F440104

General Info

Members Datasets Scaffolds Average Seq Length
421 265 842 323

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0005047|Ga0496122_0005047_6827_7951
Length 374
Sequence MPQPEWQVRRRVHPDHAAARIVAHAADKSGEGGNFSPVAASNGHPIVLLENVMSLRDALKIPEWQVTDETVHAARRGFLQSLAATPVLALAGCADAEPPAAPQPTVTPEQARSGFRTSEELTRIEDVTSYNNFYEFGTAKNDPSQAPKTLKTSPWTISVSGECDKPGRIGLEDLLKAGTSEERIYRLRCVEGWSMVIPWLGIPLAPVLSRFAPNSKAKYVAFTTLADPKQMPQIRYRSINWPYREGLRMDEAMNPLTFLATGLYGKPLPQQNGAPLRLVVPWKYGFKSIKSIVEIKFVERMPETAWHDLQPSEYGFFSNVNPNVDHPRWSQKSERRIAGTASKLFAERIPTRPFNGYGEQVASMYAGMDLKKWY

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
155 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
233 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
234 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
235 2643221559 Lysobacter sp. Root559 Isolate Unclassified
236 2643221573 Lysobacter sp. Root604 Isolate Unclassified
237 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
238 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
239 2643221586 Lysobacter sp. Root667 Isolate Unclassified
240 2643221593 Lysobacter sp. Root690 Isolate Unclassified
241 2643221612 Lysobacter sp. Root76 Isolate Unclassified
242 2643221695 Lysobacter sp. Root494 Isolate Unclassified
243 2643221720 Lysobacter sp. Root916 Isolate Unclassified
244 2643221727 Lysobacter sp. Root96 Isolate Unclassified
245 2643221728 Lysobacter sp. Root983 Isolate Unclassified
246 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
247 2818991457 Xanthomonas translucens 569 Isolate Unclassified
248 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
249 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
250 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
251 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
252 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
253 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
254 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
255 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
256 2919513703 Luteimonas sp. 3794 Isolate Unclassified
257 2919675420 Luteimonas terrae 4099 Isolate Unclassified
258 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
259 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
260 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
261 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
262 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
263 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
264 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
265 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.92
Metatranscriptomes 0
Isolates 8.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.93
Nodule 0
Rhizoplane 4.28
Rhizosphere 74.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0005047 3300048925 Bacteria 15951
2 LJNas_1000254 3300000546 Bacteria 9214
3 JGI25152J39213_1000032 3300002773 Bacteria 96369
4 JGI25150J39212_1000351 3300002774 Bacteria 22655
5 JGI25151J46595_10000080 3300003187 Bacteria 131551
6 JGI25151J46595_10000138 3300003187 Bacteria 96369
7 JGI25153J46596_10000102 3300003215 Bacteria 96369
8 Ga0055526_1017017 3300003771 Bacteria 2805
9 Ga0055537_1000380 3300003773 Bacteria 29892
10 Ga0055524_1000305 3300003775 Bacteria 46621
11 Ga0055524_1001978 3300003775 Bacteria 10981
12 Ga0055536_1000470 3300003781 Bacteria 28175
13 Ga0055534_1000179 3300003784 Bacteria 46621
14 Ga0055528_1000230 3300003790 Bacteria 46621
15 Ga0055530_10002611 3300003791 Bacteria 11349
16 Ga0055531_10008653 3300003794 Bacteria 5326
17 Ga0055531_10008730 3300003794 Bacteria 5290
18 Ga0058692_1000023 3300003856 Bacteria 237263
19 Ga0065704_10076331 3300005289 Bacteria 5162
20 Ga0065712_10077224 3300005290 Bacteria 3529
21 Ga0065715_10106787 3300005293 Bacteria 2808
22 Ga0070683_100013851 3300005329 Bacteria 7043
23 Ga0068869_100088931 3300005334 Bacteria 2319
24 Ga0070666_10002514 3300005335 Bacteria 11093
25 Ga0070666_10002726 3300005335 Bacteria 10672
26 Ga0068868_100091585 3300005338 Bacteria 2450
27 Ga0068868_100158377 3300005338 Bacteria 1869
28 Ga0070660_100014761 3300005339 Bacteria 5635
29 Ga0070689_100168081 3300005340 Bacteria 1776
30 Ga0070661_100030045 3300005344 Bacteria 3924
31 Ga0070675_100286915 3300005354 Bacteria 1448
32 Ga0070671_100056088 3300005355 Bacteria 3278
33 Ga0070674_100057565 3300005356 Bacteria 2699
34 Ga0070659_100024400 3300005366 Bacteria 4635
35 Ga0070667_100017470 3300005367 Bacteria 5945
36 Ga0070667_100026996 3300005367 Bacteria 4776
37 Ga0070667_100244596 3300005367 Bacteria 1603
38 Ga0070667_100410816 3300005367 Bacteria 1233
39 Ga0070678_100014640 3300005456 Bacteria 4956
40 Ga0070678_100184082 3300005456 Bacteria 1712
41 Ga0070685_10001101 3300005466 Bacteria 14441
42 Ga0070679_100048186 3300005530 Bacteria 4246
43 Ga0070684_100010032 3300005535 Bacteria 7487
44 Ga0068853_100012735 3300005539 Bacteria 6848
45 Ga0068853_100032184 3300005539 Bacteria 4441
46 Ga0068853_100080310 3300005539 Bacteria 2853
47 Ga0068853_100106259 3300005539 Bacteria 2488
48 Ga0070672_100013034 3300005543 Bacteria 5859
49 Ga0070672_100112037 3300005543 Bacteria 2225
50 Ga0070693_100002319 3300005547 Bacteria 8736
51 Ga0070665_100024273 3300005548 Bacteria 6105
52 Ga0070665_100074183 3300005548 Bacteria 3408
53 Ga0068855_100023127 3300005563 Bacteria 7447
54 Ga0070664_100054196 3300005564 Bacteria 3402
55 Ga0068854_100004323 3300005578 Bacteria 8956
56 Ga0068854_100077516 3300005578 Bacteria 2446
57 Ga0068854_100084894 3300005578 Bacteria 2344
58 Ga0068856_100012801 3300005614 Bacteria 8119
59 Ga0068856_100024744 3300005614 Bacteria 5848
60 Ga0068856_100190534 3300005614 Bacteria 2064
61 Ga0068852_100031797 3300005616 Bacteria 4362
62 Ga0068852_100052650 3300005616 Bacteria 3499
63 Ga0068852_100101489 3300005616 Bacteria 2598
64 Ga0068864_100100929 3300005618 Bacteria 2559
65 Ga0068851_10028040 3300005834 Bacteria 2779
66 Ga0068863_100083507 3300005841 Bacteria 3027
67 Ga0068863_100223708 3300005841 Bacteria 1814
68 Ga0068858_100005259 3300005842 Bacteria 12680
69 Ga0068858_100006448 3300005842 Bacteria 11423
70 Ga0068860_100178017 3300005843 Bacteria 2055
71 Ga0068860_100181206 3300005843 Bacteria 2036
72 Ga0068862_100063682 3300005844 Bacteria 3173
73 Ga0081539_10041105 3300005985 Bacteria 2706
74 Ga0097621_100135881 3300006237 Bacteria 2097
75 Ga0097621_100274567 3300006237 Bacteria 1482
76 Ga0068871_100126170 3300006358 Bacteria 2166
77 Ga0068871_100306184 3300006358 Bacteria 1396
78 Ga0075431_100310176 3300006847 Bacteria 1593
79 Ga0075433_10066690 3300006852 Bacteria 3158
80 Ga0075434_100044271 3300006871 Bacteria 4416
81 Ga0068865_100006141 3300006881 Bacteria 7323
82 Ga0068865_100114275 3300006881 Bacteria 1996
83 Ga0105251_10000108 3300009011 Bacteria 81679
84 Ga0105240_10010393 3300009093 Bacteria 13081
85 Ga0105240_10058129 3300009093 Bacteria 4829
86 Ga0105240_10065901 3300009093 Bacteria 4495
87 Ga0105245_10293438 3300009098 Bacteria 1593
88 Ga0114129_10008885 3300009147 Bacteria 14327
89 Ga0114129_10022549 3300009147 Bacteria 8933
90 Ga0105241_10004161 3300009174 Bacteria 10685
91 Ga0105241_10010882 3300009174 Bacteria 6674
92 Ga0105241_10011095 3300009174 Bacteria 6611
93 Ga0105241_10031382 3300009174 Bacteria 3979
94 Ga0105242_10002454 3300009176 Bacteria 14545
95 Ga0105242_10083575 3300009176 Bacteria 2674
96 Ga0105248_10026152 3300009177 Bacteria 6493
97 Ga0105237_10008040 3300009545 Bacteria 11471
98 Ga0105238_10004788 3300009551 Bacteria 13390
99 Ga0105238_10137254 3300009551 Bacteria 2423
100 Ga0105249_10003051 3300009553 Bacteria 14449
101 Ga0105249_10141078 3300009553 Bacteria 2311
102 Ga0105239_10007776 3300010375 Bacteria 12268
103 Ga0105239_10008526 3300010375 Bacteria 11649
104 Ga0105239_10103888 3300010375 Bacteria 3145
105 Ga0105239_10116435 3300010375 Bacteria 2966
106 Ga0105239_10157225 3300010375 Bacteria 2539
107 Ga0105239_10257543 3300010375 Bacteria 1961
108 Ga0105246_10031548 3300011119 Bacteria 3508
109 Ga0157370_10041961 3300013104 Bacteria 4410
110 Ga0157370_10100987 3300013104 Bacteria 2702
111 Ga0157370_10135872 3300013104 Bacteria 2292
112 Ga0157369_10043973 3300013105 Bacteria 4864
113 Ga0157369_10141382 3300013105 Bacteria 2547
114 Ga0157374_10061337 3300013296 Bacteria 3522
115 Ga0163162_10008079 3300013306 Bacteria 10269
116 Ga0163162_10021282 3300013306 Bacteria 6384
117 Ga0163162_10240185 3300013306 Bacteria 1942
118 Ga0163162_10386890 3300013306 Bacteria 1532
119 Ga0157372_10001879 3300013307 Bacteria 22756
120 Ga0157372_10029232 3300013307 Bacteria 6016
121 Ga0157372_10049927 3300013307 Bacteria 4654
122 Ga0157375_10001190 3300013308 Bacteria 22445
123 Ga0157375_10696466 3300013308 Bacteria 1170
124 Ga0163163_10001216 3300014325 Bacteria 21766
125 Ga0163163_10094402 3300014325 Bacteria 3009
126 Ga0157379_10004969 3300014968 Bacteria 11411
127 Ga0157376_10000471 3300014969 Bacteria 25943
128 Ga0157376_10003196 3300014969 Bacteria 11270
129 Ga0157376_10005965 3300014969 Bacteria 8559
130 Ga0157376_10275868 3300014969 Bacteria 1581
131 Ga0163161_10051636 3300017792 Bacteria 2979
132 Ga0207425_1000078 3300025245 Bacteria 104429
133 Ga0209129_1000157 3300025258 Bacteria 105043
134 Ga0209233_1005323 3300025261 Bacteria 4282
135 Ga0209565_1000001 3300025263 Bacteria 2950419
136 Ga0209673_1000001 3300025273 Bacteria 3176258
137 Ga0209673_1003877 3300025273 Bacteria 8432
138 Ga0209130_1008178 3300025284 Bacteria 3119
139 Ga0209675_1000001 3300025291 Bacteria 2950293
140 Ga0209676_1000628 3300025292 Bacteria 50981
141 Ga0209676_1000764 3300025292 Bacteria 43254
142 Ga0209676_1000994 3300025292 Bacteria 33423
143 Ga0209025_1000015 3300025294 Bacteria 808120
144 Ga0209025_1000054 3300025294 Bacteria 317002
145 Ga0209025_1002203 3300025294 Bacteria 21561
146 Ga0209564_1000001 3300025295 Bacteria 3176258
147 Ga0209564_1006532 3300025295 Bacteria 6270
148 Ga0209758_1000062 3300025297 Bacteria 317002
149 Ga0209758_1013522 3300025297 Bacteria 4440
150 Ga0209050_1000809 3300025298 Bacteria 44027
151 Ga0209050_1016523 3300025298 Bacteria 3011
152 Ga0209256_1000002 3300025299 Bacteria 1906740
153 Ga0209256_1003149 3300025299 Bacteria 12002
154 Ga0209051_1005648 3300025303 Bacteria 7241
155 Ga0209257_1000080 3300025304 Bacteria 312038
156 Ga0209257_1000170 3300025304 Bacteria 169384
157 Ga0209257_1000273 3300025304 Bacteria 117663
158 Ga0209257_1000593 3300025304 Bacteria 60449
159 Ga0209257_1000975 3300025304 Bacteria 38974
160 Ga0209257_1001712 3300025304 Bacteria 24579
161 Ga0207656_10000937 3300025321 Bacteria 9508
162 Ga0207713_1000595 3300025735 Bacteria 35708
163 Ga0207680_10000616 3300025903 Bacteria 16825
164 Ga0207680_10011146 3300025903 Bacteria 4530
165 Ga0207680_10032726 3300025903 Bacteria 2959
166 Ga0207647_10000186 3300025904 Bacteria 50154
167 Ga0207647_10001220 3300025904 Bacteria 19782
168 Ga0207647_10016424 3300025904 Bacteria 5054
169 Ga0207705_10028032 3300025909 Bacteria 4015
170 Ga0207705_10066599 3300025909 Bacteria 2605
171 Ga0207654_10000128 3300025911 Bacteria 49057
172 Ga0207654_10034938 3300025911 Bacteria 2797
173 Ga0207654_10105629 3300025911 Bacteria 1743
174 Ga0207695_10000007 3300025913 Bacteria 1092551
175 Ga0207695_10001506 3300025913 Bacteria 38709
176 Ga0207695_10006744 3300025913 Bacteria 14809
177 Ga0207695_10065877 3300025913 Bacteria 3722
178 Ga0207671_10006371 3300025914 Bacteria 10527
179 Ga0207671_10062050 3300025914 Bacteria 2775
180 Ga0207657_10006941 3300025919 Bacteria 11669
181 Ga0207649_10005858 3300025920 Bacteria 6660
182 Ga0207649_10010668 3300025920 Bacteria 5052
183 Ga0207694_10000944 3300025924 Bacteria 25614
184 Ga0207694_10006032 3300025924 Bacteria 9272
185 Ga0207694_10049980 3300025924 Bacteria 3237
186 Ga0207659_10287398 3300025926 Bacteria 1346
187 Ga0207706_10002671 3300025933 Bacteria 17373
188 Ga0207706_10011704 3300025933 Bacteria 7999
189 Ga0207704_10003048 3300025938 Bacteria 7575
190 Ga0207704_10094338 3300025938 Bacteria 1976
191 Ga0207704_10101905 3300025938 Bacteria 1916
192 Ga0207691_10019585 3300025940 Bacteria 6401
193 Ga0207691_10081198 3300025940 Bacteria 2915
194 Ga0207689_10111123 3300025942 Bacteria 2252
195 Ga0207667_10022110 3300025949 Bacteria 7035
196 Ga0207667_10119314 3300025949 Bacteria 2718
197 Ga0207667_10541851 3300025949 Bacteria 1177
198 Ga0207712_10000254 3300025961 Bacteria 51558
199 Ga0207668_10203572 3300025972 Bacteria 1578
200 Ga0207640_10033212 3300025981 Bacteria 3208
201 Ga0207658_10007247 3300025986 Bacteria 7561
202 Ga0207658_10038795 3300025986 Bacteria 3434
203 Ga0207677_10051499 3300026023 Bacteria 2792
204 Ga0207703_10005350 3300026035 Bacteria 10337
205 Ga0207703_10011699 3300026035 Bacteria 6826
206 Ga0207703_10300816 3300026035 Bacteria 1463
207 Ga0207639_10000129 3300026041 Bacteria 55422
208 Ga0207639_10001755 3300026041 Bacteria 14589
209 Ga0207702_10005496 3300026078 Bacteria 11083
210 Ga0207702_10151122 3300026078 Bacteria 2112
211 Ga0207702_10270981 3300026078 Bacteria 1601
212 Ga0207641_10093246 3300026088 Bacteria 2639
213 Ga0207641_10192041 3300026088 Bacteria 1877
214 Ga0207648_10096740 3300026089 Bacteria 2583
215 Ga0207676_10092171 3300026095 Bacteria 2491
216 Ga0207674_10012210 3300026116 Bacteria 9608
217 Ga0207683_10005565 3300026121 Bacteria 10793
218 Ga0207683_10019545 3300026121 Bacteria 5785
219 Ga0207683_10303175 3300026121 Bacteria 1462
220 Ga0207698_10007143 3300026142 Bacteria 6994
221 Ga0207698_10056114 3300026142 Bacteria 3040
222 Ga0209371_1000059 3300027312 Bacteria 237154
223 Ga0268266_10000006 3300028379 Bacteria 1410021
224 Ga0268264_10062055 3300028381 Bacteria 3137
225 Ga0268264_10161200 3300028381 Bacteria 2020
226 Ga0268264_10174377 3300028381 Bacteria 1948
227 Ga0265337_1015640 3300028556 Bacteria 2476
228 Ga0265334_10002437 3300028573 Bacteria 8753
229 Ga0268256_1000055 3300030500 Bacteria 237299
230 Ga0265320_10000322 3300031240 Bacteria 39135
231 Ga0265325_10097749 3300031241 Bacteria 1441
232 Ga0265339_10058062 3300031249 Bacteria 2091
233 Ga0307513_10009441 3300031456 Bacteria 12338
234 Ga0307513_10194166 3300031456 Bacteria 1878
235 Ga0307408_100019861 3300031548 Bacteria 4526
236 Ga0307408_100072281 3300031548 Bacteria 2553
237 Ga0307408_100139229 3300031548 Bacteria 1903
238 Ga0265314_10015264 3300031711 Bacteria 6099
239 Ga0307413_10025510 3300031824 Bacteria 3241
240 Ga0307413_10063451 3300031824 Bacteria 2290
241 Ga0307413_10243649 3300031824 Bacteria 1329
242 Ga0307406_10043248 3300031901 Bacteria 2816
243 Ga0307406_10043386 3300031901 Bacteria 2812
244 Ga0307406_10093501 3300031901 Bacteria 2030
245 Ga0307412_10033885 3300031911 Bacteria 3250
246 Ga0307412_10067149 3300031911 Bacteria 2434
247 Ga0307409_100037031 3300031995 Bacteria 3593
248 Ga0307409_100310223 3300031995 Bacteria 1472
249 Ga0307416_100097129 3300032002 Bacteria 2550
250 Ga0307416_100155516 3300032002 Bacteria 2104
251 Ga0307414_10000569 3300032004 Bacteria 19267
252 Ga0307414_10007030 3300032004 Bacteria 6308
253 Ga0307414_10013379 3300032004 Bacteria 4883
254 Ga0307414_10025660 3300032004 Bacteria 3779
255 Ga0307414_10038280 3300032004 Bacteria 3219
256 Ga0307414_10076595 3300032004 Bacteria 2431
257 Ga0307414_10113304 3300032004 Bacteria 2070
258 Ga0307414_10153590 3300032004 Bacteria 1819
259 Ga0307414_10155222 3300032004 Bacteria 1811
260 Ga0307414_10368585 3300032004 Bacteria 1238
261 Ga0307411_10087921 3300032005 Bacteria 2159
262 Ga0307415_100218183 3300032126 Bacteria 1527
263 Ga0373937_0372892 3300036401 Bacteria 1353
264 Ga0373925_0333464 3300037068 Bacteria 1229
265 Ga0237819_00077 3300038705 Bacteria 34998
266 Ga0439436_0005204 3300041404 Bacteria 3985
267 Ga0439447_000730 3300041407 Bacteria 12185
268 Ga0439465_0034746 3300041413 Bacteria 1614
269 Ga0451791_0939359 3300041451 Bacteria 1831
270 Ga0451793_1424622 3300041452 Bacteria 5932
271 Ga0451797_0990680 3300041453 Bacteria 1212
272 Ga0451800_1268897 3300041459 Bacteria 4302
273 Ga0451806_127377 3300041462 Bacteria 4257
274 Ga0451807_0098160 3300041486 Bacteria 1861
275 Ga0451837_1418555 3300041494 Bacteria 1797
276 Ga0451837_1603297 3300041494 Bacteria 1476
277 Ga0451839_0500772 3300041496 Bacteria 1467
278 Ga0451853_0850473 3300041512 Bacteria 1673
279 Ga0439445_0021499 3300042004 Bacteria 1621
280 Ga0439432_020504 3300042006 Bacteria 2196
281 Ga0439449_0000889 3300042007 Bacteria 11670
282 Ga0439449_0017532 3300042007 Bacteria 2689
283 Ga0451577_0007822 3300042876 Bacteria 10456
284 Ga0453684_0002948 3300044712 Bacteria 39915
285 Ga0453684_0021032 3300044712 Bacteria 9783
286 Ga0453684_0140739 3300044712 Bacteria 2881
287 Ga0466959_0005396 3300045049 Bacteria 8748
288 Ga0451576_0000156 3300045051 Bacteria 174140
289 Ga0495629_0014398 3300046459 Bacteria 5690
290 Ga0495580_0062955 3300046472 Bacteria 2602
291 Ga0495639_0077857 3300046475 Bacteria 1540
292 Ga0495607_0027902 3300046501 Bacteria 3485
293 Ga0495606_0005271 3300046507 Bacteria 12459
294 Ga0495663_0000289 3300046525 Bacteria 19166
295 Ga0495665_0005805 3300046531 Bacteria 6662
296 Ga0495645_0009898 3300046543 Bacteria 6670
297 Ga0495633_0027745 3300046558 Bacteria 2764
298 Ga0495656_0001355 3300046615 Bacteria 7995
299 Ga0495668_0000710 3300046616 Bacteria 40166
300 Ga0495659_0094593 3300046664 Bacteria 1151
301 Ga0495658_0000544 3300046683 Bacteria 20555
302 Ga0495636_0000021 3300047318 Bacteria 72964
303 Ga0495681_0029407 3300047470 Bacteria 2812
304 Ga0495686_0007155 3300047472 Bacteria 8401
305 Ga0496101_0097791 3300048904 Bacteria 2193
306 Ga0496102_0099665 3300048905 Bacteria 2697
307 Ga0496103_0062730 3300048906 Bacteria 2314
308 Ga0496103_0071676 3300048906 Bacteria 2169
309 Ga0496104_0000020 3300048907 Bacteria 247296
310 Ga0496105_0000039 3300048908 Bacteria 118127
311 Ga0496106_0016041 3300048909 Bacteria 5539
312 Ga0496109_0465478 3300048912 Bacteria 1194
313 Ga0496110_0106396 3300048913 Bacteria 2517
314 Ga0496110_0481883 3300048913 Bacteria 1130
315 Ga0496112_0214342 3300048915 Bacteria 1882
316 Ga0496113_0067906 3300048916 Bacteria 2705
317 Ga0496117_0008089 3300048920 Bacteria 10072
318 Ga0496117_0039304 3300048920 Bacteria 3494
319 Ga0496117_0039774 3300048920 Bacteria 3466
320 Ga0496118_0001999 3300048921 Bacteria 28907
321 Ga0496118_0028223 3300048921 Bacteria 4733
322 Ga0496118_0030534 3300048921 Bacteria 4495
323 Ga0496118_0117234 3300048921 Bacteria 1747
324 Ga0496119_0004117 3300048922 Bacteria 14645
325 Ga0496120_0000161 3300048923 Bacteria 112351
326 Ga0496121_0000631 3300048924 Bacteria 65738
327 Ga0496122_0000647 3300048925 Bacteria 70731
328 Ga0496123_0000234 3300048926 Bacteria 112524
329 Ga0496123_0029115 3300048926 Bacteria 4076
330 Ga0496124_0000009 3300048927 Bacteria 734820
331 Ga0496124_0000415 3300048927 Bacteria 76192
332 Ga0496125_0027335 3300048928 Bacteria 5174
333 Ga0496126_0005198 3300048929 Bacteria 15029
334 Ga0501031_0014827 3300049568 Bacteria 5066
335 Ga0501032_0004764 3300049569 Bacteria 10170
336 Ga0501032_0049130 3300049569 Bacteria 2847
337 Ga0501034_0000563 3300049571 Bacteria 58800
338 Ga0501034_0013768 3300049571 Bacteria 8321
339 Ga0501034_0018984 3300049571 Bacteria 7042
340 Ga0501034_0033391 3300049571 Bacteria 5221
341 Ga0501034_0046133 3300049571 Bacteria 4403
342 Ga0501036_0055437 3300049572 Bacteria 3358
343 Ga0501038_0006969 3300049574 Bacteria 10438
344 Ga0501038_0036684 3300049574 Bacteria 4301
345 Ga0501039_0093750 3300049575 Bacteria 2340
346 Ga0501043_0000564 3300049579 Bacteria 33148
347 Ga0501043_0027882 3300049579 Bacteria 4433
348 Ga0501043_0033424 3300049579 Bacteria 4047
349 Ga0501043_0060170 3300049579 Bacteria 2981
350 Ga0501043_0176866 3300049579 Bacteria 1663
351 Ga0501046_0017607 3300049580 Bacteria 5960
352 Ga0501047_0000653 3300049581 Bacteria 36334
353 Ga0501047_0003824 3300049581 Bacteria 14152
354 Ga0501047_0005385 3300049581 Bacteria 12027
355 Ga0501047_0078892 3300049581 Bacteria 3166
356 Ga0501067_0000699 3300049583 Bacteria 18081
357 Ga0501068_0013256 3300049584 Bacteria 4687
358 Ga0501069_0021059 3300049585 Bacteria 3536
359 Ga0501070_0033785 3300049586 Bacteria 4280
360 Ga0501070_0055358 3300049586 Bacteria 3287
361 Ga0501070_0150911 3300049586 Bacteria 1917
362 Ga0501071_0026073 3300049587 Bacteria 4100
363 Ga0501073_0001670 3300049589 Bacteria 16436
364 Ga0501073_0023208 3300049589 Bacteria 4458
365 Ga0501074_0006006 3300049590 Bacteria 8761
366 Ga0501074_0031517 3300049590 Bacteria 3840
367 Ga0501074_0076590 3300049590 Bacteria 2400
368 Ga0501075_0058063 3300049591 Bacteria 2914
369 Ga0501079_0074607 3300049741 Bacteria 2622
370 Ga0501079_0280562 3300049741 Bacteria 1303
371 Ga0501080_0006203 3300049742 Bacteria 10732
372 Ga0501080_0047014 3300049742 Bacteria 4017
373 Ga0501080_0123401 3300049742 Bacteria 2399
374 Ga0501083_0017739 3300049744 Bacteria 4964
375 Ga0501035_0026795 3300049822 Bacteria 5272
376 Ga0501044_0037141 3300049823 Bacteria 5092
377 Ga0501044_0039169 3300049823 Bacteria 4945
378 nmdc:mga00v17_418_c1 3300050491 Bacteria 22160
379 nmdc:mga05p37_563634_c1 3300050507 Bacteria 1294
380 nmdc:mga06r32_182818_c1 3300050510 Bacteria 2082
381 nmdc:mga06r32_24524_c1 3300050510 Bacteria 5600
382 nmdc:mga0rr50_190989_c1 3300050513 Bacteria 1678
383 nmdc:mga0rr50_26003_c1 3300050513 Bacteria 4077
384 nmdc:mga08x19_166730_c1 3300050514 Bacteria 1498
385 nmdc:mga0a205_345004_c1 3300050515 Bacteria 1357
386 Ga0500634_0000148 3300053161 Bacteria 25167
387 Ga0501082_0215530 3300060353 Bacteria 1670
388 2525556618 2524614729 Bacteria 3091755
389 2572254047 2571042365 Bacteria 3289345
390 2630648214 2627854209 Bacteria 3093011
391 2643817610 2643221559 Bacteria 4424915
392 2643878827 2643221573 Bacteria 4784121
393 2643906422 2643221579 Bacteria 4443405
394 2643916516 2643221581 Bacteria 3893603
395 2643940322 2643221586 Bacteria 4446529
396 2643974077 2643221593 Bacteria 6296053
397 2644079393 2643221612 Bacteria 4361984
398 2644529213 2643221695 Bacteria 3441323
399 2644660143 2643221720 Bacteria 4694283
400 2644694837 2643221727 Bacteria 4415595
401 2644697444 2643221728 Bacteria 4797149
402 2748015740 2747842501 Bacteria 5293829
403 2819663093 2818991457 Bacteria 5323295
404 2842780949 2842780639 Bacteria 4337790
405 2852685921 2852684882 Bacteria 5463342
406 2894415503 2894414249 Bacteria 4405451
407 2895500689 2895498888 Bacteria 5283788
408 2895516441 2895511927 Bacteria 6802080
409 2895523639 2895522137 Bacteria 3284416
410 2895526779 2895525241 Bacteria 3388457
411 2919133765 2919130084 Bacteria 5301837
412 2919514544 2919513703 Bacteria 3844312
413 2919676584 2919675420 Bacteria 3969095
414 2923518293 2923516293 Bacteria 3716336
415 2929197499 2929195423 Bacteria 5325372
416 2941490803 2941489479 Bacteria 6313767
417 2995951249 2995948881 Bacteria 6358104
418 8003015998 8003014200 Bacteria 4059994
419 8021624585 8021622325 Bacteria 4844743
420 8021627929 8021626552 Bacteria 4665214
421 8021649496 8021648035 Bacteria 4772378
422 Ga0496122_0005047
423 LJNas_1000254
424 JGI25152J39213_1000032
425 JGI25150J39212_1000351
426 JGI25151J46595_10000080
427 JGI25151J46595_10000138
428 JGI25153J46596_10000102
429 Ga0055526_1017017
430 Ga0055537_1000380
431 Ga0055524_1000305
432 Ga0055524_1001978
433 Ga0055536_1000470
434 Ga0055534_1000179
435 Ga0055528_1000230
436 Ga0055530_10002611
437 Ga0055531_10008653
438 Ga0055531_10008730
439 Ga0058692_1000023
440 Ga0065704_10076331
441 Ga0065712_10077224
442 Ga0065715_10106787
443 Ga0070683_100013851
444 Ga0068869_100088931
445 Ga0070666_10002514
446 Ga0070666_10002726
447 Ga0068868_100091585
448 Ga0068868_100158377
449 Ga0070660_100014761
450 Ga0070689_100168081
451 Ga0070661_100030045
452 Ga0070675_100286915
453 Ga0070671_100056088
454 Ga0070674_100057565
455 Ga0070659_100024400
456 Ga0070667_100017470
457 Ga0070667_100026996
458 Ga0070667_100244596
459 Ga0070667_100410816
460 Ga0070678_100014640
461 Ga0070678_100184082
462 Ga0070685_10001101
463 Ga0070679_100048186
464 Ga0070684_100010032
465 Ga0068853_100012735
466 Ga0068853_100032184
467 Ga0068853_100080310
468 Ga0068853_100106259
469 Ga0070672_100013034
470 Ga0070672_100112037
471 Ga0070693_100002319
472 Ga0070665_100024273
473 Ga0070665_100074183
474 Ga0068855_100023127
475 Ga0070664_100054196
476 Ga0068854_100004323
477 Ga0068854_100077516
478 Ga0068854_100084894
479 Ga0068856_100012801
480 Ga0068856_100024744
481 Ga0068856_100190534
482 Ga0068852_100031797
483 Ga0068852_100052650
484 Ga0068852_100101489
485 Ga0068864_100100929
486 Ga0068851_10028040
487 Ga0068863_100083507
488 Ga0068863_100223708
489 Ga0068858_100005259
490 Ga0068858_100006448
491 Ga0068860_100178017
492 Ga0068860_100181206
493 Ga0068862_100063682
494 Ga0081539_10041105
495 Ga0097621_100135881
496 Ga0097621_100274567
497 Ga0068871_100126170
498 Ga0068871_100306184
499 Ga0075431_100310176
500 Ga0075433_10066690
501 Ga0075434_100044271
502 Ga0068865_100006141
503 Ga0068865_100114275
504 Ga0105251_10000108
505 Ga0105240_10010393
506 Ga0105240_10058129
507 Ga0105240_10065901
508 Ga0105245_10293438
509 Ga0114129_10008885
510 Ga0114129_10022549
511 Ga0105241_10004161
512 Ga0105241_10010882
513 Ga0105241_10011095
514 Ga0105241_10031382
515 Ga0105242_10002454
516 Ga0105242_10083575
517 Ga0105248_10026152
518 Ga0105237_10008040
519 Ga0105238_10004788
520 Ga0105238_10137254
521 Ga0105249_10003051
522 Ga0105249_10141078
523 Ga0105239_10007776
524 Ga0105239_10008526
525 Ga0105239_10103888
526 Ga0105239_10116435
527 Ga0105239_10157225
528 Ga0105239_10257543
529 Ga0105246_10031548
530 Ga0157370_10041961
531 Ga0157370_10100987
532 Ga0157370_10135872
533 Ga0157369_10043973
534 Ga0157369_10141382
535 Ga0157374_10061337
536 Ga0163162_10008079
537 Ga0163162_10021282
538 Ga0163162_10240185
539 Ga0163162_10386890
540 Ga0157372_10001879
541 Ga0157372_10029232
542 Ga0157372_10049927
543 Ga0157375_10001190
544 Ga0157375_10696466
545 Ga0163163_10001216
546 Ga0163163_10094402
547 Ga0157379_10004969
548 Ga0157376_10000471
549 Ga0157376_10003196
550 Ga0157376_10005965
551 Ga0157376_10275868
552 Ga0163161_10051636
553 Ga0207425_1000078
554 Ga0209129_1000157
555 Ga0209233_1005323
556 Ga0209565_1000001
557 Ga0209673_1000001
558 Ga0209673_1003877
559 Ga0209130_1008178
560 Ga0209675_1000001
561 Ga0209676_1000628
562 Ga0209676_1000764
563 Ga0209676_1000994
564 Ga0209025_1000015
565 Ga0209025_1000054
566 Ga0209025_1002203
567 Ga0209564_1000001
568 Ga0209564_1006532
569 Ga0209758_1000062
570 Ga0209758_1013522
571 Ga0209050_1000809
572 Ga0209050_1016523
573 Ga0209256_1000002
574 Ga0209256_1003149
575 Ga0209051_1005648
576 Ga0209257_1000080
577 Ga0209257_1000170
578 Ga0209257_1000273
579 Ga0209257_1000593
580 Ga0209257_1000975
581 Ga0209257_1001712
582 Ga0207656_10000937
583 Ga0207713_1000595
584 Ga0207680_10000616
585 Ga0207680_10011146
586 Ga0207680_10032726
587 Ga0207647_10000186
588 Ga0207647_10001220
589 Ga0207647_10016424
590 Ga0207705_10028032
591 Ga0207705_10066599
592 Ga0207654_10000128
593 Ga0207654_10034938
594 Ga0207654_10105629
595 Ga0207695_10000007
596 Ga0207695_10001506
597 Ga0207695_10006744
598 Ga0207695_10065877
599 Ga0207671_10006371
600 Ga0207671_10062050
601 Ga0207657_10006941
602 Ga0207649_10005858
603 Ga0207649_10010668
604 Ga0207694_10000944
605 Ga0207694_10006032
606 Ga0207694_10049980
607 Ga0207659_10287398
608 Ga0207706_10002671
609 Ga0207706_10011704
610 Ga0207704_10003048
611 Ga0207704_10094338
612 Ga0207704_10101905
613 Ga0207691_10019585
614 Ga0207691_10081198
615 Ga0207689_10111123
616 Ga0207667_10022110
617 Ga0207667_10119314
618 Ga0207667_10541851
619 Ga0207712_10000254
620 Ga0207668_10203572
621 Ga0207640_10033212
622 Ga0207658_10007247
623 Ga0207658_10038795
624 Ga0207677_10051499
625 Ga0207703_10005350
626 Ga0207703_10011699
627 Ga0207703_10300816
628 Ga0207639_10000129
629 Ga0207639_10001755
630 Ga0207702_10005496
631 Ga0207702_10151122
632 Ga0207702_10270981
633 Ga0207641_10093246
634 Ga0207641_10192041
635 Ga0207648_10096740
636 Ga0207676_10092171
637 Ga0207674_10012210
638 Ga0207683_10005565
639 Ga0207683_10019545
640 Ga0207683_10303175
641 Ga0207698_10007143
642 Ga0207698_10056114
643 Ga0209371_1000059
644 Ga0268266_10000006
645 Ga0268264_10062055
646 Ga0268264_10161200
647 Ga0268264_10174377
648 Ga0265337_1015640
649 Ga0265334_10002437
650 Ga0268256_1000055
651 Ga0265320_10000322
652 Ga0265325_10097749
653 Ga0265339_10058062
654 Ga0307513_10009441
655 Ga0307513_10194166
656 Ga0307408_100019861
657 Ga0307408_100072281
658 Ga0307408_100139229
659 Ga0265314_10015264
660 Ga0307413_10025510
661 Ga0307413_10063451
662 Ga0307413_10243649
663 Ga0307406_10043248
664 Ga0307406_10043386
665 Ga0307406_10093501
666 Ga0307412_10033885
667 Ga0307412_10067149
668 Ga0307409_100037031
669 Ga0307409_100310223
670 Ga0307416_100097129
671 Ga0307416_100155516
672 Ga0307414_10000569
673 Ga0307414_10007030
674 Ga0307414_10013379
675 Ga0307414_10025660
676 Ga0307414_10038280
677 Ga0307414_10076595
678 Ga0307414_10113304
679 Ga0307414_10153590
680 Ga0307414_10155222
681 Ga0307414_10368585
682 Ga0307411_10087921
683 Ga0307415_100218183
684 Ga0373937_0372892
685 Ga0373925_0333464
686 Ga0237819_00077
687 Ga0439436_0005204
688 Ga0439447_000730
689 Ga0439465_0034746
690 Ga0451791_0939359
691 Ga0451793_1424622
692 Ga0451797_0990680
693 Ga0451800_1268897
694 Ga0451806_127377
695 Ga0451807_0098160
696 Ga0451837_1418555
697 Ga0451837_1603297
698 Ga0451839_0500772
699 Ga0451853_0850473
700 Ga0439445_0021499
701 Ga0439432_020504
702 Ga0439449_0000889
703 Ga0439449_0017532
704 Ga0451577_0007822
705 Ga0453684_0002948
706 Ga0453684_0021032
707 Ga0453684_0140739
708 Ga0466959_0005396
709 Ga0451576_0000156
710 Ga0495629_0014398
711 Ga0495580_0062955
712 Ga0495639_0077857
713 Ga0495607_0027902
714 Ga0495606_0005271
715 Ga0495663_0000289
716 Ga0495665_0005805
717 Ga0495645_0009898
718 Ga0495633_0027745
719 Ga0495656_0001355
720 Ga0495668_0000710
721 Ga0495659_0094593
722 Ga0495658_0000544
723 Ga0495636_0000021
724 Ga0495681_0029407
725 Ga0495686_0007155
726 Ga0496101_0097791
727 Ga0496102_0099665
728 Ga0496103_0062730
729 Ga0496103_0071676
730 Ga0496104_0000020
731 Ga0496105_0000039
732 Ga0496106_0016041
733 Ga0496109_0465478
734 Ga0496110_0106396
735 Ga0496110_0481883
736 Ga0496112_0214342
737 Ga0496113_0067906
738 Ga0496117_0008089
739 Ga0496117_0039304
740 Ga0496117_0039774
741 Ga0496118_0001999
742 Ga0496118_0028223
743 Ga0496118_0030534
744 Ga0496118_0117234
745 Ga0496119_0004117
746 Ga0496120_0000161
747 Ga0496121_0000631
748 Ga0496122_0000647
749 Ga0496123_0000234
750 Ga0496123_0029115
751 Ga0496124_0000009
752 Ga0496124_0000415
753 Ga0496125_0027335
754 Ga0496126_0005198
755 Ga0501031_0014827
756 Ga0501032_0004764
757 Ga0501032_0049130
758 Ga0501034_0000563
759 Ga0501034_0013768
760 Ga0501034_0018984
761 Ga0501034_0033391
762 Ga0501034_0046133
763 Ga0501036_0055437
764 Ga0501038_0006969
765 Ga0501038_0036684
766 Ga0501039_0093750
767 Ga0501043_0000564
768 Ga0501043_0027882
769 Ga0501043_0033424
770 Ga0501043_0060170
771 Ga0501043_0176866
772 Ga0501046_0017607
773 Ga0501047_0000653
774 Ga0501047_0003824
775 Ga0501047_0005385
776 Ga0501047_0078892
777 Ga0501067_0000699
778 Ga0501068_0013256
779 Ga0501069_0021059
780 Ga0501070_0033785
781 Ga0501070_0055358
782 Ga0501070_0150911
783 Ga0501071_0026073
784 Ga0501073_0001670
785 Ga0501073_0023208
786 Ga0501074_0006006
787 Ga0501074_0031517
788 Ga0501074_0076590
789 Ga0501075_0058063
790 Ga0501079_0074607
791 Ga0501079_0280562
792 Ga0501080_0006203
793 Ga0501080_0047014
794 Ga0501080_0123401
795 Ga0501083_0017739
796 Ga0501035_0026795
797 Ga0501044_0037141
798 Ga0501044_0039169
799 nmdc:mga00v17_418_c1
800 nmdc:mga05p37_563634_c1
801 nmdc:mga06r32_182818_c1
802 nmdc:mga06r32_24524_c1
803 nmdc:mga0rr50_190989_c1
804 nmdc:mga0rr50_26003_c1
805 nmdc:mga08x19_166730_c1
806 nmdc:mga0a205_345004_c1
807 Ga0500634_0000148
808 Ga0501082_0215530
809 2525556618
810 2572254047
811 2630648214
812 2643817610
813 2643878827
814 2643906422
815 2643916516
816 2643940322
817 2643974077
818 2644079393
819 2644529213
820 2644660143
821 2644694837
822 2644697444
823 2748015740
824 2819663093
825 2842780949
826 2852685921
827 2894415503
828 2895500689
829 2895516441
830 2895523639
831 2895526779
832 2919133765
833 2919514544
834 2919676584
835 2923518293
836 2929197499
837 2941490803
838 2995951249
839 8003015998
840 8021624585
841 8021627929
842 8021649496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

144

306

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9059 65 315
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9034 65 315
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.867 65 315
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.86 65 315
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.8263 99 255
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9156 65 315 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8691 65 315 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8263 101 256 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8252 100 255 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8177 99 255 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9618 85 230
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9554 85 230
AF-A0A7V8JR83-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP 0.954 71 183
AF-A0A7S1GSH0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9495 100 269
AF-A0A150QJ33-F1-model_v4 Sulfoxide reductase catalytic subunit YedY 0.949 73 303

Map