 3300025944 Ga0207661_10117684 Ga0207661_101176843 280
305 3300025945 Ga0207679_10004895 Ga0207679_100048952 280
306 3300025949 Ga0207667_10091292 Ga0207667_100912922 280
307 3300025960 Ga0207651_10100509 Ga0207651_101005092 280
308 3300026023 Ga0207677_10017674 Ga0207677_100176743 280
309 3300026041 Ga0207639_10053159 Ga0207639_100531593 280
310 3300026078 Ga0207702_10042121 Ga0207702_100421213 280
311 3300026088 Ga0207641_10024641 Ga0207641_100246413 280
312 3300026095 Ga0207676_10009808 Ga0207676_100098086 280
313 3300026116 Ga0207674_10000387 Ga0207674_1000038739 280
314 3300026142 Ga0207698_10145562 Ga0207698_101455622 280
315 3300046511 Ga0495608_0088686 Ga0495608_0088686_593_1534 280
316 3300046809 Ga0495600_0148013 Ga0495600_0148013_273_1214 280
317 3300049570 Ga0501033_0059449 Ga0501033_0059449_1522_2370 280
318 3300049571 Ga0501034_0431587 Ga0501034_0431587_68_916 280
319 3300049574 Ga0501038_0230144 Ga0501038_0230144_265_1113 280
320 3300049581 Ga0501047_0220427 Ga0501047_0220427_839_1687 280
321 3300049583 Ga0501067_0234096 Ga0501067_0234096_17_901 280
322 3300049822 Ga0501035_0022374 Ga0501035_0022374_4652_5500 280
323 3300049823 Ga0501044_0012189 Ga0501044_0012189_1609_2457 280
324 3300053078 Ga0495612_0000058 Ga0495612_0000058_13018_13968 280
325 iso_pu_bacteria 2898907183 2898909774 280
326 3300003187 JGI25151J46595_10005200 JGI25151J46595_100052007 281
327 3300003758 Ga0055532_1000064 Ga0055532_100006423 281
328 3300003758 Ga0055532_1000216 Ga0055532_100021632 281
329 3300005289 Ga0065704_10152088 Ga0065704_101520882 281
330 3300005295 Ga0065707_10096095 Ga0065707_100960954 281
331 3300005328 Ga0070676_10105050 Ga0070676_101050502 281
332 3300005331 Ga0070670_100012602 Ga0070670_1000126022 281
333 3300005331 Ga0070670_100041025 Ga0070670_1000410253 281
334 3300005331 Ga0070670_100185319 Ga0070670_1001853193 281
335 3300005347 Ga0070668_100135376 Ga0070668_1001353762 281
336 3300005354 Ga0070675_100061763 Ga0070675_1000617633 281
337 3300005354 Ga0070675_100156355 Ga0070675_1001563552 281
338 3300005467 Ga0070706_100009421 Ga0070706_1000094217 281
339 3300005467 Ga0070706_100133604 Ga0070706_1001336042 281
340 3300005536 Ga0070697_100002705 Ga0070697_10000270511 281
341 3300005543 Ga0070672_100019528 Ga0070672_1000195282 281
342 3300005543 Ga0070672_100194042 Ga0070672_1001940422 281
343 3300005549 Ga0070704_100013777 Ga0070704_1000137775 281
344 3300005617 Ga0068859_100102932 Ga0068859_1001029324 281
345 3300005618 Ga0068864_100255484 Ga0068864_1002554842 281
346 3300005719 Ga0068861_100035776 Ga0068861_1000357763 281
347 3300005840 Ga0068870_10018621 Ga0068870_100186212 281
348 3300005841 Ga0068863_100054556 Ga0068863_1000545564 281
349 3300006358 Ga0068871_100042992 Ga0068871_1000429923 281
350 3300006844 Ga0075428_100256740 Ga0075428_1002567402 281
351 3300006844 Ga0075428_100534127 Ga0075428_1005341272 281
352 3300006931 Ga0097620_100102941 Ga0097620_1001029414 281
353 3300009094 Ga0111539_10126778 Ga0111539_101267783 281
354 3300009094 Ga0111539_10255637 Ga0111539_102556372 281
355 3300009176 Ga0105242_10835493 Ga0105242_108354931 281
356 3300009177 Ga0105248_10501259 Ga0105248_105012592 281
357 3300009553 Ga0105249_10006106 Ga0105249_100061062 281
358 3300013306 Ga0163162_10008335 Ga0163162_100083358 281
359 3300013307 Ga0157372_10035128 Ga0157372_100351284 281
360 3300013308 Ga0157375_10062572 Ga0157375_100625725 281
361 3300014325 Ga0163163_10107322 Ga0163163_101073223 281
362 3300014325 Ga0163163_10128422 Ga0163163_101284222 281
363 3300014326 Ga0157380_10055343 Ga0157380_100553434 281
364 3300014326 Ga0157380_10571356 Ga0157380_105713561 281
365 3300017792 Ga0163161_10001581 Ga0163161_1000158119 281
366 3300025229 Ga0209147_100014 Ga0209147_100014546 281
367 3300025294 Ga0209025_1001116 Ga0209025_100111626 281
368 3300025907 Ga0207645_10168323 Ga0207645_101683232 281
369 3300025908 Ga0207643_10098668 Ga0207643_100986683 281
370 3300025910 Ga0207684_10003909 Ga0207684_100039098 281
371 3300025925 Ga0207650_10026294 Ga0207650_100262946 281
372 3300025925 Ga0207650_10157078 Ga0207650_101570782 281
373 3300025940 Ga0207691_10016863 Ga0207691_100168636 281
374 3300025940 Ga0207691_10085553 Ga0207691_100855534 281
375 3300025941 Ga0207711_10226538 Ga0207711_102265382 281
376 3300025942 Ga0207689_10061554 Ga0207689_100615543 281
377 3300025961 Ga0207712_10114947 Ga0207712_101149472 281
378 3300025972 Ga0207668_10022730 Ga0207668_100227306 281
379 3300025972 Ga0207668_10157477 Ga0207668_101574772 281
380 3300026095 Ga0207676_10357477 Ga0207676_103574772 281
381 3300026118 Ga0207675_100116446 Ga0207675_1001164462 281
382 3300026118 Ga0207675_100157715 Ga0207675_1001577152 281
383 3300026118 Ga0207675_100394694 Ga0207675_1003946942 281
384 3300026121 Ga0207683_10064087 Ga0207683_100640874 281
385 3300028380 Ga0268265_10065930 Ga0268265_100659302 281
386 3300028380 Ga0268265_10343075 Ga0268265_103430752 281
387 3300031548 Ga0307408_100110500 Ga0307408_1001105002 281
388 3300031852 Ga0307410_10009124 Ga0307410_100091245 281
389 3300031852 Ga0307410_10042105 Ga0307410_100421053 281
390 3300031901 Ga0307406_10004225 Ga0307406_100042257 281
391 3300031903 Ga0307407_10006367 Ga0307407_100063674 281
392 3300031903 Ga0307407_10188866 Ga0307407_101888661 281
393 3300031911 Ga0307412_10150772 Ga0307412_101507722 281
394 3300031995 Ga0307409_100001866 Ga0307409_10000186610 281
395 3300032002 Ga0307416_100014348 Ga0307416_1000143484 281
396 3300032005 Ga0307411_10013373 Ga0307411_100133735 281
397 3300032005 Ga0307411_10033951 Ga0307411_100339513 281
398 3300032126 Ga0307415_100024531 Ga0307415_1000245314 281
399 3300037312 Ga0395899_0098950 Ga0395899_0098950_134_1006 281
400 3300037312 Ga0395899_0141691 Ga0395899_0141691_467_1342 281
401 3300042876 Ga0451577_0000616 Ga0451577_0000616_2243_3094 281
402 3300042876 Ga0451577_0118271 Ga0451577_0118271_965_1816 281
403 3300044673 Ga0453683_0000492 Ga0453683_0000492_10036_10887 281
404 3300044712 Ga0453684_0001864 Ga0453684_0001864_23836_24687 281
405 3300044712 Ga0453684_0173867 Ga0453684_0173867_558_1403 281
406 3300045051 Ga0451576_0157173 Ga0451576_0157173_36_887 281
407 3300045836 Ga0466958_0236091 Ga0466958_0236091_102_1058 281
408 3300046616 Ga0495668_0003407 Ga0495668_0003407_4702_5556 281
409 3300048919 Ga0496116_0022123 Ga0496116_0022123_197_1090 281
410 3300048922 Ga0496119_0169289 Ga0496119_0169289_197_1090 281
411 3300048925 Ga0496122_0012337 Ga0496122_0012337_2837_3730 281
412 3300048926 Ga0496123_0002924 Ga0496123_0002924_6091_6984 281
413 3300048927 Ga0496124_0001026 Ga0496124_0001026_26245_27138 281
414 3300048928 Ga0496125_0001387 Ga0496125_0001387_3702_4595 281
415 3300049161 Ga0501305_001848 Ga0501305_001848_718_1611 281
416 3300049527 Ga0501311_001172 Ga0501311_001172_750_1643 281
417 3300049528 Ga0501312_010208 Ga0501312_010208_211_1104 281
418 3300050511 nmdc:mga08y16_61138_c1 nmdc:mga08y16_61138_c1_41_895 281
419 3300059647 Ga0587079_024630 Ga0587079_024630_157_1041 281
420 iso_pu_bacteria 2981284811 2981285610 281
421 iso_pu_bacteria 8022948649 8022951749 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02569

Pantoate_ligase

Pantoate-beta-alanine ligase

2

286

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x3f-assembly1.cif.gz_A crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase. 0.9832 1 281
3ag6-assembly1.cif.gz_B crystal structure of pantothenate synthetase from staphylococcus aureus in complex with pantoyl adenylate 0.982 1 280
2x3f-assembly1.cif.gz_B crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase. 0.9817 1 281
3mxt-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine ligase from campylobacter jejuni 0.9789 1 280
2ejc-assembly1.cif.gz_A-2 crystal structure of pantoate--beta-alanine ligase (panc) from thermotoga maritima 0.9782 1 280
ID Description Score Start End Superfamily
2x3fA02 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.9956 178 277 3.30.1300.10
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.988 2 177 3.40.50.620
2x3fA02 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.9858 178 277 3.30.1300.10
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9824 2 177 3.40.50.620
af_B4F7V8_214_317_3.30.1300.10 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.9722 180 281 3.30.1300.10
ID Description Score Start End GO Terms
AF-A0A7S2CTR7-F1-model_v4 Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pantoate-activating enzyme) (Pantothenate synthetase) 0.9951 118 215 GO:0004592
GO:0005524
GO:0015940
AF-Q9KC86-F1-model_v4 Pantothenate synthetase (PS) (EC 6.3.2.1) (Pantoate--beta-alanine ligase) (Pantoate-activating enzyme) 0.9936 1 280 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A0A2V229-F1-model_v4 Pantothenate synthetase (PS) (EC 6.3.2.1) (Pantoate--beta-alanine ligase) (Pantoate-activating enzyme) 0.9933 1 280 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-W4RGF6-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.993 98 280 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A6P1B4P4-F1-model_v4 deleted 0.9926 208 281

Feature Viewer

pLDDT pTM Quality
95.5 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map