F440118

General Info

Members Datasets Scaffolds Average Seq Length
421 228 842 428

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0001176|Ga0501083_0001176_13747_15108
Length 453
Sequence MAETNRPLANRILAGLAVGVIAGVATLALSAVLPPFNVPFGGGSGRLVDHARTLATAVLDPFGQIFLRMLFFVVIPLVFASLAAGVVQLGRLDRLGPLAGRTFFLFFLNMAIGVALGLLMMHALRPGDHLDAAAKAGLMQEFGGAAQKTIAAHAAAPAIGFGTLVEMFMPKNLFGAVVGHTNTAIGDVLPLILFAILVGAVGTQLAEEKRQRLQDTLELVAELMTGIVNFALRLAPYAVPAMIYSVIVKVGLDILAALGVFVLGCVAVLLLHLFGTMSVWIRLWTGRSPLAVFRDSRAVLITAFSTSSSNATLPTALACAKDTLGVQPSVSGFVLPLGATMNMSGTALYEGCVVLFVAQVFGVELSLAQQFTLLLLAVLSAVAVAGIPGGSLPLIAGLLATFGIPPEGIGIVLGVDRLLDMTRTMTNVGADVVTALVVDAQVRKTEARAATAG

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
154 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
155 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
156 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
157 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
164 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
223 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
224 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
225 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
226 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
227 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
228 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0.95
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.93
Nodule 0
Rhizoplane 0.95
Rhizosphere 78.86
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0001176 3300049744 Bacteria 17642
2 JGI24741J21665_1000127 3300001915 Bacteria 20745
3 JGI24741J21665_1002031 3300001915 Bacteria 5437
4 JGI24741J21665_1003111 3300001915 Bacteria 4073
5 JGI24740J21852_10000021 3300001979 Bacteria 53145
6 JGI24740J21852_10002426 3300001979 Bacteria 8469
7 JGI24737J22298_10001210 3300001990 Bacteria 9097
8 JGI25156J39149_1000792 3300002705 Bacteria 16264
9 JGI25156J39149_1002953 3300002705 Bacteria 5778
10 JGI25156J39149_1005523 3300002705 Bacteria 3626
11 JGI25162J39368_1001171 3300002737 Bacteria 15589
12 JGI25154J39366_1001991 3300002738 Bacteria 5990
13 JGI25157J39369_1000481 3300002741 Bacteria 25045
14 JGI25157J39369_1001139 3300002741 Bacteria 11617
15 JGI25157J39369_1001904 3300002741 Bacteria 6333
16 JGI25164J39214_1000167 3300002772 Bacteria 61442
17 JGI25165J46597_1000359 3300003214 Bacteria 51049
18 rootH2_10000070 3300003320 Bacteria 107704
19 rootH2_10003054 3300003320 Bacteria 11796
20 rootL2_10098371 3300003322 Bacteria 1925
21 rootL2_10275138 3300003322 Bacteria 1716
22 rootH1_10262268 3300003323 Bacteria 1736
23 Ga0006562J51391_1030066 3300003578 Bacteria 6640
24 Ga0006562J51391_1030067 3300003578 Bacteria 5590
25 Ga0055525_1000091 3300003759 Bacteria 140920
26 Ga0055527_1000369 3300003760 Bacteria 21049
27 Ga0055527_1000382 3300003760 Bacteria 19483
28 Ga0055535_1000557 3300003761 Bacteria 31869
29 Ga0055535_1000879 3300003761 Bacteria 20971
30 Ga0055535_1001539 3300003761 Bacteria 11294
31 Ga0055542_1000863 3300003762 Bacteria 21241
32 Ga0055542_1000874 3300003762 Bacteria 21049
33 Ga0055542_1000927 3300003762 Bacteria 19458
34 Ga0055542_1001508 3300003762 Bacteria 11298
35 Ga0055529_1000258 3300003763 Bacteria 63488
36 Ga0055529_1000749 3300003763 Bacteria 20971
37 Ga0055529_1000789 3300003763 Bacteria 19479
38 Ga0065165_1005385 3300005262 Bacteria 7229
39 Ga0070658_10005923 3300005327 Bacteria 9919
40 Ga0070658_10221451 3300005327 Bacteria 1600
41 Ga0070676_10168331 3300005328 Bacteria 1415
42 Ga0070666_10000018 3300005335 Bacteria 187218
43 Ga0070680_100000853 3300005336 Bacteria 21627
44 Ga0070682_100004042 3300005337 Bacteria 8151
45 Ga0070682_100005607 3300005337 Bacteria 6999
46 Ga0070682_100014110 3300005337 Bacteria 4613
47 Ga0070689_100027819 3300005340 Bacteria 4266
48 Ga0070691_10000250 3300005341 Bacteria 18513
49 Ga0070691_10021310 3300005341 Bacteria 2998
50 Ga0070687_100042650 3300005343 Bacteria 2300
51 Ga0070661_100001741 3300005344 Bacteria 15095
52 Ga0070661_100012555 3300005344 Bacteria 5928
53 Ga0070692_10000240 3300005345 Bacteria 15073
54 Ga0070668_100111418 3300005347 Bacteria 2178
55 Ga0070675_100159843 3300005354 Bacteria 1937
56 Ga0070659_100000803 3300005366 Bacteria 22895
57 Ga0070659_100054541 3300005366 Bacteria 3148
58 Ga0070714_100041704 3300005435 Bacteria 3874
59 Ga0070710_10007835 3300005437 Bacteria 5184
60 Ga0070700_100033954 3300005441 Bacteria 3077
61 Ga0070663_100005402 3300005455 Bacteria 7592
62 Ga0070663_100008855 3300005455 Bacteria 6211
63 Ga0070663_100036665 3300005455 Bacteria 3407
64 Ga0070662_100144773 3300005457 Bacteria 1845
65 Ga0070681_10005430 3300005458 Bacteria 12314
66 Ga0070681_10011175 3300005458 Bacteria 8885
67 Ga0070681_10046356 3300005458 Bacteria 4346
68 Ga0070681_10077332 3300005458 Bacteria 3286
69 Ga0068867_100057633 3300005459 Bacteria 2877
70 Ga0070685_10042813 3300005466 Bacteria 2586
71 Ga0070679_100000472 3300005530 Bacteria 34355
72 Ga0070679_100006874 3300005530 Bacteria 10609
73 Ga0068853_100005187 3300005539 Bacteria 10193
74 Ga0068853_100258400 3300005539 Bacteria 1600
75 Ga0070696_100001590 3300005546 Bacteria 14885
76 Ga0070696_100011164 3300005546 Bacteria 6010
77 Ga0070696_100011693 3300005546 Bacteria 5882
78 Ga0070693_100018104 3300005547 Bacteria 3674
79 Ga0070693_100056265 3300005547 Bacteria 2269
80 Ga0068855_100079749 3300005563 Bacteria 3796
81 Ga0068855_100082957 3300005563 Bacteria 3714
82 Ga0068855_100115217 3300005563 Bacteria 3081
83 Ga0068855_100317037 3300005563 Bacteria 1724
84 Ga0070664_100170706 3300005564 Bacteria 1929
85 Ga0068857_100000513 3300005577 Bacteria 27847
86 Ga0068857_100044772 3300005577 Bacteria 3926
87 Ga0068854_100007514 3300005578 Bacteria 6966
88 Ga0068854_100022388 3300005578 Bacteria 4304
89 Ga0068856_100002381 3300005614 Bacteria 19348
90 Ga0068852_100031524 3300005616 Bacteria 4376
91 Ga0068859_100105621 3300005617 Bacteria 2875
92 Ga0068861_100029904 3300005719 Bacteria 3988
93 Ga0068851_10001902 3300005834 Bacteria 9175
94 Ga0068851_10050087 3300005834 Bacteria 2120
95 Ga0068858_100145419 3300005842 Bacteria 2226
96 Ga0081539_10001836 3300005985 Bacteria 33487
97 Ga0075428_100004658 3300006844 Bacteria 15175
98 Ga0075428_100055177 3300006844 Bacteria 4353
99 Ga0075430_100036249 3300006846 Bacteria 4182
100 Ga0075430_100092064 3300006846 Bacteria 2535
101 Ga0075431_100024386 3300006847 Bacteria 6198
102 Ga0075431_100062407 3300006847 Bacteria 3845
103 Ga0075431_100317751 3300006847 Bacteria 1571
104 Ga0075429_100096758 3300006880 Bacteria 2575
105 Ga0075429_100216012 3300006880 Bacteria 1680
106 Ga0068865_100016817 3300006881 Bacteria 4689
107 Ga0097620_100105628 3300006931 Bacteria 2875
108 Ga0105240_10006542 3300009093 Bacteria 17109
109 Ga0105240_10023096 3300009093 Bacteria 8236
110 Ga0105240_10076159 3300009093 Bacteria 4137
111 Ga0105240_10076448 3300009093 Bacteria 4127
112 Ga0105240_10116929 3300009093 Bacteria 3216
113 Ga0105240_10236520 3300009093 Bacteria 2120
114 Ga0111539_10039597 3300009094 Bacteria 5679
115 Ga0111539_10088646 3300009094 Bacteria 3635
116 Ga0111539_10106365 3300009094 Bacteria 3291
117 Ga0114129_10179951 3300009147 Unclassified 2878
118 Ga0105237_10000026 3300009545 Bacteria 212619
119 Ga0105237_10000105 3300009545 Bacteria 118218
120 Ga0105238_10000319 3300009551 Bacteria 52428
121 Ga0105238_10018682 3300009551 Bacteria 7061
122 Ga0105249_10103211 3300009553 Bacteria 2685
123 Ga0105030_100028 3300009987 Bacteria 11265
124 Ga0105239_10000791 3300010375 Bacteria 44909
125 Ga0157373_10013306 3300013100 Bacteria 6038
126 Ga0157371_10010032 3300013102 Bacteria 7406
127 Ga0157371_10207401 3300013102 Bacteria 1406
128 Ga0157370_10033752 3300013104 Bacteria 4987
129 Ga0157370_10078766 3300013104 Bacteria 3103
130 Ga0157369_10003727 3300013105 Bacteria 18101
131 Ga0157369_10132762 3300013105 Bacteria 2637
132 Ga0163162_10001986 3300013306 Bacteria 19222
133 Ga0157372_10003710 3300013307 Bacteria 16413
134 Ga0157372_10094353 3300013307 Bacteria 3407
135 Ga0157380_10066313 3300014326 Bacteria 2903
136 Ga0182008_10022537 3300014497 Bacteria 3225
137 Ga0182006_1017733 3300015261 Bacteria 3019
138 Ga0182007_10004263 3300015262 Bacteria 6527
139 Ga0182007_10040595 3300015262 Bacteria 1553
140 Ga0163161_10060060 3300017792 Bacteria 2766
141 Ga0206356_10534545 3300020070 Bacteria 10914
142 Ga0206353_12002709 3300020082 Bacteria 2694
143 Ga0209674_100053 3300025226 Bacteria 323159
144 Ga0209672_100009 3300025228 Bacteria 883623
145 Ga0209672_100082 3300025228 Bacteria 137036
146 Ga0209672_100163 3300025228 Bacteria 57341
147 Ga0209672_100780 3300025228 Bacteria 15210
148 Ga0209563_100087 3300025230 Bacteria 180595
149 Ga0207427_100168 3300025231 Bacteria 72708
150 Ga0209437_100292 3300025233 Bacteria 72708
151 Ga0209258_100011 3300025242 Bacteria 867542
152 Ga0209258_100155 3300025242 Bacteria 157847
153 Ga0209258_100181 3300025242 Bacteria 137036
154 Ga0209258_100184 3300025242 Bacteria 133161
155 Ga0209646_1002239 3300025246 Bacteria 4441
156 Ga0209646_1005240 3300025246 Bacteria 2281
157 Ga0209026_1000111 3300025250 Bacteria 140599
158 Ga0209026_1000280 3300025250 Bacteria 58823
159 Ga0209026_1000412 3300025250 Bacteria 37194
160 Ga0209677_102044 3300025253 Bacteria 7986
161 Ga0209148_1000013 3300025254 Bacteria 956684
162 Ga0209148_1000125 3300025254 Bacteria 184380
163 Ga0209148_1000164 3300025254 Bacteria 137036
164 Ga0209148_1000169 3300025254 Bacteria 133161
165 Ga0209759_1000808 3300025256 Bacteria 25112
166 Ga0209759_1000962 3300025256 Bacteria 20381
167 Ga0209129_1004352 3300025258 Bacteria 5577
168 Ga0209233_1000276 3300025261 Bacteria 72708
169 Ga0209455_1000012 3300025272 Bacteria 867234
170 Ga0209455_1000077 3300025272 Bacteria 279165
171 Ga0209455_1000145 3300025272 Bacteria 137036
172 Ga0209455_1000980 3300025272 Bacteria 14435
173 Ga0209758_1000269 3300025297 Bacteria 103013
174 Ga0209758_1000309 3300025297 Bacteria 94619
175 Ga0207642_10026492 3300025899 Bacteria 2361
176 Ga0207680_10000002 3300025903 Bacteria 1018646
177 Ga0207647_10001673 3300025904 Bacteria 17075
178 Ga0207647_10027173 3300025904 Bacteria 3734
179 Ga0207645_10000736 3300025907 Bacteria 27275
180 Ga0207705_10000368 3300025909 Bacteria 40858
181 Ga0207705_10002079 3300025909 Bacteria 15566
182 Ga0207705_10008040 3300025909 Bacteria 7730
183 Ga0207707_10000210 3300025912 Bacteria 62292
184 Ga0207707_10000255 3300025912 Bacteria 58579
185 Ga0207707_10051082 3300025912 Bacteria 3600
186 Ga0207707_10061757 3300025912 Bacteria 3261
187 Ga0207707_10117115 3300025912 Bacteria 2329
188 Ga0207695_10002203 3300025913 Bacteria 29330
189 Ga0207695_10002441 3300025913 Bacteria 27477
190 Ga0207695_10003029 3300025913 Bacteria 24120
191 Ga0207695_10004361 3300025913 Bacteria 19376
192 Ga0207695_10019649 3300025913 Bacteria 7770
193 Ga0207695_10055778 3300025913 Bacteria 4116
194 Ga0207671_10000041 3300025914 Bacteria 216095
195 Ga0207671_10000167 3300025914 Bacteria 100428
196 Ga0207660_10000360 3300025917 Bacteria 29709
197 Ga0207660_10000659 3300025917 Bacteria 23141
198 Ga0207662_10029058 3300025918 Bacteria 3200
199 Ga0207657_10003895 3300025919 Bacteria 15836
200 Ga0207657_10008087 3300025919 Bacteria 10725
201 Ga0207649_10027290 3300025920 Bacteria 3349
202 Ga0207652_10000231 3300025921 Bacteria 58590
203 Ga0207652_10000314 3300025921 Bacteria 49931
204 Ga0207652_10076190 3300025921 Bacteria 2924
205 Ga0207681_10060140 3300025923 Bacteria 2607
206 Ga0207694_10000388 3300025924 Bacteria 40972
207 Ga0207659_10010181 3300025926 Bacteria 5897
208 Ga0207659_10040527 3300025926 Bacteria 3257
209 Ga0207664_10000103 3300025929 Bacteria 77654
210 Ga0207690_10000565 3300025932 Bacteria 24186
211 Ga0207690_10002157 3300025932 Bacteria 12029
212 Ga0207690_10005240 3300025932 Bacteria 7648
213 Ga0207690_10006585 3300025932 Bacteria 6881
214 Ga0207690_10028137 3300025932 Bacteria 3560
215 Ga0207706_10007798 3300025933 Bacteria 9880
216 Ga0207706_10025465 3300025933 Bacteria 5301
217 Ga0207706_10124864 3300025933 Bacteria 2264
218 Ga0207670_10003613 3300025936 Bacteria 8205
219 Ga0207691_10001397 3300025940 Bacteria 24162
220 Ga0207661_10000529 3300025944 Bacteria 24467
221 Ga0207679_10236557 3300025945 Bacteria 1545
222 Ga0207667_10000119 3300025949 Bacteria 124365
223 Ga0207667_10000624 3300025949 Bacteria 45756
224 Ga0207667_10001011 3300025949 Bacteria 35804
225 Ga0207667_10010357 3300025949 Bacteria 10900
226 Ga0207667_10021575 3300025949 Bacteria 7135
227 Ga0207667_10080953 3300025949 Bacteria 3364
228 Ga0207668_10057012 3300025972 Bacteria 2724
229 Ga0207640_10003244 3300025981 Bacteria 8763
230 Ga0207640_10003872 3300025981 Bacteria 8079
231 Ga0207640_10018021 3300025981 Bacteria 4143
232 Ga0207703_10122576 3300026035 Bacteria 2234
233 Ga0207639_10000231 3300026041 Bacteria 41634
234 Ga0207639_10002163 3300026041 Bacteria 13227
235 Ga0207639_10008225 3300026041 Bacteria 7143
236 Ga0207678_10002281 3300026067 Bacteria 17354
237 Ga0207678_10005355 3300026067 Bacteria 11491
238 Ga0207678_10039095 3300026067 Bacteria 4118
239 Ga0207708_10002773 3300026075 Bacteria 12871
240 Ga0207708_10024917 3300026075 Bacteria 4526
241 Ga0207702_10000473 3300026078 Bacteria 45429
242 Ga0207702_10005541 3300026078 Bacteria 11029
243 Ga0207702_10014455 3300026078 Bacteria 6554
244 Ga0207648_10035639 3300026089 Bacteria 4384
245 Ga0207676_10165030 3300026095 Unclassified 1923
246 Ga0207674_10000209 3300026116 Bacteria 72184
247 Ga0207674_10002836 3300026116 Bacteria 21551
248 Ga0207674_10016106 3300026116 Bacteria 8190
249 Ga0207674_10047589 3300026116 Bacteria 4394
250 Ga0207675_100003067 3300026118 Bacteria 16387
251 Ga0207675_100021157 3300026118 Bacteria 6060
252 Ga0207698_10000238 3300026142 Bacteria 34346
253 Ga0207698_10033822 3300026142 Bacteria 3719
254 Ga0209971_1001181 3300027682 Bacteria 6573
255 Ga0209971_1007782 3300027682 Bacteria 2542
256 Ga0209998_10001641 3300027717 Bacteria 5360
257 Ga0209974_10002814 3300027876 Bacteria 6313
258 Ga0209974_10045310 3300027876 Bacteria 1468
259 Ga0207428_10060186 3300027907 Bacteria 3009
260 Ga0207428_10061480 3300027907 Bacteria 2973
261 Ga0207428_10062398 3300027907 Unclassified 2947
262 Ga0268266_10000004 3300028379 Bacteria 1495817
263 Ga0316578_10093256 3300031728 Bacteria 1800
264 Ga0307406_10004920 3300031901 Bacteria 7279
265 Ga0307409_100002177 3300031995 Bacteria 10109
266 Ga0307409_100060669 3300031995 Bacteria 2951
267 Ga0307411_10077350 3300032005 Bacteria 2277
268 Ga0307411_10129257 3300032005 Bacteria 1843
269 Ga0316580_10004403 3300032139 Bacteria 4081
270 Ga0307510_10007911 3300033180 Bacteria 12657
271 Ga0316582_0035717 3300036647 Bacteria 3071
272 Ga0316584_0024458 3300036712 Bacteria 4420
273 Ga0395899_0000069 3300037312 Bacteria 194382
274 Ga0395899_0046981 3300037312 Bacteria 3214
275 Ga0395899_0132213 3300037312 Bacteria 1781
276 Ga0395900_0000018 3300037418 Bacteria 363472
277 Ga0395900_0170428 3300037418 Bacteria 2216
278 Ga0395900_0209518 3300037418 Bacteria 1969
279 Ga0395898_0000167 3300037466 Bacteria 168946
280 Ga0395898_0038200 3300037466 Bacteria 4760
281 Ga0395898_0109140 3300037466 Bacteria 2653
282 Ga0395901_0000518 3300038443 Bacteria 44502
283 Ga0395901_0012406 3300038443 Bacteria 8646
284 Ga0395901_0021035 3300038443 Bacteria 6683
285 Ga0395901_0126854 3300038443 Bacteria 2681
286 Ga0395901_0149963 3300038443 Bacteria 2450
287 Ga0395901_0150544 3300038443 Bacteria 2445
288 Ga0439453_0005171 3300041408 Bacteria 1977
289 Ga0450920_014234 3300042122 Bacteria 1503
290 Ga0450892_002552 3300042130 Bacteria 1544
291 Ga0450895_002400 3300042132 Bacteria 1394
292 Ga0450896_000032 3300042133 Bacteria 8042
293 Ga0450910_002617 3300042147 Bacteria 2367
294 Ga0439446_0008345 3300042156 Bacteria 2746
295 Ga0439446_0012114 3300042156 Bacteria 2352
296 Ga0450908_004733 3300042184 Bacteria 2621
297 Ga0450908_013938 3300042184 Bacteria 1449
298 Ga0439434_0000513 3300042435 Bacteria 11036
299 Ga0439435_0000983 3300042436 Bacteria 4976
300 Ga0439459_0006290 3300042438 Bacteria 1974
301 Ga0450916_004755 3300042530 Bacteria 1547
302 Ga0450918_010412 3300042531 Bacteria 1624
303 Ga0451577_0000023 3300042876 Bacteria 419051
304 Ga0451577_0000368 3300042876 Bacteria 83997
305 Ga0451577_0023613 3300042876 Bacteria 5605
306 Ga0451577_0027508 3300042876 Bacteria 5148
307 Ga0453683_0013079 3300044673 Bacteria 5427
308 Ga0466961_0001631 3300044693 Bacteria 13916
309 Ga0466961_0020401 3300044693 Bacteria 4262
310 Ga0466961_0091787 3300044693 Bacteria 1917
311 Ga0453684_0045852 3300044712 Bacteria 5824
312 Ga0453684_0067647 3300044712 Bacteria 4542
313 Ga0453684_0072622 3300044712 Bacteria 4343
314 Ga0453684_0260545 3300044712 Bacteria 1986
315 Ga0466970_0010893 3300044765 Bacteria 4624
316 Ga0466970_0056302 3300044765 Bacteria 2101
317 Ga0466959_0016825 3300045049 Bacteria 5351
318 Ga0451576_0001856 3300045051 Bacteria 34183
319 Ga0451576_0004096 3300045051 Bacteria 19245
320 Ga0451576_0009866 3300045051 Bacteria 11031
321 Ga0451576_0013485 3300045051 Bacteria 9142
322 Ga0451576_0026081 3300045051 Bacteria 6288
323 Ga0451576_0135689 3300045051 Bacteria 2566
324 Ga0466958_0129624 3300045836 Bacteria 1583
325 Ga0495638_0000934 3300046460 Bacteria 29607
326 Ga0495625_0012697 3300046660 Bacteria 6813
327 Ga0496100_0064562 3300048903 Bacteria 2423
328 Ga0496102_0200688 3300048905 Bacteria 1880
329 Ga0496104_0051962 3300048907 Bacteria 3870
330 Ga0496105_0005713 3300048908 Bacteria 9470
331 Ga0496118_0004237 3300048921 Bacteria 17199
332 Ga0496118_0007830 3300048921 Bacteria 11205
333 Ga0496119_0000447 3300048922 Bacteria 56393
334 Ga0496120_0000575 3300048923 Bacteria 56074
335 Ga0496120_0002386 3300048923 Bacteria 19150
336 Ga0496121_0005714 3300048924 Bacteria 15797
337 Ga0496121_0017317 3300048924 Bacteria 7371
338 Ga0496121_0130156 3300048924 Bacteria 1885
339 Ga0496125_0001371 3300048928 Bacteria 35830
340 Ga0496126_0001972 3300048929 Bacteria 29078
341 Ga0496126_0013108 3300048929 Bacteria 8455
342 Ga0501031_0067121 3300049568 Bacteria 2337
343 Ga0501031_0133637 3300049568 Bacteria 1621
344 Ga0501032_0027528 3300049569 Bacteria 3906
345 Ga0501032_0138742 3300049569 Bacteria 1602
346 Ga0501033_0114834 3300049570 Bacteria 1957
347 Ga0501033_0121675 3300049570 Bacteria 1894
348 Ga0501034_0034789 3300049571 Bacteria 5108
349 Ga0501036_0054420 3300049572 Bacteria 3390
350 Ga0501036_0099838 3300049572 Bacteria 2455
351 Ga0501037_0043781 3300049573 Bacteria 3290
352 Ga0501037_0085484 3300049573 Bacteria 2284
353 Ga0501037_0104794 3300049573 Bacteria 2039
354 Ga0501038_0054846 3300049574 Bacteria 3427
355 Ga0501038_0074533 3300049574 Bacteria 2871
356 Ga0501040_0013584 3300049576 Bacteria 5355
357 Ga0501040_0044732 3300049576 Bacteria 3019
358 Ga0501041_0056596 3300049577 Bacteria 2396
359 Ga0501043_0074986 3300049579 Bacteria 2657
360 Ga0501046_0035234 3300049580 Bacteria 4034
361 Ga0501047_0113671 3300049581 Bacteria 2590
362 Ga0501067_0007659 3300049583 Bacteria 6003
363 Ga0501067_0023031 3300049583 Bacteria 3450
364 Ga0501068_0001719 3300049584 Bacteria 11648
365 Ga0501068_0026368 3300049584 Bacteria 3423
366 Ga0501068_0026522 3300049584 Bacteria 3415
367 Ga0501070_0000180 3300049586 Bacteria 59024
368 Ga0501070_0028172 3300049586 Bacteria 4711
369 Ga0501070_0078368 3300049586 Bacteria 2735
370 Ga0501071_0019258 3300049587 Bacteria 4735
371 Ga0501071_0020591 3300049587 Bacteria 4585
372 Ga0501071_0062317 3300049587 Bacteria 2702
373 Ga0501071_0157280 3300049587 Bacteria 1697
374 Ga0501072_0054191 3300049588 Bacteria 3159
375 Ga0501073_0006523 3300049589 Bacteria 8681
376 Ga0501074_0013746 3300049590 Bacteria 5885
377 Ga0501074_0033645 3300049590 Bacteria 3715
378 Ga0501075_0073391 3300049591 Bacteria 2587
379 Ga0501075_0128467 3300049591 Bacteria 1930
380 Ga0501076_0016711 3300049592 Bacteria 5566
381 Ga0501076_0016834 3300049592 Bacteria 5549
382 Ga0501077_0020682 3300049593 Bacteria 4166
383 Ga0501077_0042639 3300049593 Bacteria 2885
384 Ga0501079_0003581 3300049741 Bacteria 11422
385 Ga0501079_0050321 3300049741 Bacteria 3216
386 Ga0501079_0055357 3300049741 Bacteria 3061
387 Ga0501080_0004501 3300049742 Bacteria 12422
388 Ga0501080_0014657 3300049742 Bacteria 7220
389 Ga0501080_0033107 3300049742 Bacteria 4824
390 Ga0501080_0088814 3300049742 Bacteria 2871
391 Ga0501081_0029699 3300049743 Bacteria 3696
392 Ga0501081_0057214 3300049743 Bacteria 2695
393 Ga0501081_0093658 3300049743 Bacteria 2115
394 Ga0501083_0016338 3300049744 Bacteria 5197
395 Ga0501035_0027971 3300049822 Bacteria 5151
396 Ga0501044_0130316 3300049823 Bacteria 2509
397 nmdc:mga05p37_70246_c2 3300050507 Bacteria 3934
398 nmdc:mga09592_41553_c1 3300050508 Bacteria 3866
399 nmdc:mga09592_74690_c1 3300050508 Bacteria 2881
400 nmdc:mga06r32_133668_c1 3300050510 Bacteria 2455
401 nmdc:mga08y16_106948_c1 3300050511 Unclassified 2912
402 nmdc:mga08y16_129802_c1 3300050511 Unclassified 2622
403 nmdc:mga08y16_143917_c1 3300050511 Bacteria 2478
404 nmdc:mga08y16_182847_c1 3300050511 Bacteria 2176
405 Ga0500646_0024599 3300053090 Bacteria 1622
406 Ga0500556_0000407 3300053104 Bacteria 31365
407 Ga0500568_0044667 3300053139 Bacteria 1766
408 Ga0500616_0000019 3300053153 Bacteria 549964
409 Ga0501084_0008069 3300054114 Bacteria 8672
410 Ga0501084_0063610 3300054114 Bacteria 3089
411 Ga0501084_0082833 3300054114 Bacteria 2692
412 Ga0501084_0241723 3300054114 Bacteria 1524
413 Ga0501082_0007851 3300060353 Bacteria 9205
414 Ga0501082_0039805 3300060353 Bacteria 4055
415 2538834576 2537561836 Bacteria 3910579
416 2643829901 2643221562 Bacteria 4048635
417 2643894821 2643221577 Bacteria 3710843
418 2644476986 2643221685 Bacteria 3673288
419 2788435425 2786546940 Bacteria 6396474
420 2895399093 2895395659 Bacteria 3983269
421 2939612189 2939611941 Bacteria 3892017
422 Ga0501083_0001176
423 JGI24741J21665_1000127
424 JGI24741J21665_1002031
425 JGI24741J21665_1003111
426 JGI24740J21852_10000021
427 JGI24740J21852_10002426
428 JGI24737J22298_10001210
429 JGI25156J39149_1000792
430 JGI25156J39149_1002953
431 JGI25156J39149_1005523
432 JGI25162J39368_1001171
433 JGI25154J39366_1001991
434 JGI25157J39369_1000481
435 JGI25157J39369_1001139
436 JGI25157J39369_1001904
437 JGI25164J39214_1000167
438 JGI25165J46597_1000359
439 rootH2_10000070
440 rootH2_10003054
441 rootL2_10098371
442 rootL2_10275138
443 rootH1_10262268
444 Ga0006562J51391_1030066
445 Ga0006562J51391_1030067
446 Ga0055525_1000091
447 Ga0055527_1000369
448 Ga0055527_1000382
449 Ga0055535_1000557
450 Ga0055535_1000879
451 Ga0055535_1001539
452 Ga0055542_1000863
453 Ga0055542_1000874
454 Ga0055542_1000927
455 Ga0055542_1001508
456 Ga0055529_1000258
457 Ga0055529_1000749
458 Ga0055529_1000789
459 Ga0065165_1005385
460 Ga0070658_10005923
461 Ga0070658_10221451
462 Ga0070676_10168331
463 Ga0070666_10000018
464 Ga0070680_100000853
465 Ga0070682_100004042
466 Ga0070682_100005607
467 Ga0070682_100014110
468 Ga0070689_100027819
469 Ga0070691_10000250
470 Ga0070691_10021310
471 Ga0070687_100042650
472 Ga0070661_100001741
473 Ga0070661_100012555
474 Ga0070692_10000240
475 Ga0070668_100111418
476 Ga0070675_100159843
477 Ga0070659_100000803
478 Ga0070659_100054541
479 Ga0070714_100041704
480 Ga0070710_10007835
481 Ga0070700_100033954
482 Ga0070663_100005402
483 Ga0070663_100008855
484 Ga0070663_100036665
485 Ga0070662_100144773
486 Ga0070681_10005430
487 Ga0070681_10011175
488 Ga0070681_10046356
489 Ga0070681_10077332
490 Ga0068867_100057633
491 Ga0070685_10042813
492 Ga0070679_100000472
493 Ga0070679_100006874
494 Ga0068853_100005187
495 Ga0068853_100258400
496 Ga0070696_100001590
497 Ga0070696_100011164
498 Ga0070696_100011693
499 Ga0070693_100018104
500 Ga0070693_100056265
501 Ga0068855_100079749
502 Ga0068855_100082957
503 Ga0068855_100115217
504 Ga0068855_100317037
505 Ga0070664_100170706
506 Ga0068857_100000513
507 Ga0068857_100044772
508 Ga0068854_100007514
509 Ga0068854_100022388
510 Ga0068856_100002381
511 Ga0068852_100031524
512 Ga0068859_100105621
513 Ga0068861_100029904
514 Ga0068851_10001902
515 Ga0068851_10050087
516 Ga0068858_100145419
517 Ga0081539_10001836
518 Ga0075428_100004658
519 Ga0075428_100055177
520 Ga0075430_100036249
521 Ga0075430_100092064
522 Ga0075431_100024386
523 Ga0075431_100062407
524 Ga0075431_100317751
525 Ga0075429_100096758
526 Ga0075429_100216012
527 Ga0068865_100016817
528 Ga0097620_100105628
529 Ga0105240_10006542
530 Ga0105240_10023096
531 Ga0105240_10076159
532 Ga0105240_10076448
533 Ga0105240_10116929
534 Ga0105240_10236520
535 Ga0111539_10039597
536 Ga0111539_10088646
537 Ga0111539_10106365
538 Ga0114129_10179951
539 Ga0105237_10000026
540 Ga0105237_10000105
541 Ga0105238_10000319
542 Ga0105238_10018682
543 Ga0105249_10103211
544 Ga0105030_100028
545 Ga0105239_10000791
546 Ga0157373_10013306
547 Ga0157371_10010032
548 Ga0157371_10207401
549 Ga0157370_10033752
550 Ga0157370_10078766
551 Ga0157369_10003727
552 Ga0157369_10132762
553 Ga0163162_10001986
554 Ga0157372_10003710
555 Ga0157372_10094353
556 Ga0157380_10066313
557 Ga0182008_10022537
558 Ga0182006_1017733
559 Ga0182007_10004263
560 Ga0182007_10040595
561 Ga0163161_10060060
562 Ga0206356_10534545
563 Ga0206353_12002709
564 Ga0209674_100053
565 Ga0209672_100009
566 Ga0209672_100082
567 Ga0209672_100163
568 Ga0209672_100780
569 Ga0209563_100087
570 Ga0207427_100168
571 Ga0209437_100292
572 Ga0209258_100011
573 Ga0209258_100155
574 Ga0209258_100181
575 Ga0209258_100184
576 Ga0209646_1002239
577 Ga0209646_1005240
578 Ga0209026_1000111
579 Ga0209026_1000280
580 Ga0209026_1000412
581 Ga0209677_102044
582 Ga0209148_1000013
583 Ga0209148_1000125
584 Ga0209148_1000164
585 Ga0209148_1000169
586 Ga0209759_1000808
587 Ga0209759_1000962
588 Ga0209129_1004352
589 Ga0209233_1000276
590 Ga0209455_1000012
591 Ga0209455_1000077
592 Ga0209455_1000145
593 Ga0209455_1000980
594 Ga0209758_1000269
595 Ga0209758_1000309
596 Ga0207642_10026492
597 Ga0207680_10000002
598 Ga0207647_10001673
599 Ga0207647_10027173
600 Ga0207645_10000736
601 Ga0207705_10000368
602 Ga0207705_10002079
603 Ga0207705_10008040
604 Ga0207707_10000210
605 Ga0207707_10000255
606 Ga0207707_10051082
607 Ga0207707_10061757
608 Ga0207707_10117115
609 Ga0207695_10002203
610 Ga0207695_10002441
611 Ga0207695_10003029
612 Ga0207695_10004361
613 Ga0207695_10019649
614 Ga0207695_10055778
615 Ga0207671_10000041
616 Ga0207671_10000167
617 Ga0207660_10000360
618 Ga0207660_10000659
619 Ga0207662_10029058
620 Ga0207657_10003895
621 Ga0207657_10008087
622 Ga0207649_10027290
623 Ga0207652_10000231
624 Ga0207652_10000314
625 Ga0207652_10076190
626 Ga0207681_10060140
627 Ga0207694_10000388
628 Ga0207659_10010181
629 Ga0207659_10040527
630 Ga0207664_10000103
631 Ga0207690_10000565
632 Ga0207690_10002157
633 Ga0207690_10005240
634 Ga0207690_10006585
635 Ga0207690_10028137
636 Ga0207706_10007798
637 Ga0207706_10025465
638 Ga0207706_10124864
639 Ga0207670_10003613
640 Ga0207691_10001397
641 Ga0207661_10000529
642 Ga0207679_10236557
643 Ga0207667_10000119
644 Ga0207667_10000624
645 Ga0207667_10001011
646 Ga0207667_10010357
647 Ga0207667_10021575
648 Ga0207667_10080953
649 Ga0207668_10057012
650 Ga0207640_10003244
651 Ga0207640_10003872
652 Ga0207640_10018021
653 Ga0207703_10122576
654 Ga0207639_10000231
655 Ga0207639_10002163
656 Ga0207639_10008225
657 Ga0207678_10002281
658 Ga0207678_10005355
659 Ga0207678_10039095
660 Ga0207708_10002773
661 Ga0207708_10024917
662 Ga0207702_10000473
663 Ga0207702_10005541
664 Ga0207702_10014455
665 Ga0207648_10035639
666 Ga0207676_10165030
667 Ga0207674_10000209
668 Ga0207674_10002836
669 Ga0207674_10016106
670 Ga0207674_10047589
671 Ga0207675_100003067
672 Ga0207675_100021157
673 Ga0207698_10000238
674 Ga0207698_10033822
675 Ga0209971_1001181
676 Ga0209971_1007782
677 Ga0209998_10001641
678 Ga0209974_10002814
679 Ga0209974_10045310
680 Ga0207428_10060186
681 Ga0207428_10061480
682 Ga0207428_10062398
683 Ga0268266_10000004
684 Ga0316578_10093256
685 Ga0307406_10004920
686 Ga0307409_100002177
687 Ga0307409_100060669
688 Ga0307411_10077350
689 Ga0307411_10129257
690 Ga0316580_10004403
691 Ga0307510_10007911
692 Ga0316582_0035717
693 Ga0316584_0024458
694 Ga0395899_0000069
695 Ga0395899_0046981
696 Ga0395899_0132213
697 Ga0395900_0000018
698 Ga0395900_0170428
699 Ga0395900_0209518
700 Ga0395898_0000167
701 Ga0395898_0038200
702 Ga0395898_0109140
703 Ga0395901_0000518
704 Ga0395901_0012406
705 Ga0395901_0021035
706 Ga0395901_0126854
707 Ga0395901_0149963
708 Ga0395901_0150544
709 Ga0439453_0005171
710 Ga0450920_014234
711 Ga0450892_002552
712 Ga0450895_002400
713 Ga0450896_000032
714 Ga0450910_002617
715 Ga0439446_0008345
716 Ga0439446_0012114
717 Ga0450908_004733
718 Ga0450908_013938
719 Ga0439434_0000513
720 Ga0439435_0000983
721 Ga0439459_0006290
722 Ga0450916_004755
723 Ga0450918_010412
724 Ga0451577_0000023
725 Ga0451577_0000368
726 Ga0451577_0023613
727 Ga0451577_0027508
728 Ga0453683_0013079
729 Ga0466961_0001631
730 Ga0466961_0020401
731 Ga0466961_0091787
732 Ga0453684_0045852
733 Ga0453684_0067647
734 Ga0453684_0072622
735 Ga0453684_0260545
736 Ga0466970_0010893
737 Ga0466970_0056302
738 Ga0466959_0016825
739 Ga0451576_0001856
740 Ga0451576_0004096
741 Ga0451576_0009866
742 Ga0451576_0013485
743 Ga0451576_0026081
744 Ga0451576_0135689
745 Ga0466958_0129624
746 Ga0495638_0000934
747 Ga0495625_0012697
748 Ga0496100_0064562
749 Ga0496102_0200688
750 Ga0496104_0051962
751 Ga0496105_0005713
752 Ga0496118_0004237
753 Ga0496118_0007830
754 Ga0496119_0000447
755 Ga0496120_0000575
756 Ga0496120_0002386
757 Ga0496121_0005714
758 Ga0496121_0017317
759 Ga0496121_0130156
760 Ga0496125_0001371
761 Ga0496126_0001972
762 Ga0496126_0013108
763 Ga0501031_0067121
764 Ga0501031_0133637
765 Ga0501032_0027528
766 Ga0501032_0138742
767 Ga0501033_0114834
768 Ga0501033_0121675
769 Ga0501034_0034789
770 Ga0501036_0054420
771 Ga0501036_0099838
772 Ga0501037_0043781
773 Ga0501037_0085484
774 Ga0501037_0104794
775 Ga0501038_0054846
776 Ga0501038_0074533
777 Ga0501040_0013584
778 Ga0501040_0044732
779 Ga0501041_0056596
780 Ga0501043_0074986
781 Ga0501046_0035234
782 Ga0501047_0113671
783 Ga0501067_0007659
784 Ga0501067_0023031
785 Ga0501068_0001719
786 Ga0501068_0026368
787 Ga0501068_0026522
788 Ga0501070_0000180
789 Ga0501070_0028172
790 Ga0501070_0078368
791 Ga0501071_0019258
792 Ga0501071_0020591
793 Ga0501071_0062317
794 Ga0501071_0157280
795 Ga0501072_0054191
796 Ga0501073_0006523
797 Ga0501074_0013746
798 Ga0501074_0033645
799 Ga0501075_0073391
800 Ga0501075_0128467
801 Ga0501076_0016711
802 Ga0501076_0016834
803 Ga0501077_0020682
804 Ga0501077_0042639
805 Ga0501079_0003581
806 Ga0501079_0050321
807 Ga0501079_0055357
808 Ga0501080_0004501
809 Ga0501080_0014657
810 Ga0501080_0033107
811 Ga0501080_0088814
812 Ga0501081_0029699
813 Ga0501081_0057214
814 Ga0501081_0093658
815 Ga0501083_0016338
816 Ga0501035_0027971
817 Ga0501044_0130316
818 nmdc:mga05p37_70246_c2
819 nmdc:mga09592_41553_c1
820 nmdc:mga09592_74690_c1
821 nmdc:mga06r32_133668_c1
822 nmdc:mga08y16_106948_c1
823 nmdc:mga08y16_129802_c1
824 nmdc:mga08y16_143917_c1
825 nmdc:mga08y16_182847_c1
826 Ga0500646_0024599
827 Ga0500556_0000407
828 Ga0500568_0044667
829 Ga0500616_0000019
830 Ga0501084_0008069
831 Ga0501084_0063610
832 Ga0501084_0082833
833 Ga0501084_0241723
834 Ga0501082_0007851
835 Ga0501082_0039805
836 2538834576
837 2643829901
838 2643894821
839 2644476986
840 2788435425
841 2895399093
842 2939612189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

8

441

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cua-assembly1.cif.gz_A human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state 0.6018 39 388
3v8f-assembly1.cif.gz_B crystal structure of crosslinked gltph v216c-m385c mutant 0.6014 49 381
6x2l-assembly1.cif.gz_A heaat3-ifs-na 0.594 46 390
8cuj-assembly1.cif.gz_A human excitatory amino acid transporter 3 (eaat3) protomer in an outward facing apo state in 150 mm nmdg-cl 0.5904 46 394
7nsg-assembly1.cif.gz_A structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b 0.5872 46 387
ID Description Score Start End Superfamily
af_Q22682_1_462_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.5923 40 390 1.10.3860.10
af_Q2G0Z4_33_460_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.5691 51 394 1.10.3860.10
af_Q15758_43_493_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.565 16 388 1.10.3860.10
af_Q9UAY8_3_451_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.5625 20 390 1.10.3860.10
af_D7RVR8_28_485_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.5548 8 390 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A356RI50-F1-model_v4 Sodium:dicarboxylate symporter 0.8356 200 382 GO:0015293
GO:0016020
GO:1902475
AF-A0A2S8M7D3-F1-model_v4 deleted 0.8248 203 383
AF-A0A6I9XP77-F1-model_v4 Amino acid transporter 0.8184 200 388 GO:0005313
GO:0015501
GO:0016324
GO:0031901
GO:0031902
GO:0033229
GO:0043005
GO:0045202
GO:0055038
AF-A0A293M1G7-F1-model_v4 Amino acid transporter 0.8183 180 389 GO:0005313
GO:0005886
GO:0015175
GO:0015501
AF-A0A6Q2YIA7-F1-model_v4 Amino acid transporter 0.8183 200 394 GO:0005313
GO:0005886
GO:0015175
GO:0015501

Map