F440124

General Info

Members Datasets Scaffolds Average Seq Length
421 246 405 217

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_002905|Ga0500643_002905_4814_5500
Length 228
Sequence LEKAMAAYLKAADLPQVIPVFPLDGALLLPHGMLPLNIFEPRYLNMIDDVMAGDRIVGMIQTLGPAPTFGNDDEPPAPKLAQIGCAGRITSYAETSDGRYLITLTGVCRFRLGAELPLRGPYRQVRADFAPFEADLHPLDQESDAGRDAVLDALKNYLERRGLEVDWRMAKEAPLEALVNSLAMALPFDQGEKQALLEASDVETRRKALTALLRIDAAVDDDNPSQLQ

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
12 2818991435 Caulobacter henricii 536 Isolate Unclassified
13 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
14 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
15 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
16 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
220 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
225 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
229 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
230 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
244 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.32
Nodule 0
Rhizoplane 1.43
Rhizosphere 62
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10027103 3300003215 Bacteria 2014
2 JGI25153J46596_10067528 3300003215 Bacteria 941
3 rootH1_10022538 3300003316 Bacteria 2880
4 rootL2_10065417 3300003322 Bacteria 4688
5 Ga0055537_1004331 3300003773 Bacteria 4079
6 Ga0055524_1018338 3300003775 Bacteria 2434
7 Ga0055536_1012522 3300003781 Bacteria 3138
8 Ga0055536_1013219 3300003781 Bacteria 2999
9 Ga0055528_1009094 3300003790 Bacteria 4188
10 Ga0055530_10002908 3300003791 Bacteria 10379
11 Ga0055530_10008227 3300003791 Bacteria 4216
12 Ga0055530_10011679 3300003791 Bacteria 3134
13 Ga0055531_10000947 3300003794 Bacteria 23329
14 Ga0055531_10004401 3300003794 Bacteria 8587
15 Ga0055531_10006144 3300003794 Bacteria 6874
16 Ga0055543_1011693 3300004625 Bacteria 1788
17 Ga0065165_1001692 3300005262 Bacteria 22261
18 Ga0065165_1003158 3300005262 Bacteria 12127
19 Ga0065165_1023558 3300005262 Bacteria 2085
20 Ga0065165_1050505 3300005262 Bacteria 1184
21 Ga0070676_10503834 3300005328 Bacteria 860
22 Ga0070670_100000004 3300005331 Bacteria 392110
23 Ga0070670_100023936 3300005331 Bacteria 5253
24 Ga0070670_100636868 3300005331 Bacteria 956
25 Ga0070680_100002348 3300005336 Bacteria 13971
26 Ga0070668_100002884 3300005347 Bacteria 12687
27 Ga0070668_100002963 3300005347 Bacteria 12551
28 Ga0070668_100035971 3300005347 Bacteria 3779
29 Ga0070668_100085489 3300005347 Bacteria 2479
30 Ga0070669_100190963 3300005353 Bacteria 1607
31 Ga0070671_100207489 3300005355 Bacteria 1662
32 Ga0070667_100007531 3300005367 Bacteria 9031
33 Ga0070667_100044326 3300005367 Bacteria 3735
34 Ga0070663_100353703 3300005455 Bacteria 1190
35 Ga0070662_100339211 3300005457 Bacteria 1229
36 Ga0070681_10000014 3300005458 Bacteria 132528
37 Ga0070665_100000667 3300005548 Bacteria 46192
38 Ga0070665_100285631 3300005548 Bacteria 1652
39 Ga0068855_100000752 3300005563 Bacteria 39805
40 Ga0068857_100483813 3300005577 Bacteria 1160
41 Ga0068852_100270822 3300005616 Bacteria 1634
42 Ga0068859_100095192 3300005617 Bacteria 3030
43 Ga0068864_100000058 3300005618 Bacteria 125688
44 Ga0068861_100091485 3300005719 Bacteria 2402
45 Ga0068863_100000290 3300005841 Bacteria 52019
46 Ga0068863_100578145 3300005841 Bacteria 1111
47 Ga0068858_100000006 3300005842 Bacteria 256011
48 Ga0068860_100000066 3300005843 Bacteria 182836
49 Ga0068860_100103851 3300005843 Bacteria 2713
50 Ga0068862_100025245 3300005844 Bacteria 4989
51 Ga0068862_100033648 3300005844 Bacteria 4334
52 Ga0068862_100036703 3300005844 Bacteria 4154
53 Ga0068862_100123996 3300005844 Bacteria 2280
54 Ga0075368_10004928 3300006042 Bacteria 4554
55 Ga0075363_100016426 3300006048 Bacteria 3656
56 Ga0075364_10000415 3300006051 Bacteria 21345
57 Ga0075367_10014430 3300006178 Bacteria 4277
58 Ga0075369_10174898 3300006186 Bacteria 987
59 Ga0075366_10089838 3300006195 Bacteria 1840
60 Ga0075366_10120337 3300006195 Bacteria 1582
61 Ga0075366_10216511 3300006195 Bacteria 1166
62 Ga0075370_10220199 3300006353 Bacteria 1122
63 Ga0075370_10513220 3300006353 Bacteria 724
64 Ga0068871_100558645 3300006358 Bacteria 1037
65 Ga0068871_100640175 3300006358 Bacteria 970
66 Ga0068865_100399102 3300006881 Bacteria 1126
67 Ga0097620_100095182 3300006931 Bacteria 3030
68 Ga0105240_10000830 3300009093 Bacteria 55820
69 Ga0105240_10010647 3300009093 Bacteria 12915
70 Ga0105240_10023538 3300009093 Bacteria 8142
71 Ga0105240_10601896 3300009093 Bacteria 1210
72 Ga0105240_11046244 3300009093 Bacteria 871
73 Ga0105241_10164287 3300009174 Bacteria 1828
74 Ga0105242_10017319 3300009176 Bacteria 5612
75 Ga0105248_10000001 3300009177 Bacteria 1881304
76 Ga0105248_10016004 3300009177 Bacteria 8257
77 Ga0105248_10022274 3300009177 Bacteria 7025
78 Ga0105248_10157756 3300009177 Bacteria 2560
79 Ga0105248_10427693 3300009177 Bacteria 1491
80 Ga0105248_11326063 3300009177 Bacteria 814
81 Ga0105238_10018393 3300009551 Bacteria 7113
82 Ga0105238_10061827 3300009551 Bacteria 3747
83 Ga0105238_10598491 3300009551 Bacteria 1110
84 Ga0105238_11204257 3300009551 Bacteria 782
85 Ga0105249_10040244 3300009553 Bacteria 4245
86 Ga0105239_10001627 3300010375 Bacteria 29662
87 Ga0105239_10030359 3300010375 Bacteria 5942
88 Ga0105239_10192999 3300010375 Bacteria 2280
89 Ga0157369_10005517 3300013105 Bacteria 14693
90 Ga0163163_10085374 3300014325 Bacteria 3165
91 Ga0157379_10011036 3300014968 Bacteria 7874
92 Ga0157379_10058260 3300014968 Bacteria 3453
93 Ga0163161_10693264 3300017792 Bacteria 847
94 Ga0213874_10032728 3300021377 Bacteria 1512
95 Ga0213876_10000126 3300021384 Bacteria 83223
96 Ga0213876_10055955 3300021384 Bacteria 2083
97 Ga0213876_10166089 3300021384 Bacteria 1174
98 Ga0213875_10071145 3300021388 Bacteria 1624
99 Ga0209026_1000608 3300025250 Bacteria 23009
100 Ga0209148_1005975 3300025254 Bacteria 2700
101 Ga0209565_1000183 3300025263 Bacteria 76983
102 Ga0209673_1001961 3300025273 Bacteria 16105
103 Ga0209676_1000713 3300025292 Bacteria 45996
104 Ga0209676_1003719 3300025292 Bacteria 9084
105 Ga0209564_1003434 3300025295 Bacteria 10857
106 Ga0209564_1025979 3300025295 Bacteria 1950
107 Ga0209758_1002141 3300025297 Bacteria 20813
108 Ga0209758_1003752 3300025297 Bacteria 13449
109 Ga0209050_1000053 3300025298 Bacteria 349521
110 Ga0209050_1002131 3300025298 Bacteria 18032
111 Ga0209050_1015597 3300025298 Bacteria 3177
112 Ga0209256_1001520 3300025299 Bacteria 23400
113 Ga0209256_1006940 3300025299 Bacteria 5784
114 Ga0209257_1000282 3300025304 Bacteria 113789
115 Ga0209257_1000352 3300025304 Bacteria 94530
116 Ga0209257_1000419 3300025304 Bacteria 81956
117 Ga0209257_1001795 3300025304 Bacteria 23594
118 Ga0209257_1012368 3300025304 Bacteria 3958
119 Ga0207710_10011224 3300025900 Bacteria 3773
120 Ga0207654_10111894 3300025911 Bacteria 1700
121 Ga0207654_10335511 3300025911 Bacteria 1037
122 Ga0207707_10000001 3300025912 Bacteria 1212482
123 Ga0207695_10000004 3300025913 Bacteria 1288665
124 Ga0207695_10002758 3300025913 Bacteria 25593
125 Ga0207695_10054986 3300025913 Bacteria 4152
126 Ga0207695_10943133 3300025913 Bacteria 742
127 Ga0207671_10603296 3300025914 Bacteria 875
128 Ga0207660_10000551 3300025917 Bacteria 25165
129 Ga0207662_10149667 3300025918 Bacteria 1484
130 Ga0207649_10226690 3300025920 Bacteria 1334
131 Ga0207652_10000094 3300025921 Bacteria 98207
132 Ga0207681_10111674 3300025923 Bacteria 1989
133 Ga0207694_10000014 3300025924 Bacteria 374435
134 Ga0207650_10022108 3300025925 Bacteria 4501
135 Ga0207686_10029512 3300025934 Bacteria 3236
136 Ga0207711_10000001 3300025941 Bacteria 1325674
137 Ga0207711_10012879 3300025941 Bacteria 6947
138 Ga0207711_10370125 3300025941 Bacteria 1329
139 Ga0207667_10000116 3300025949 Bacteria 128218
140 Ga0207668_10000004 3300025972 Bacteria 201204
141 Ga0207668_10008286 3300025972 Bacteria 6193
142 Ga0207668_10008535 3300025972 Bacteria 6111
143 Ga0207668_10070821 3300025972 Bacteria 2488
144 Ga0207640_10694130 3300025981 Bacteria 872
145 Ga0207658_10022559 3300025986 Bacteria 4384
146 Ga0207658_10029578 3300025986 Bacteria 3870
147 Ga0207703_10000027 3300026035 Bacteria 209608
148 Ga0207703_10012536 3300026035 Bacteria 6609
149 Ga0207703_11012358 3300026035 Bacteria 797
150 Ga0207639_10039265 3300026041 Bacteria 3526
151 Ga0207641_10000003 3300026088 Bacteria 496984
152 Ga0207641_10538571 3300026088 Bacteria 1137
153 Ga0207676_10003810 3300026095 Bacteria 10658
154 Ga0207676_10136845 3300026095 Bacteria 2091
155 Ga0207675_100053467 3300026118 Bacteria 3768
156 Ga0209981_1000565 3300027378 Bacteria 4703
157 Ga0268266_10000970 3300028379 Bacteria 36427
158 Ga0268266_10155208 3300028379 Bacteria 2067
159 Ga0268266_10473773 3300028379 Bacteria 1193
160 Ga0268265_10025500 3300028380 Bacteria 4198
161 Ga0268265_10029359 3300028380 Bacteria 3946
162 Ga0268265_10080347 3300028380 Bacteria 2571
163 Ga0268265_10112180 3300028380 Bacteria 2228
164 Ga0268264_10000113 3300028381 Bacteria 203262
165 Ga0268264_10020074 3300028381 Bacteria 5460
166 Ga0307517_10096340 3300028786 Bacteria 2371
167 Ga0307515_10041561 3300028794 Bacteria 7223
168 Ga0307515_10057851 3300028794 Bacteria 5601
169 Ga0307515_10368887 3300028794 Bacteria 1073
170 Ga0265338_10084553 3300028800 Bacteria 2648
171 Ga0265320_10004623 3300031240 Bacteria 8997
172 Ga0265325_10000060 3300031241 Bacteria 75733
173 Ga0265325_10011656 3300031241 Bacteria 5047
174 Ga0265325_10186715 3300031241 Bacteria 963
175 Ga0265339_10053438 3300031249 Bacteria 2197
176 Ga0265331_10186864 3300031250 Bacteria 935
177 Ga0265331_10238982 3300031250 Bacteria 815
178 Ga0265327_10000287 3300031251 Bacteria 99268
179 Ga0265316_10057002 3300031344 Bacteria 3048
180 Ga0265316_10559325 3300031344 Bacteria 813
181 Ga0307513_10003286 3300031456 Bacteria 22017
182 Ga0265313_10001837 3300031595 Bacteria 19362
183 Ga0265314_10034709 3300031711 Bacteria 3681
184 Ga0307516_10000338 3300031730 Bacteria 61339
185 Ga0307516_10116449 3300031730 Bacteria 2467
186 Ga0307416_100192332 3300032002 Bacteria 1926
187 Ga0307414_10368425 3300032004 Bacteria 1238
188 Ga0307510_10023326 3300033180 Bacteria 7174
189 Ga0373940_0084140 3300035088 Bacteria 945
190 Ga0373936_0033324 3300035113 Bacteria 2042
191 Ga0373939_0144783 3300035114 Bacteria 860
192 Ga0373946_0035402 3300035171 Bacteria 2020
193 Ga0373931_0180766 3300035691 Bacteria 1249
194 Ga0373935_0237790 3300035692 Bacteria 1270
195 Ga0373927_0000111 3300035695 Bacteria 62031
196 Ga0373937_0255563 3300036401 Bacteria 1652
197 Ga0373937_0294670 3300036401 Bacteria 1533
198 Ga0373925_0000209 3300037068 Bacteria 64086
199 Ga0395899_0000018 3300037312 Bacteria 423194
200 Ga0395900_0083605 3300037418 Bacteria 3279
201 Ga0395900_0291627 3300037418 Bacteria 1620
202 Ga0395898_0062040 3300037466 Bacteria 3631
203 Ga0395898_0193767 3300037466 Bacteria 1942
204 Ga0395905_0019172 3300037471 Bacteria 6487
205 Ga0395905_0281839 3300037471 Bacteria 1548
206 Ga0436364_1446448 3300037853 Bacteria 2932
207 Ga0395901_0420125 3300038443 Bacteria 1371
208 Ga0436365_0593717 3300039437 Bacteria 12392
209 Ga0436365_0689453 3300039437 Bacteria 4898
210 Ga0436365_1684223 3300039437 Bacteria 5162
211 Ga0436361_0242437 3300039447 Bacteria 31293
212 Ga0436363_0493758 3300039450 Bacteria 4036
213 Ga0436362_0200597 3300039453 Bacteria 1487
214 Ga0451853_1121887 3300041512 Bacteria 956
215 Ga0466965_0107585 3300044683 Bacteria 1431
216 Ga0466966_0149928 3300044684 Bacteria 1423
217 Ga0466961_0404382 3300044693 Bacteria 828
218 Ga0466970_0324425 3300044765 Bacteria 871
219 Ga0466959_0015302 3300045049 Bacteria 5586
220 Ga0495627_000654 3300046453 Bacteria 26690
221 Ga0495592_0150164 3300046454 Bacteria 1612
222 Ga0495590_0022740 3300046457 Bacteria 2216
223 Ga0495638_0000230 3300046460 Bacteria 76565
224 Ga0495638_0000688 3300046460 Bacteria 36751
225 Ga0495638_0001674 3300046460 Bacteria 19617
226 Ga0495638_0002962 3300046460 Bacteria 13549
227 Ga0495638_0004141 3300046460 Bacteria 11075
228 Ga0495638_0027449 3300046460 Bacteria 3684
229 Ga0495638_0068775 3300046460 Bacteria 2171
230 Ga0495650_0000207 3300046471 Bacteria 127568
231 Ga0495650_0089868 3300046471 Bacteria 1170
232 Ga0495580_0103126 3300046472 Bacteria 1983
233 Ga0495607_0072617 3300046501 Bacteria 1915
234 Ga0495583_0000025 3300046506 Bacteria 263775
235 Ga0495606_0067663 3300046507 Bacteria 2261
236 Ga0495610_0000140 3300046512 Bacteria 80219
237 Ga0495610_0002440 3300046512 Bacteria 15640
238 Ga0495610_0006540 3300046512 Bacteria 7985
239 Ga0495610_0018450 3300046512 Bacteria 3940
240 Ga0495616_0000105 3300046513 Bacteria 72439
241 Ga0495616_0170555 3300046513 Bacteria 973
242 Ga0495620_0046280 3300046515 Bacteria 1879
243 Ga0495631_0006312 3300046518 Bacteria 6134
244 Ga0495631_0250426 3300046518 Bacteria 755
245 Ga0495632_0039476 3300046519 Bacteria 2382
246 Ga0495632_0050022 3300046519 Bacteria 2063
247 Ga0495637_0005167 3300046520 Bacteria 6685
248 Ga0495637_0066918 3300046520 Bacteria 1459
249 Ga0495637_0185351 3300046520 Bacteria 770
250 Ga0495643_0022945 3300046522 Bacteria 3552
251 Ga0495643_0079887 3300046522 Bacteria 1704
252 Ga0495643_0165907 3300046522 Bacteria 1083
253 Ga0495648_0045349 3300046524 Bacteria 2735
254 Ga0495648_0144732 3300046524 Bacteria 1247
255 Ga0495663_0048363 3300046525 Bacteria 1311
256 Ga0495652_0069989 3300046529 Bacteria 2935
257 Ga0495654_0000016 3300046530 Bacteria 306416
258 Ga0495654_0050067 3300046530 Bacteria 2043
259 Ga0495640_0265817 3300046533 Bacteria 1071
260 Ga0495587_0159778 3300046536 Bacteria 1283
261 Ga0495597_0000877 3300046542 Bacteria 23394
262 Ga0495645_0052694 3300046543 Bacteria 2959
263 Ga0495622_0002815 3300046557 Bacteria 8296
264 Ga0495668_0000040 3300046616 Bacteria 230681
265 Ga0495668_0001804 3300046616 Bacteria 19521
266 Ga0495668_0005894 3300046616 Bacteria 8160
267 Ga0495668_0024881 3300046616 Bacteria 3404
268 Ga0495668_0033508 3300046616 Bacteria 2885
269 Ga0495668_0038359 3300046616 Bacteria 2677
270 Ga0495668_0353207 3300046616 Bacteria 807
271 Ga0495625_0000043 3300046660 Bacteria 205715
272 Ga0495625_0002055 3300046660 Bacteria 22587
273 Ga0495625_0006044 3300046660 Bacteria 10871
274 Ga0495625_0008430 3300046660 Bacteria 8799
275 Ga0495625_0032838 3300046660 Bacteria 3843
276 Ga0495625_0073276 3300046660 Bacteria 2400
277 Ga0495625_0134806 3300046660 Bacteria 1670
278 Ga0495625_0139861 3300046660 Bacteria 1634
279 Ga0495625_0414178 3300046660 Bacteria 839
280 Ga0495669_0000014 3300046684 Bacteria 140832
281 Ga0495669_0000731 3300046684 Bacteria 14261
282 Ga0495669_0002870 3300046684 Bacteria 7073
283 Ga0495669_0123067 3300046684 Bacteria 1217
284 Ga0495670_0133280 3300046691 Bacteria 1296
285 Ga0495670_0240565 3300046691 Bacteria 964
286 Ga0495660_0003096 3300046810 Bacteria 10368
287 Ga0495672_0004568 3300047320 Bacteria 11254
288 Ga0495683_0278887 3300047323 Bacteria 724
289 Ga0495675_0363223 3300047444 Bacteria 849
290 Ga0495673_0000223 3300047469 Bacteria 84150
291 Ga0495673_0003725 3300047469 Bacteria 9903
292 Ga0495686_0001955 3300047472 Bacteria 20498
293 Ga0495686_0009337 3300047472 Bacteria 7073
294 Ga0495686_0023957 3300047472 Bacteria 4014
295 Ga0495686_0036068 3300047472 Bacteria 3174
296 Ga0495686_0286208 3300047472 Bacteria 914
297 Ga0495686_0297199 3300047472 Bacteria 892
298 Ga0496102_0024604 3300048905 Bacteria 5354
299 Ga0496107_0009429 3300048910 Bacteria 6773
300 Ga0496107_0072776 3300048910 Bacteria 2499
301 Ga0496107_0319775 3300048910 Bacteria 1155
302 Ga0496112_0836959 3300048915 Bacteria 844
303 Ga0496115_0003294 3300048918 Bacteria 11596
304 Ga0496117_0051371 3300048920 Bacteria 2914
305 Ga0496121_0000042 3300048924 Bacteria 342304
306 Ga0496121_0008019 3300048924 Bacteria 12597
307 Ga0496124_0019539 3300048927 Bacteria 6299
308 Ga0496124_0261872 3300048927 Bacteria 1272
309 Ga0496125_0037050 3300048928 Bacteria 4246
310 Ga0496126_0011392 3300048929 Bacteria 9212
311 Ga0496126_0524634 3300048929 Bacteria 943
312 Ga0495678_001042 3300049459 Bacteria 23497
313 Ga0495682_0003140 3300049460 Bacteria 7468
314 Ga0501032_0297294 3300049569 Bacteria 1044
315 Ga0501033_0001194 3300049570 Bacteria 23444
316 Ga0501037_0090703 3300049573 Bacteria 2210
317 Ga0501038_0203483 3300049574 Bacteria 1588
318 Ga0501047_0012196 3300049581 Bacteria 8136
319 Ga0501047_0022986 3300049581 Bacteria 5985
320 Ga0501047_0065079 3300049581 Bacteria 3515
321 Ga0501047_0103456 3300049581 Bacteria 2728
322 Ga0501047_0108214 3300049581 Bacteria 2662
323 Ga0501047_0752120 3300049581 Bacteria 791
324 Ga0501048_0102758 3300049582 Bacteria 2017
325 Ga0501048_0429487 3300049582 Bacteria 945
326 Ga0501070_0517189 3300049586 Bacteria 958
327 Ga0501238_000305 3300049671 Bacteria 6433
328 Ga0501238_007718 3300049671 Bacteria 1404
329 Ga0501257_007347 3300049686 Bacteria 2462
330 Ga0501080_0016374 3300049742 Bacteria 6848
331 Ga0501035_0026275 3300049822 Bacteria 5328
332 Ga0501044_0012942 3300049823 Bacteria 9031
333 Ga0501044_0139591 3300049823 Bacteria 2412
334 Ga0501044_0273759 3300049823 Bacteria 1623
335 Ga0501044_0701885 3300049823 Bacteria 897
336 nmdc:mga03683_134016_c1 3300050489 Bacteria 1110
337 nmdc:mga00v17_494_c1 3300050491 Bacteria 22171
338 nmdc:mga0k408_126535_c1 3300050493 Bacteria 1516
339 nmdc:mga0k408_43154_c1 3300050493 Bacteria 2598
340 nmdc:mga0k408_54694_c1 3300050493 Bacteria 2313
341 nmdc:mga06z11_25706_c1 3300050494 Bacteria 2794
342 nmdc:mga07m45_140017_c1 3300050496 Bacteria 1401
343 nmdc:mga07m45_375041_c1 3300050496 Bacteria 826
344 Ga0500635_0001420 3300053080 Bacteria 5768
345 Ga0500578_0000041 3300053086 Bacteria 129580
346 Ga0500578_0147692 3300053086 Bacteria 1466
347 Ga0500643_000265 3300053087 Bacteria 46271
348 Ga0500643_002905 3300053087 Bacteria 8515
349 Ga0500643_010645 3300053087 Bacteria 3408
350 Ga0500643_025424 3300053087 Bacteria 1868
351 Ga0500643_031655 3300053087 Bacteria 1611
352 Ga0500647_0023029 3300053091 Bacteria 2919
353 Ga0500641_0001082 3300053096 Bacteria 9702
354 Ga0500641_0001351 3300053096 Bacteria 8719
355 Ga0500641_0171301 3300053096 Bacteria 934
356 Ga0500554_026611 3300053102 Bacteria 1664
357 Ga0500555_000832 3300053103 Bacteria 11017
358 Ga0500555_012018 3300053103 Bacteria 2488
359 Ga0500556_0000688 3300053104 Bacteria 20792
360 Ga0500556_0006739 3300053104 Bacteria 3266
361 Ga0500556_0147080 3300053104 Bacteria 928
362 Ga0500562_000786 3300053108 Bacteria 7753
363 Ga0500562_001777 3300053108 Bacteria 5388
364 Ga0500562_013432 3300053108 Bacteria 2091
365 Ga0500569_002122 3300053109 Bacteria 3858
366 Ga0500572_001102 3300053111 Bacteria 7916
367 Ga0500593_143616 3300053117 Bacteria 936
368 Ga0500594_0000437 3300053118 Bacteria 9204
369 Ga0500595_008594 3300053119 Bacteria 4166
370 Ga0500595_029784 3300053119 Bacteria 1848
371 Ga0500595_048852 3300053119 Bacteria 1320
372 Ga0500607_058726 3300053121 Bacteria 2023
373 Ga0500618_000022 3300053125 Bacteria 157907
374 Ga0500655_037593 3300053133 Bacteria 944
375 Ga0500655_048506 3300053133 Bacteria 843
376 Ga0500658_0003982 3300053134 Bacteria 5546
377 Ga0500658_0104062 3300053134 Bacteria 1242
378 Ga0500559_0000004 3300053136 Bacteria 241551
379 Ga0500559_0000054 3300053136 Bacteria 90695
380 Ga0500559_0002343 3300053136 Bacteria 9908
381 Ga0500559_0002849 3300053136 Bacteria 8736
382 Ga0500559_0009524 3300053136 Bacteria 4198
383 Ga0500559_0162204 3300053136 Bacteria 1050
384 Ga0500568_0077826 3300053139 Bacteria 1262
385 Ga0500577_0001345 3300053142 Bacteria 6286
386 Ga0500616_0005399 3300053153 Bacteria 8678
387 Ga0500619_024052 3300053154 Bacteria 1788
388 Ga0500622_0009386 3300053156 Bacteria 5414
389 Ga0500622_0010718 3300053156 Bacteria 5016
390 Ga0500622_0010795 3300053156 Bacteria 4995
391 Ga0500622_0014800 3300053156 Bacteria 4182
392 Ga0500622_0015451 3300053156 Bacteria 4086
393 Ga0500622_0038462 3300053156 Bacteria 2495
394 Ga0500627_0012068 3300053158 Bacteria 3221
395 Ga0500638_063624 3300053162 Bacteria 1770
396 Ga0500636_0005973 3300053177 Bacteria 6977
397 Ga0500637_0068106 3300053178 Bacteria 2045
398 Ga0500645_000487 3300053730 Bacteria 26840
399 Ga0500645_001143 3300053730 Bacteria 14378
400 Ga0500645_002128 3300053730 Bacteria 9121
401 Ga0500645_002212 3300053730 Bacteria 8872
402 Ga0500552_020948 3300053733 Bacteria 930
403 Ga0500596_004130 3300053735 Bacteria 2689
404 Ga0501084_0000512 3300054114 Bacteria 29772
405 Ga0501082_0141598 3300060353 Bacteria 2087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053134 Ga0500658_0104062 Ga0500658_0104062_691_1230 176
2 3300049671 Ga0501238_000305 Ga0501238_000305_3467_4129 184
3 3300053136 Ga0500559_0000004 Ga0500559_0000004_229650_230297 185
4 3300046520 Ga0495637_0005167 Ga0495637_0005167_4460_5122 186
5 3300046691 Ga0495670_0133280 Ga0495670_0133280_11_673 186
6 3300053104 Ga0500556_0000688 Ga0500556_0000688_11801_12463 186
7 3300053730 Ga0500645_002128 Ga0500645_002128_46_708 186
8 3300047472 Ga0495686_0286208 Ga0495686_0286208_14_589 188
9 3300053136 Ga0500559_0009524 Ga0500559_0009524_1998_2645 188
10 3300053154 Ga0500619_024052 Ga0500619_024052_264_911 188
11 3300005262 Ga0065165_1050505 Ga0065165_10505052 196
12 3300039453 Ga0436362_0200597 Ga0436362_0200597_186_851 198
13 3300047472 Ga0495686_0297199 Ga0495686_0297199_144_806 199
14 3300039447 Ga0436361_0242437 Ga0436361_0242437_111_812 200
15 3300005328 Ga0070676_10503834 Ga0070676_105038341 202
16 3300005347 Ga0070668_100002884 Ga0070668_10000288415 202
17 3300005367 Ga0070667_100044326 Ga0070667_1000443262 202
18 3300005548 Ga0070665_100000667 Ga0070665_10000066723 202
19 3300005577 Ga0068857_100483813 Ga0068857_1004838132 202
20 3300005844 Ga0068862_100025245 Ga0068862_1000252451 202
21 3300009177 Ga0105248_10157756 Ga0105248_101577562 202
22 3300025941 Ga0207711_10370125 Ga0207711_103701252 202
23 3300025972 Ga0207668_10000004 Ga0207668_10000004168 202
24 3300025986 Ga0207658_10029578 Ga0207658_100295784 202
25 3300028379 Ga0268266_10000970 Ga0268266_1000097041 202
26 3300028380 Ga0268265_10025500 Ga0268265_100255004 202
27 3300035088 Ga0373940_0084140 Ga0373940_0084140_106_762 202
28 3300035691 Ga0373931_0180766 Ga0373931_0180766_35_691 202
29 3300005457 Ga0070662_100339211 Ga0070662_1003392112 204
30 3300005618 Ga0068864_100000058 Ga0068864_10000005873 204
31 3300005841 Ga0068863_100000290 Ga0068863_10000029046 204
32 3300005842 Ga0068858_100000006 Ga0068858_100000006209 204
33 3300009177 Ga0105248_10016004 Ga0105248_1001600410 204
34 3300009177 Ga0105248_10022274 Ga0105248_100222743 204
35 3300014325 Ga0163163_10085374 Ga0163163_100853743 204
36 3300014968 Ga0157379_10058260 Ga0157379_100582605 204
37 3300025941 Ga0207711_10012879 Ga0207711_100128798 204
38 3300026035 Ga0207703_10000027 Ga0207703_10000027134 204
39 3300026088 Ga0207641_10000003 Ga0207641_10000003239 204
40 3300026095 Ga0207676_10003810 Ga0207676_100038108 204
41 3300032002 Ga0307416_100192332 Ga0307416_1001923322 204
42 3300046507 Ga0495606_0067663 Ga0495606_0067663_1561_2223 204
43 3300046512 Ga0495610_0018450 Ga0495610_0018450_2956_3618 204
44 3300046522 Ga0495643_0022945 Ga0495643_0022945_1284_1946 204
45 3300046530 Ga0495654_0050067 Ga0495654_0050067_997_1659 204
46 3300046542 Ga0495597_0000877 Ga0495597_0000877_2087_2749 204
47 3300046557 Ga0495622_0002815 Ga0495622_0002815_3580_4242 204
48 3300046616 Ga0495668_0024881 Ga0495668_0024881_976_1638 204
49 3300046660 Ga0495625_0139861 Ga0495625_0139861_707_1369 204
50 3300046684 Ga0495669_0002870 Ga0495669_0002870_3986_4651 204
51 3300048905 Ga0496102_0024604 Ga0496102_0024604_2650_3312 204
52 3300048910 Ga0496107_0319775 Ga0496107_0319775_452_1117 204
53 3300048920 Ga0496117_0051371 Ga0496117_0051371_2025_2687 204
54 3300048924 Ga0496121_0000042 Ga0496121_0000042_231043_231705 204
55 3300053086 Ga0500578_0147692 Ga0500578_0147692_707_1369 204
56 3300053109 Ga0500569_002122 Ga0500569_002122_241_903 204
57 3300053119 Ga0500595_008594 Ga0500595_008594_317_979 204
58 3300053136 Ga0500559_0162204 Ga0500559_0162204_274_936 204
59 3300053735 Ga0500596_004130 Ga0500596_004130_1877_2539 204
60 3300006353 Ga0075370_10220199 Ga0075370_102201992 205
61 3300046616 Ga0495668_0038359 Ga0495668_0038359_351_1025 205
62 3300053119 Ga0500595_029784 Ga0500595_029784_670_1344 205
63 3300025918 Ga0207662_10149667 Ga0207662_101496672 206
64 3300037471 Ga0395905_0019172 Ga0395905_0019172_2715_3374 206
65 3300049823 Ga0501044_0701885 Ga0501044_0701885_42_710 206
66 3300053087 Ga0500643_025424 Ga0500643_025424_612_1271 206
67 3300028786 Ga0307517_10096340 Ga0307517_100963403 207
68 3300046524 Ga0495648_0144732 Ga0495648_0144732_43_675 207
69 3300049570 Ga0501033_0001194 Ga0501033_0001194_22740_23417 207
70 3300049574 Ga0501038_0203483 Ga0501038_0203483_892_1569 207
71 3300049823 Ga0501044_0012942 Ga0501044_0012942_2562_3239 207
72 3300009093 Ga0105240_10601896 Ga0105240_106018962 208
73 3300032004 Ga0307414_10368425 Ga0307414_103684252 208
74 3300039437 Ga0436365_1684223 Ga0436365_1684223_4130_4771 208
75 3300046691 Ga0495670_0240565 Ga0495670_0240565_64_729 208
76 3300050496 nmdc:mga07m45_140017_c1 nmdc:mga07m45_140017_c1_307_957 208
77 3300053730 Ga0500645_002212 Ga0500645_002212_655_1308 208
78 3300005843 Ga0068860_100000066 Ga0068860_10000006656 210
79 3300006358 Ga0068871_100558645 Ga0068871_1005586452 210
80 3300014968 Ga0157379_10011036 Ga0157379_100110362 210
81 3300021377 Ga0213874_10032728 Ga0213874_100327282 210
82 3300026035 Ga0207703_10012536 Ga0207703_100125365 210
83 3300028381 Ga0268264_10000113 Ga0268264_10000113137 210
84 3300031240 Ga0265320_10004623 Ga0265320_100046234 210
85 3300031241 Ga0265325_10000060 Ga0265325_1000006065 210
86 3300031241 Ga0265325_10011656 Ga0265325_100116565 210
87 3300031241 Ga0265325_10186715 Ga0265325_101867152 210
88 3300031249 Ga0265339_10053438 Ga0265339_100534383 210
89 3300031250 Ga0265331_10186864 Ga0265331_101868642 210
90 3300031344 Ga0265316_10057002 Ga0265316_100570021 210
91 3300031344 Ga0265316_10559325 Ga0265316_105593252 210
92 3300031595 Ga0265313_10001837 Ga0265313_100018379 210
93 3300031711 Ga0265314_10034709 Ga0265314_100347091 210
94 3300035114 Ga0373939_0144783 Ga0373939_0144783_129_779 210
95 3300036401 Ga0373937_0294670 Ga0373937_0294670_264_914 210
96 3300046472 Ga0495580_0103126 Ga0495580_0103126_819_1469 210
97 3300046533 Ga0495640_0265817 Ga0495640_0265817_156_806 210
98 3300005336 Ga0070680_100002348 Ga0070680_10000234815 211
99 3300005458 Ga0070681_10000014 Ga0070681_1000001463 211
100 3300005563 Ga0068855_100000752 Ga0068855_10000075215 211
101 3300009093 Ga0105240_10000830 Ga0105240_1000083034 211
102 3300009093 Ga0105240_10023538 Ga0105240_100235388 211
103 3300009093 Ga0105240_11046244 Ga0105240_110462442 211
104 3300009176 Ga0105242_10017319 Ga0105242_100173192 211
105 3300009177 Ga0105248_10000001 Ga0105248_10000001675 211
106 3300009177 Ga0105248_10427693 Ga0105248_104276932 211
107 3300009551 Ga0105238_10018393 Ga0105238_100183935 211
108 3300009551 Ga0105238_11204257 Ga0105238_112042572 211
109 3300010375 Ga0105239_10001627 Ga0105239_1000162730 211
110 3300010375 Ga0105239_10030359 Ga0105239_100303596 211
111 3300010375 Ga0105239_10192999 Ga0105239_101929992 211
112 3300013105 Ga0157369_10005517 Ga0157369_1000551717 211
113 3300025900 Ga0207710_10011224 Ga0207710_100112244 211
114 3300025911 Ga0207654_10111894 Ga0207654_101118942 211
115 3300025912 Ga0207707_10000001 Ga0207707_10000001723 211
116 3300025913 Ga0207695_10000004 Ga0207695_10000004919 211
117 3300025913 Ga0207695_10054986 Ga0207695_100549866 211
118 3300025913 Ga0207695_10943133 Ga0207695_109431331 211
119 3300025914 Ga0207671_10603296 Ga0207671_106032962 211
120 3300025917 Ga0207660_10000551 Ga0207660_100005516 211
121 3300025920 Ga0207649_10226690 Ga0207649_102266902 211
122 3300025921 Ga0207652_10000094 Ga0207652_1000009411 211
123 3300025924 Ga0207694_10000014 Ga0207694_1000001439 211
124 3300025934 Ga0207686_10029512 Ga0207686_100295126 211
125 3300025941 Ga0207711_10000001 Ga0207711_100000011195 211
126 3300025949 Ga0207667_10000116 Ga0207667_1000011662 211
127 3300026041 Ga0207639_10039265 Ga0207639_100392654 211
128 3300031730 Ga0307516_10116449 Ga0307516_101164492 211
129 3300036401 Ga0373937_0255563 Ga0373937_0255563_106_759 211
130 3300046454 Ga0495592_0150164 Ga0495592_0150164_569_1222 211
131 3300046529 Ga0495652_0069989 Ga0495652_0069989_1668_2321 211
132 3300046536 Ga0495587_0159778 Ga0495587_0159778_65_718 211
133 3300046543 Ga0495645_0052694 Ga0495645_0052694_128_781 211
134 3300047444 Ga0495675_0363223 Ga0495675_0363223_67_720 211
135 3300049460 Ga0495682_0003140 Ga0495682_0003140_1704_2357 211
136 3300049581 Ga0501047_0108214 Ga0501047_0108214_124_774 211
137 3300049742 Ga0501080_0016374 Ga0501080_0016374_1912_2562 211
138 3300053119 Ga0500595_048852 Ga0500595_048852_589_1260 211
139 3300053133 Ga0500655_048506 Ga0500655_048506_85_738 211
140 3300054114 Ga0501084_0000512 Ga0501084_0000512_9613_10266 211
141 3300060353 Ga0501082_0141598 Ga0501082_0141598_463_1116 211
142 3300031250 Ga0265331_10238982 Ga0265331_102389821 212
143 3300031251 Ga0265327_10000287 Ga0265327_1000028737 212
144 3300053177 Ga0500636_0005973 Ga0500636_0005973_5759_6406 212
145 3300025981 Ga0207640_10694130 Ga0207640_106941301 213
146 3300037312 Ga0395899_0000018 Ga0395899_0000018_332949_333602 213
147 3300037466 Ga0395898_0193767 Ga0395898_0193767_170_823 213
148 3300044684 Ga0466966_0149928 Ga0466966_0149928_154_807 213
149 3300045049 Ga0466959_0015302 Ga0466959_0015302_2133_2786 213
150 iso_pu_bacteria 2643221545 2643750382 213
151 iso_pu_bacteria 2643221691 2644507271 213
152 iso_pu_bacteria 2857504554 2857505907 213
153 3300006042 Ga0075368_10004928 Ga0075368_100049286 214
154 3300006048 Ga0075363_100016426 Ga0075363_1000164264 214
155 3300006051 Ga0075364_10000415 Ga0075364_1000041526 214
156 3300006178 Ga0075367_10014430 Ga0075367_100144304 214
157 3300006195 Ga0075366_10216511 Ga0075366_102165112 214
158 3300009093 Ga0105240_10010647 Ga0105240_100106472 214
159 3300009551 Ga0105238_10598491 Ga0105238_105984912 214
160 3300021384 Ga0213876_10000126 Ga0213876_1000012671 214
161 3300021388 Ga0213875_10071145 Ga0213875_100711452 214
162 3300025911 Ga0207654_10335511 Ga0207654_103355111 214
163 3300025913 Ga0207695_10002758 Ga0207695_1000275815 214
164 3300028800 Ga0265338_10084553 Ga0265338_100845533 214
165 3300037418 Ga0395900_0291627 Ga0395900_0291627_421_1080 214
166 3300037471 Ga0395905_0281839 Ga0395905_0281839_62_718 214
167 3300037853 Ga0436364_1446448 Ga0436364_1446448_74_730 214
168 3300039437 Ga0436365_0593717 Ga0436365_0593717_2479_3135 214
169 3300039450 Ga0436363_0493758 Ga0436363_0493758_166_822 214
170 3300046684 Ga0495669_0123067 Ga0495669_0123067_430_1086 214
171 3300048910 Ga0496107_0072776 Ga0496107_0072776_1426_2085 214
172 3300049569 Ga0501032_0297294 Ga0501032_0297294_183_842 214
173 3300049823 Ga0501044_0273759 Ga0501044_0273759_362_1021 214
174 3300050491 nmdc:mga00v17_494_c1 nmdc:mga00v17_494_c1_18697_19353 214
175 3300050493 nmdc:mga0k408_126535_c1 nmdc:mga0k408_126535_c1_840_1496 214
176 3300050494 nmdc:mga06z11_25706_c1 nmdc:mga06z11_25706_c1_713_1369 214
177 3300053087 Ga0500643_002905 Ga0500643_002905_4814_5500 214
178 3300053096 Ga0500641_0171301 Ga0500641_0171301_74_727 214
179 3300053111 Ga0500572_001102 Ga0500572_001102_2636_3298 214
180 iso_pu_bacteria 2510917020 2511120593 214
181 iso_pu_bacteria 2582581280 2585154563 214
182 iso_pu_bacteria 2582581293 2585198548 214
183 iso_pu_bacteria 2585428106 2587919843 214
184 iso_pu_bacteria 2643221552 2643780324 214
185 iso_pu_bacteria 2643221583 2643926935 214
186 iso_pu_bacteria 2643221584 2643932164 214
187 iso_pu_bacteria 2643221640 2644223530 214
188 iso_pu_bacteria 2643221642 2644236381 214
189 iso_pu_bacteria 2818991435 2819538352 214
190 iso_pu_bacteria 2818991454 2819649398 214
191 iso_pu_bacteria 2884960567 2884963733 214
192 iso_pu_bacteria 2928531327 2928531984 214
193 3300005331 Ga0070670_100023936 Ga0070670_1000239361 215
194 3300005331 Ga0070670_100636868 Ga0070670_1006368682 215
195 3300005347 Ga0070668_100002963 Ga0070668_1000029633 215
196 3300005347 Ga0070668_100035971 Ga0070668_1000359712 215
197 3300005347 Ga0070668_100085489 Ga0070668_1000854893 215
198 3300005353 Ga0070669_100190963 Ga0070669_1001909631 215
199 3300005355 Ga0070671_100207489 Ga0070671_1002074892 215
200 3300005367 Ga0070667_100007531 Ga0070667_1000075318 215
201 3300005455 Ga0070663_100353703 Ga0070663_1003537032 215
202 3300005548 Ga0070665_100285631 Ga0070665_1002856312 215
203 3300005617 Ga0068859_100095192 Ga0068859_1000951922 215
204 3300005719 Ga0068861_100091485 Ga0068861_1000914853 215
205 3300005841 Ga0068863_100578145 Ga0068863_1005781452 215
206 3300005843 Ga0068860_100103851 Ga0068860_1001038512 215
207 3300005844 Ga0068862_100033648 Ga0068862_1000336483 215
208 3300005844 Ga0068862_100036703 Ga0068862_1000367034 215
209 3300005844 Ga0068862_100123996 Ga0068862_1001239962 215
210 3300006195 Ga0075366_10089838 Ga0075366_100898382 215
211 3300006353 Ga0075370_10513220 Ga0075370_105132201 215
212 3300006358 Ga0068871_100640175 Ga0068871_1006401752 215
213 3300006931 Ga0097620_100095182 Ga0097620_1000951824 215
214 3300009553 Ga0105249_10040244 Ga0105249_100402441 215
215 3300017792 Ga0163161_10693264 Ga0163161_106932641 215
216 3300021384 Ga0213876_10166089 Ga0213876_101660892 215
217 3300025923 Ga0207681_10111674 Ga0207681_101116743 215
218 3300025925 Ga0207650_10022108 Ga0207650_100221082 215
219 3300025972 Ga0207668_10008286 Ga0207668_100082863 215
220 3300025972 Ga0207668_10008535 Ga0207668_100085352 215
221 3300025972 Ga0207668_10070821 Ga0207668_100708213 215
222 3300025986 Ga0207658_10022559 Ga0207658_100225593 215
223 3300026035 Ga0207703_11012358 Ga0207703_110123581 215
224 3300026088 Ga0207641_10538571 Ga0207641_105385711 215
225 3300026095 Ga0207676_10136845 Ga0207676_101368453 215
226 3300026118 Ga0207675_100053467 Ga0207675_1000534674 215
227 3300028379 Ga0268266_10155208 Ga0268266_101552082 215
228 3300028379 Ga0268266_10473773 Ga0268266_104737732 215
229 3300028380 Ga0268265_10029359 Ga0268265_100293594 215
230 3300028380 Ga0268265_10080347 Ga0268265_100803473 215
231 3300028380 Ga0268265_10112180 Ga0268265_101121802 215
232 3300028381 Ga0268264_10020074 Ga0268264_100200742 215
233 3300031730 Ga0307516_10000338 Ga0307516_1000033864 215
234 3300046660 Ga0495625_0414178 Ga0495625_0414178_97_756 215
235 3300046684 Ga0495669_0000014 Ga0495669_0000014_1644_2303 215
236 3300046684 Ga0495669_0000731 Ga0495669_0000731_11070_11729 215
237 3300049581 Ga0501047_0022986 Ga0501047_0022986_4447_5106 215
238 3300049686 Ga0501257_007347 Ga0501257_007347_1276_1932 215
239 3300050496 nmdc:mga07m45_375041_c1 nmdc:mga07m45_375041_c1_93_752 215
240 3300053087 Ga0500643_000265 Ga0500643_000265_38402_39064 215
241 3300053087 Ga0500643_010645 Ga0500643_010645_1292_1954 215
242 3300053087 Ga0500643_031655 Ga0500643_031655_739_1401 215
243 3300053096 Ga0500641_0001082 Ga0500641_0001082_7035_7697 215
244 3300053096 Ga0500641_0001351 Ga0500641_0001351_4238_4900 215
245 3300053108 Ga0500562_001777 Ga0500562_001777_2703_3365 215
246 3300053117 Ga0500593_143616 Ga0500593_143616_205_867 215
247 3300053125 Ga0500618_000022 Ga0500618_000022_23480_24139 215
248 3300053133 Ga0500655_037593 Ga0500655_037593_147_809 215
249 3300053153 Ga0500616_0005399 Ga0500616_0005399_4353_5015 215
250 3300053156 Ga0500622_0009386 Ga0500622_0009386_1808_2470 215
251 3300053156 Ga0500622_0010795 Ga0500622_0010795_687_1349 215
252 3300053156 Ga0500622_0038462 Ga0500622_0038462_800_1462 215
253 3300053730 Ga0500645_000487 Ga0500645_000487_2923_3585 215
254 3300053730 Ga0500645_001143 Ga0500645_001143_11113_11775 215
255 3300053733 Ga0500552_020948 Ga0500552_020948_16_678 215
256 3300003322 rootL2_10065417 rootL2_100654174 216
257 3300003773 Ga0055537_1004331 Ga0055537_10043313 216
258 3300003781 Ga0055536_1013219 Ga0055536_10132192 216
259 3300003790 Ga0055528_1009094 Ga0055528_10090947 216
260 3300003791 Ga0055530_10008227 Ga0055530_100082272 216
261 3300006186 Ga0075369_10174898 Ga0075369_101748982 216
262 3300006881 Ga0068865_100399102 Ga0068865_1003991022 216
263 3300025263 Ga0209565_1000183 Ga0209565_100018322 216
264 3300025273 Ga0209673_1001961 Ga0209673_10019619 216
265 3300025292 Ga0209676_1003719 Ga0209676_10037194 216
266 3300025295 Ga0209564_1025979 Ga0209564_10259792 216
267 3300025298 Ga0209050_1002131 Ga0209050_100213117 216
268 3300025304 Ga0209257_1012368 Ga0209257_10123685 216
269 3300028794 Ga0307515_10057851 Ga0307515_100578514 216
270 3300028794 Ga0307515_10368887 Ga0307515_103688872 216
271 3300031456 Ga0307513_10003286 Ga0307513_100032867 216
272 3300035113 Ga0373936_0033324 Ga0373936_0033324_1173_1829 216
273 3300035692 Ga0373935_0237790 Ga0373935_0237790_493_1149 216
274 3300046460 Ga0495638_0000230 Ga0495638_0000230_55024_55686 216
275 3300046460 Ga0495638_0001674 Ga0495638_0001674_8250_8912 216
276 3300046460 Ga0495638_0004141 Ga0495638_0004141_4602_5264 216
277 3300046471 Ga0495650_0000207 Ga0495650_0000207_69504_70166 216
278 3300046506 Ga0495583_0000025 Ga0495583_0000025_236646_237308 216
279 3300046512 Ga0495610_0000140 Ga0495610_0000140_70505_71167 216
280 3300046513 Ga0495616_0170555 Ga0495616_0170555_86_748 216
281 3300046515 Ga0495620_0046280 Ga0495620_0046280_1123_1785 216
282 3300046519 Ga0495632_0050022 Ga0495632_0050022_103_765 216
283 3300046522 Ga0495643_0079887 Ga0495643_0079887_589_1251 216
284 3300046524 Ga0495648_0045349 Ga0495648_0045349_1987_2649 216
285 3300046530 Ga0495654_0000016 Ga0495654_0000016_236436_237098 216
286 3300046660 Ga0495625_0000043 Ga0495625_0000043_25996_26658 216
287 3300046660 Ga0495625_0002055 Ga0495625_0002055_18905_19567 216
288 3300046660 Ga0495625_0006044 Ga0495625_0006044_68_730 216
289 3300046660 Ga0495625_0008430 Ga0495625_0008430_127_789 216
290 3300046660 Ga0495625_0073276 Ga0495625_0073276_711_1373 216
291 3300047320 Ga0495672_0004568 Ga0495672_0004568_1305_1967 216
292 3300047469 Ga0495673_0003725 Ga0495673_0003725_6560_7222 216
293 3300047472 Ga0495686_0023957 Ga0495686_0023957_2393_3064 216
294 3300048910 Ga0496107_0009429 Ga0496107_0009429_3914_4576 216
295 3300048918 Ga0496115_0003294 Ga0496115_0003294_5649_6311 216
296 3300048924 Ga0496121_0008019 Ga0496121_0008019_9140_9802 216
297 3300048927 Ga0496124_0019539 Ga0496124_0019539_3469_4140 216
298 3300048927 Ga0496124_0261872 Ga0496124_0261872_198_869 216
299 3300048928 Ga0496125_0037050 Ga0496125_0037050_2143_2814 216
300 3300048929 Ga0496126_0011392 Ga0496126_0011392_1122_1793 216
301 3300048929 Ga0496126_0524634 Ga0496126_0524634_43_714 216
302 3300053134 Ga0500658_0003982 Ga0500658_0003982_2121_2783 216
303 3300053136 Ga0500559_0000054 Ga0500559_0000054_24680_25342 216
304 3300053136 Ga0500559_0002343 Ga0500559_0002343_2929_3591 216
305 3300053136 Ga0500559_0002849 Ga0500559_0002849_7665_8336 216
306 3300053156 Ga0500622_0010718 Ga0500622_0010718_1029_1691 216
307 3300053158 Ga0500627_0012068 Ga0500627_0012068_914_1576 216
308 3300003215 JGI25153J46596_10027103 JGI25153J46596_100271032 217
309 3300003215 JGI25153J46596_10067528 JGI25153J46596_100675281 217
310 3300003316 rootH1_10022538 rootH1_100225383 217
311 3300003775 Ga0055524_1018338 Ga0055524_10183383 217
312 3300003781 Ga0055536_1012522 Ga0055536_10125222 217
313 3300003791 Ga0055530_10002908 Ga0055530_100029084 217
314 3300003791 Ga0055530_10011679 Ga0055530_100116792 217
315 3300003794 Ga0055531_10000947 Ga0055531_1000094720 217
316 3300003794 Ga0055531_10004401 Ga0055531_1000440110 217
317 3300003794 Ga0055531_10006144 Ga0055531_100061446 217
318 3300004625 Ga0055543_1011693 Ga0055543_10116932 217
319 3300005262 Ga0065165_1001692 Ga0065165_10016921 217
320 3300005262 Ga0065165_1003158 Ga0065165_10031582 217
321 3300005262 Ga0065165_1023558 Ga0065165_10235582 217
322 3300005331 Ga0070670_100000004 Ga0070670_10000000465 217
323 3300005616 Ga0068852_100270822 Ga0068852_1002708222 217
324 3300006195 Ga0075366_10120337 Ga0075366_101203372 217
325 3300009174 Ga0105241_10164287 Ga0105241_101642871 217
326 3300009177 Ga0105248_11326063 Ga0105248_113260632 217
327 3300009551 Ga0105238_10061827 Ga0105238_100618274 217
328 3300021384 Ga0213876_10055955 Ga0213876_100559553 217
329 3300025250 Ga0209026_1000608 Ga0209026_100060812 217
330 3300025254 Ga0209148_1005975 Ga0209148_10059753 217
331 3300025292 Ga0209676_1000713 Ga0209676_100071343 217
332 3300025295 Ga0209564_1003434 Ga0209564_10034349 217
333 3300025297 Ga0209758_1002141 Ga0209758_100214111 217
334 3300025297 Ga0209758_1003752 Ga0209758_100375212 217
335 3300025298 Ga0209050_1000053 Ga0209050_1000053136 217
336 3300025298 Ga0209050_1015597 Ga0209050_10155972 217
337 3300025299 Ga0209256_1001520 Ga0209256_100152011 217
338 3300025299 Ga0209256_1006940 Ga0209256_10069405 217
339 3300025304 Ga0209257_1000282 Ga0209257_100028224 217
340 3300025304 Ga0209257_1000352 Ga0209257_100035273 217
341 3300025304 Ga0209257_1000419 Ga0209257_100041912 217
342 3300025304 Ga0209257_1001795 Ga0209257_100179512 217
343 3300027378 Ga0209981_1000565 Ga0209981_10005654 217
344 3300028794 Ga0307515_10041561 Ga0307515_100415615 217
345 3300033180 Ga0307510_10023326 Ga0307510_100233265 217
346 3300035171 Ga0373946_0035402 Ga0373946_0035402_1045_1707 217
347 3300035695 Ga0373927_0000111 Ga0373927_0000111_45159_45821 217
348 3300037068 Ga0373925_0000209 Ga0373925_0000209_18279_18941 217
349 3300037418 Ga0395900_0083605 Ga0395900_0083605_1671_2330 217
350 3300037466 Ga0395898_0062040 Ga0395898_0062040_1067_1726 217
351 3300038443 Ga0395901_0420125 Ga0395901_0420125_403_1065 217
352 3300039437 Ga0436365_0689453 Ga0436365_0689453_1376_2038 217
353 3300041512 Ga0451853_1121887 Ga0451853_1121887_62_736 217
354 3300044683 Ga0466965_0107585 Ga0466965_0107585_404_1063 217
355 3300044693 Ga0466961_0404382 Ga0466961_0404382_108_767 217
356 3300044765 Ga0466970_0324425 Ga0466970_0324425_117_776 217
357 3300046453 Ga0495627_000654 Ga0495627_000654_19846_20511 217
358 3300046457 Ga0495590_0022740 Ga0495590_0022740_396_1070 217
359 3300046460 Ga0495638_0000688 Ga0495638_0000688_15369_16043 217
360 3300046460 Ga0495638_0002962 Ga0495638_0002962_12754_13419 217
361 3300046460 Ga0495638_0027449 Ga0495638_0027449_1424_2089 217
362 3300046460 Ga0495638_0068775 Ga0495638_0068775_800_1474 217
363 3300046471 Ga0495650_0089868 Ga0495650_0089868_332_991 217
364 3300046501 Ga0495607_0072617 Ga0495607_0072617_575_1240 217
365 3300046512 Ga0495610_0002440 Ga0495610_0002440_3303_3977 217
366 3300046512 Ga0495610_0006540 Ga0495610_0006540_222_887 217
367 3300046513 Ga0495616_0000105 Ga0495616_0000105_59210_59875 217
368 3300046518 Ga0495631_0006312 Ga0495631_0006312_3258_3932 217
369 3300046518 Ga0495631_0250426 Ga0495631_0250426_29_691 217
370 3300046519 Ga0495632_0039476 Ga0495632_0039476_227_892 217
371 3300046520 Ga0495637_0066918 Ga0495637_0066918_354_1019 217
372 3300046520 Ga0495637_0185351 Ga0495637_0185351_91_756 217
373 3300046522 Ga0495643_0165907 Ga0495643_0165907_199_873 217
374 3300046525 Ga0495663_0048363 Ga0495663_0048363_31_696 217
375 3300046616 Ga0495668_0000040 Ga0495668_0000040_192459_193139 217
376 3300046616 Ga0495668_0001804 Ga0495668_0001804_11109_11783 217
377 3300046616 Ga0495668_0005894 Ga0495668_0005894_7079_7753 217
378 3300046616 Ga0495668_0033508 Ga0495668_0033508_1788_2453 217
379 3300046616 Ga0495668_0353207 Ga0495668_0353207_56_730 217
380 3300046660 Ga0495625_0032838 Ga0495625_0032838_113_787 217
381 3300046660 Ga0495625_0134806 Ga0495625_0134806_200_874 217
382 3300046810 Ga0495660_0003096 Ga0495660_0003096_2263_2928 217
383 3300047323 Ga0495683_0278887 Ga0495683_0278887_36_701 217
384 3300047469 Ga0495673_0000223 Ga0495673_0000223_16392_17057 217
385 3300047472 Ga0495686_0001955 Ga0495686_0001955_14124_14798 217
386 3300047472 Ga0495686_0009337 Ga0495686_0009337_3840_4493 217
387 3300047472 Ga0495686_0036068 Ga0495686_0036068_2411_3076 217
388 3300048915 Ga0496112_0836959 Ga0496112_0836959_97_756 217
389 3300049459 Ga0495678_001042 Ga0495678_001042_1350_2024 217
390 3300049573 Ga0501037_0090703 Ga0501037_0090703_170_826 217
391 3300049581 Ga0501047_0012196 Ga0501047_0012196_77_739 217
392 3300049581 Ga0501047_0065079 Ga0501047_0065079_985_1641 217
393 3300049581 Ga0501047_0103456 Ga0501047_0103456_1830_2489 217
394 3300049581 Ga0501047_0752120 Ga0501047_0752120_60_722 217
395 3300049582 Ga0501048_0102758 Ga0501048_0102758_932_1591 217
396 3300049582 Ga0501048_0429487 Ga0501048_0429487_28_690 217
397 3300049586 Ga0501070_0517189 Ga0501070_0517189_59_715 217
398 3300049671 Ga0501238_007718 Ga0501238_007718_386_1054 217
399 3300049822 Ga0501035_0026275 Ga0501035_0026275_1770_2426 217
400 3300049823 Ga0501044_0139591 Ga0501044_0139591_428_1084 217
401 3300050489 nmdc:mga03683_134016_c1 nmdc:mga03683_134016_c1_361_1020 217
402 3300050493 nmdc:mga0k408_43154_c1 nmdc:mga0k408_43154_c1_1198_1872 217
403 3300050493 nmdc:mga0k408_54694_c1 nmdc:mga0k408_54694_c1_916_1581 217
404 3300053080 Ga0500635_0001420 Ga0500635_0001420_4059_4721 217
405 3300053086 Ga0500578_0000041 Ga0500578_0000041_29540_30214 217
406 3300053091 Ga0500647_0023029 Ga0500647_0023029_614_1276 217
407 3300053102 Ga0500554_026611 Ga0500554_026611_891_1556 217
408 3300053103 Ga0500555_000832 Ga0500555_000832_3564_4226 217
409 3300053103 Ga0500555_012018 Ga0500555_012018_874_1539 217
410 3300053104 Ga0500556_0006739 Ga0500556_0006739_1864_2526 217
411 3300053104 Ga0500556_0147080 Ga0500556_0147080_105_779 217
412 3300053108 Ga0500562_000786 Ga0500562_000786_5702_6376 217
413 3300053108 Ga0500562_013432 Ga0500562_013432_1403_2065 217
414 3300053118 Ga0500594_0000437 Ga0500594_0000437_2579_3253 217
415 3300053121 Ga0500607_058726 Ga0500607_058726_104_766 217
416 3300053139 Ga0500568_0077826 Ga0500568_0077826_455_1108 217
417 3300053142 Ga0500577_0001345 Ga0500577_0001345_311_976 217
418 3300053156 Ga0500622_0014800 Ga0500622_0014800_3085_3759 217
419 3300053156 Ga0500622_0015451 Ga0500622_0015451_1358_2032 217
420 3300053162 Ga0500638_063624 Ga0500638_063624_966_1628 217
421 3300053178 Ga0500637_0068106 Ga0500637_0068106_757_1419 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

17

214

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8987 13 117
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8534 13 117
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.8178 13 200
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.7919 13 200
7cr9-assembly1.cif.gz_B crystal structure of the n-terminal fragment (residue 1-206) of lona protease from meiothermus taiwanensis 0.7655 13 206
ID Description Score Start End Superfamily
af_I1K7N5_54_171_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9212 13 117 2.30.130.40
af_B4FM67_80_193_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.912 13 116 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9084 13 117 2.30.130.40
af_A0A0G2K313_628_728_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9053 14 117 2.30.130.40
af_Q5JKW4_92_204_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8926 13 116 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A382ZK07-F1-model_v4 Lon N-terminal domain-containing protein 0.9777 13 115
AF-A0A383A2J6-F1-model_v4 Lon N-terminal domain-containing protein 0.976 6 127
AF-A0A4Y9RS31-F1-model_v4 Peptidase S16 0.9726 4 206
AF-A0A2S6T611-F1-model_v4 Lon protease 2 (EC 3.4.21.53) 0.9714 10 103 GO:0004252
GO:0006508
AF-A0A2G1YZM3-F1-model_v4 Peptidase S16 0.9691 7 125

Feature Viewer

pLDDT pTM Quality
88.24 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map