F440159

General Info

Members Datasets Scaffolds Average Seq Length
421 266 840 293

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054795415|8054799798
Length 313
Sequence TTLDKTLLRTSKKSLTGIKKWPYIFSLPFVVTYLAFHFYPVVYSFYLSLNDWNGVGPKTFVGFKNYVNLLTNDPLFYKSLYNTFLIMLMSLPVTLFLGMLLAYIIFNLTKGRHVFQTVNFLPYITTPVAIGFIFSFMFDWKVGLVNQLIVKLGWMEEGVYWLQEPWAARCIIAFMVIWKFLGYFMAIYLSGMTAIPHDLYEAARVDGSSGFHLFTHITLPLLKNITIFLVVTSIIGGWQLFDEPKLLYDGAGSSGVGGPENAALTVIWKFVDDSFISNNRFGYSSAIAYTLFVIIIIFSIASYKLSSGREEKL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
160 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
161 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
162 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
163 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
166 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
188 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
189 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
190 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
191 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
215 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
216 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
217 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
218 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
219 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
220 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
221 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
222 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
223 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
224 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
225 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
226 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
231 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
232 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
233 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
234 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
235 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
244 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
257 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
258 2643221585 Pelomonas sp. Root662 Isolate Unclassified
259 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
260 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
261 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
262 2643221656 Pelomonas sp. Root405 Isolate Unclassified
263 2738541337 Pelomonas sp. BT06 Isolate Unclassified
264 2818991459 Paenibacillus sp. 597 Isolate Unclassified
265 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
266 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.26
Nodule 0.71
Rhizoplane 2.14
Rhizosphere 78.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10017786 3300003316 Bacteria 13231
2 rootH2_10076355 3300003320 Bacteria 3722
3 rootL2_10033751 3300003322 Bacteria 2988
4 rootL2_10049292 3300003322 Bacteria 3860
5 rootL2_10050587 3300003322 Bacteria 17839
6 rootH1_10024525 3300003323 Bacteria 5149
7 Ga0055525_1000161 3300003759 Bacteria 87478
8 Ga0055524_1000025 3300003775 Bacteria 216427
9 Ga0055531_10000117 3300003794 Bacteria 88276
10 Ga0055531_10000179 3300003794 Bacteria 72059
11 Ga0065704_10070355 3300005289 Bacteria 30536
12 Ga0065707_10268358 3300005295 Bacteria 1072
13 Ga0070690_100000481 3300005330 Bacteria 20092
14 Ga0068869_100007298 3300005334 Bacteria 7046
15 Ga0070666_10000270 3300005335 Bacteria 34703
16 Ga0070666_10009663 3300005335 Bacteria 6022
17 Ga0070666_10179824 3300005335 Bacteria 1483
18 Ga0070666_10263801 3300005335 Bacteria 1221
19 Ga0070680_100384682 3300005336 Bacteria 1195
20 Ga0070682_100018227 3300005337 Bacteria 4100
21 Ga0068868_100052090 3300005338 Bacteria 3222
22 Ga0070689_100027498 3300005340 Bacteria 4288
23 Ga0070691_10021144 3300005341 Bacteria 3009
24 Ga0070692_10008235 3300005345 Bacteria 4641
25 Ga0070671_100098111 3300005355 Bacteria 2457
26 Ga0070674_100166230 3300005356 Bacteria 1678
27 Ga0070673_100009828 3300005364 Bacteria 6444
28 Ga0070667_100000044 3300005367 Bacteria 166321
29 Ga0070667_100004287 3300005367 Bacteria 12047
30 Ga0070667_100063695 3300005367 Bacteria 3125
31 Ga0070667_100330624 3300005367 Bacteria 1377
32 Ga0070711_100000029 3300005439 Bacteria 101028
33 Ga0070705_100016314 3300005440 Bacteria 3858
34 Ga0070700_100000628 3300005441 Bacteria 17527
35 Ga0070694_100015451 3300005444 Bacteria 4797
36 Ga0070694_100092669 3300005444 Bacteria 2123
37 Ga0070663_100000528 3300005455 Bacteria 20192
38 Ga0070663_100018893 3300005455 Bacteria 4530
39 Ga0070663_100117553 3300005455 Bacteria 2005
40 Ga0070678_100016018 3300005456 Bacteria 4781
41 Ga0070681_10115981 3300005458 Bacteria 2616
42 Ga0068867_100001785 3300005459 Bacteria 14965
43 Ga0070679_100276339 3300005530 Bacteria 1633
44 Ga0070697_100390297 3300005536 Bacteria 1207
45 Ga0068853_100000701 3300005539 Bacteria 23195
46 Ga0068853_100001138 3300005539 Bacteria 18828
47 Ga0068853_100003059 3300005539 Bacteria 12772
48 Ga0068853_100038453 3300005539 Bacteria 4076
49 Ga0070672_100020144 3300005543 Bacteria 4860
50 Ga0070672_100071403 3300005543 Bacteria 2762
51 Ga0070672_100349820 3300005543 Bacteria 1260
52 Ga0070686_100006987 3300005544 Bacteria 6292
53 Ga0070695_100019170 3300005545 Bacteria 4162
54 Ga0070695_100144807 3300005545 Bacteria 1652
55 Ga0070696_100383514 3300005546 Bacteria 1096
56 Ga0070693_100008627 3300005547 Bacteria 5038
57 Ga0070693_100080804 3300005547 Bacteria 1937
58 Ga0070693_100318513 3300005547 Bacteria 1054
59 Ga0070665_100000095 3300005548 Bacteria 170459
60 Ga0070665_100024630 3300005548 Bacteria 6064
61 Ga0070665_100052032 3300005548 Bacteria 4108
62 Ga0070665_100085724 3300005548 Bacteria 3155
63 Ga0070665_100126384 3300005548 Bacteria 2559
64 Ga0070665_100472467 3300005548 Bacteria 1264
65 Ga0068855_100186319 3300005563 Bacteria 2344
66 Ga0068857_100021728 3300005577 Bacteria 5647
67 Ga0068857_100029726 3300005577 Bacteria 4822
68 Ga0068856_100083326 3300005614 Bacteria 3175
69 Ga0068856_100213257 3300005614 Bacteria 1946
70 Ga0068852_100367387 3300005616 Bacteria 1409
71 Ga0068859_100000295 3300005617 Bacteria 49698
72 Ga0068859_100259501 3300005617 Bacteria 1829
73 Ga0068866_10002792 3300005718 Bacteria 7203
74 Ga0068861_100059166 3300005719 Bacteria 2932
75 Ga0068861_100248802 3300005719 Bacteria 1516
76 Ga0068870_10018941 3300005840 Bacteria 3333
77 Ga0068870_10032336 3300005840 Bacteria 2659
78 Ga0068863_100098306 3300005841 Bacteria 2779
79 Ga0068863_100335295 3300005841 Bacteria 1471
80 Ga0068858_100010116 3300005842 Bacteria 8956
81 Ga0068858_100095644 3300005842 Bacteria 2768
82 Ga0068860_100045875 3300005843 Bacteria 4168
83 Ga0068862_100000507 3300005844 Bacteria 41412
84 Ga0081540_1011855 3300005983 Bacteria 5791
85 Ga0075367_10065533 3300006178 Bacteria 2175
86 Ga0075366_10001546 3300006195 Bacteria 11508
87 Ga0075366_10194274 3300006195 Bacteria 1233
88 Ga0075370_10000170 3300006353 Bacteria 22468
89 Ga0075370_10012946 3300006353 Bacteria 4422
90 Ga0075370_10017523 3300006353 Bacteria 3871
91 Ga0068871_100023115 3300006358 Bacteria 4802
92 Ga0075428_100007485 3300006844 Bacteria 12101
93 Ga0075428_100045978 3300006844 Bacteria 4796
94 Ga0075434_100249338 3300006871 Bacteria 1795
95 Ga0068865_100074655 3300006881 Bacteria 2415
96 Ga0097620_100000295 3300006931 Bacteria 49698
97 Ga0097620_100259521 3300006931 Bacteria 1829
98 Ga0099826_10000005 3300006948 Bacteria 465206
99 Ga0105240_10121688 3300009093 Bacteria 3142
100 Ga0111539_10017012 3300009094 Bacteria 8999
101 Ga0105245_10006831 3300009098 Bacteria 10010
102 Ga0105243_10094855 3300009148 Bacteria 2465
103 Ga0105241_10017636 3300009174 Bacteria 5249
104 Ga0105241_10455079 3300009174 Bacteria 1133
105 Ga0105242_10021236 3300009176 Bacteria 5095
106 Ga0105248_10000412 3300009177 Bacteria 49169
107 Ga0105248_10005709 3300009177 Bacteria 13664
108 Ga0105237_10034265 3300009545 Bacteria 5142
109 Ga0105237_10337039 3300009545 Bacteria 1512
110 Ga0105249_10000511 3300009553 Bacteria 35866
111 Ga0105028_103271 3300009993 Bacteria 1697
112 Ga0105239_10013302 3300010375 Bacteria 9144
113 Ga0105239_10086152 3300010375 Bacteria 3462
114 Ga0105239_10117983 3300010375 Bacteria 2945
115 Ga0105239_10462428 3300010375 Bacteria 1440
116 Ga0157370_10006412 3300013104 Bacteria 12977
117 Ga0157378_10001412 3300013297 Bacteria 21592
118 Ga0157378_10056153 3300013297 Bacteria 3508
119 Ga0157378_10079910 3300013297 Bacteria 2953
120 Ga0157378_10101323 3300013297 Bacteria 2630
121 Ga0157378_10302711 3300013297 Bacteria 1548
122 Ga0163162_10294601 3300013306 Bacteria 1754
123 Ga0157372_10111109 3300013307 Bacteria 3140
124 Ga0157372_10446697 3300013307 Bacteria 1507
125 Ga0157372_10477037 3300013307 Bacteria 1454
126 Ga0157375_10449380 3300013308 Bacteria 1454
127 Ga0163161_10004013 3300017792 Bacteria 10300
128 Ga0213872_10000198 3300021361 Bacteria 53480
129 Ga0213872_10001170 3300021361 Bacteria 17827
130 Ga0209563_100088 3300025230 Bacteria 175375
131 Ga0209565_1010026 3300025263 Bacteria 2368
132 Ga0209050_1003377 3300025298 Bacteria 11873
133 Ga0209050_1008765 3300025298 Bacteria 5320
134 Ga0209256_1000040 3300025299 Bacteria 366839
135 Ga0209051_1006196 3300025303 Bacteria 6781
136 Ga0209051_1018802 3300025303 Bacteria 3042
137 Ga0209051_1026468 3300025303 Bacteria 2337
138 Ga0209257_1000047 3300025304 Bacteria 460507
139 Ga0209257_1027568 3300025304 Bacteria 1889
140 Ga0207642_10021160 3300025899 Bacteria 2556
141 Ga0207680_10000262 3300025903 Bacteria 25280
142 Ga0207680_10005628 3300025903 Bacteria 5997
143 Ga0207680_10157284 3300025903 Bacteria 1521
144 Ga0207699_10010710 3300025906 Bacteria 4611
145 Ga0207643_10027686 3300025908 Bacteria 3144
146 Ga0207643_10049992 3300025908 Bacteria 2370
147 Ga0207654_10032116 3300025911 Bacteria 2897
148 Ga0207695_10043588 3300025913 Bacteria 4781
149 Ga0207671_10001458 3300025914 Bacteria 27326
150 Ga0207671_10162336 3300025914 Bacteria 1731
151 Ga0207663_10000050 3300025916 Bacteria 63105
152 Ga0207650_10212966 3300025925 Bacteria 1552
153 Ga0207687_10046983 3300025927 Bacteria 2991
154 Ga0207700_10000303 3300025928 Bacteria 29240
155 Ga0207644_10004733 3300025931 Bacteria 8843
156 Ga0207709_10029109 3300025935 Bacteria 3200
157 Ga0207670_10003667 3300025936 Bacteria 8146
158 Ga0207669_10212965 3300025937 Bacteria 1412
159 Ga0207704_10005543 3300025938 Bacteria 5817
160 Ga0207665_10017189 3300025939 Bacteria 4751
161 Ga0207691_10015297 3300025940 Bacteria 7299
162 Ga0207691_10110415 3300025940 Bacteria 2446
163 Ga0207711_10000596 3300025941 Bacteria 36537
164 Ga0207711_10011756 3300025941 Bacteria 7271
165 Ga0207689_10006569 3300025942 Bacteria 10254
166 Ga0207651_10011121 3300025960 Bacteria 5022
167 Ga0207712_10014350 3300025961 Bacteria 5095
168 Ga0207668_10036852 3300025972 Bacteria 3268
169 Ga0207668_10093035 3300025972 Bacteria 2221
170 Ga0207658_10000043 3300025986 Bacteria 131765
171 Ga0207658_10003006 3300025986 Bacteria 12064
172 Ga0207677_10011017 3300026023 Bacteria 5136
173 Ga0207677_10357756 3300026023 Bacteria 1225
174 Ga0207703_10137167 3300026035 Bacteria 2119
175 Ga0207639_10005566 3300026041 Bacteria 8519
176 Ga0207639_10086356 3300026041 Bacteria 2498
177 Ga0207639_10187286 3300026041 Bacteria 1765
178 Ga0207678_10000242 3300026067 Bacteria 49297
179 Ga0207678_10031782 3300026067 Bacteria 4602
180 Ga0207678_10139765 3300026067 Bacteria 2067
181 Ga0207708_10000948 3300026075 Bacteria 21726
182 Ga0207702_10068832 3300026078 Bacteria 3041
183 Ga0207702_10184846 3300026078 Bacteria 1921
184 Ga0207641_10023397 3300026088 Bacteria 5091
185 Ga0207648_10003813 3300026089 Bacteria 15762
186 Ga0207648_10004116 3300026089 Bacteria 15050
187 Ga0207648_10061219 3300026089 Bacteria 3282
188 Ga0207648_10207666 3300026089 Bacteria 1738
189 Ga0207674_10007980 3300026116 Bacteria 12284
190 Ga0207674_10010503 3300026116 Bacteria 10480
191 Ga0207674_10022966 3300026116 Bacteria 6690
192 Ga0207675_100005712 3300026118 Bacteria 11906
193 Ga0207675_100317418 3300026118 Bacteria 1521
194 Ga0207698_10002813 3300026142 Bacteria 10406
195 Ga0207698_10165366 3300026142 Bacteria 1941
196 Ga0207698_10242709 3300026142 Bacteria 1643
197 Ga0209967_1001326 3300027364 Bacteria 3170
198 Ga0210000_1001945 3300027462 Bacteria 2917
199 Ga0209995_1003612 3300027471 Bacteria 2464
200 Ga0209282_1000003 3300027666 Bacteria 856377
201 Ga0209974_10014351 3300027876 Bacteria 2636
202 Ga0209974_10034465 3300027876 Bacteria 1681
203 Ga0207428_10208996 3300027907 Bacteria 1467
204 Ga0268266_10000001 3300028379 Bacteria 4040580
205 Ga0268266_10011510 3300028379 Bacteria 7682
206 Ga0268266_10358044 3300028379 Bacteria 1372
207 Ga0268265_10000140 3300028380 Bacteria 91626
208 Ga0268265_10027787 3300028380 Bacteria 4042
209 Ga0268265_10301102 3300028380 Bacteria 1444
210 Ga0307515_10007880 3300028794 Bacteria 20929
211 Ga0307515_10017006 3300028794 Bacteria 13287
212 Ga0307515_10032292 3300028794 Bacteria 8680
213 Ga0307515_10077937 3300028794 Bacteria 4368
214 Ga0307515_10166019 3300028794 Bacteria 2225
215 Ga0316181_1171476 3300030744 Bacteria 3676
216 Ga0265331_10001077 3300031250 Bacteria 21159
217 Ga0265327_10000078 3300031251 Bacteria 207398
218 Ga0307513_10303702 3300031456 Bacteria 1361
219 Ga0307509_10042226 3300031507 Bacteria 4944
220 Ga0307408_100000029 3300031548 Bacteria 227806
221 Ga0307408_100000109 3300031548 Bacteria 91284
222 Ga0307508_10000144 3300031616 Bacteria 84437
223 Ga0307416_100257755 3300032002 Bacteria 1702
224 Ga0307414_10018554 3300032004 Bacteria 4288
225 Ga0307411_10000237 3300032005 Bacteria 18016
226 Ga0307411_10010230 3300032005 Bacteria 4987
227 Ga0307507_10125034 3300033179 Bacteria 2039
228 Ga0307510_10000426 3300033180 Bacteria 40466
229 Ga0307510_10290018 3300033180 Bacteria 1102
230 Ga0373948_0026341 3300034817 Bacteria 1145
231 Ga0373939_0000040 3300035114 Bacteria 45617
232 Ga0373939_0000433 3300035114 Bacteria 10526
233 Ga0373960_0001069 3300035121 Bacteria 5906
234 Ga0373960_0001147 3300035121 Bacteria 5748
235 Ga0373924_0016783 3300035410 Bacteria 2800
236 Ga0373931_0030556 3300035691 Bacteria 2774
237 Ga0373933_0112198 3300035724 Bacteria 1702
238 Ga0373937_0220766 3300036401 Bacteria 1784
239 Ga0373937_0459387 3300036401 Bacteria 1209
240 Ga0395899_0203325 3300037312 Bacteria 1380
241 Ga0395900_0026802 3300037418 Bacteria 5898
242 Ga0395898_0015433 3300037466 Bacteria 7833
243 Ga0395905_0003219 3300037471 Bacteria 17561
244 Ga0395905_0015109 3300037471 Bacteria 7349
245 Ga0395901_0008138 3300038443 Bacteria 10591
246 Ga0436361_0099049 3300039447 Bacteria 4369
247 Ga0436361_0628908 3300039447 Bacteria 17498
248 Ga0436361_0648483 3300039447 Bacteria 7313
249 Ga0436361_0692684 3300039447 Bacteria 133303
250 Ga0439461_0005919 3300041410 Bacteria 2110
251 Ga0451793_0494313 3300041452 Bacteria 2792
252 Ga0451793_1422541 3300041452 Bacteria 1056
253 Ga0451807_0381198 3300041486 Bacteria 1034
254 Ga0451807_2037227 3300041486 Bacteria 1359
255 Ga0451833_0999607 3300041491 Bacteria 1373
256 Ga0450917_000213 3300042120 Bacteria 4185
257 Ga0450917_000319 3300042120 Bacteria 3567
258 Ga0450888_001106 3300042126 Bacteria 2560
259 Ga0450888_003111 3300042126 Bacteria 1666
260 Ga0450890_000779 3300042127 Bacteria 4591
261 Ga0450890_000945 3300042127 Bacteria 4212
262 Ga0450891_000196 3300042129 Bacteria 5958
263 Ga0450889_003712 3300042144 Bacteria 1506
264 Ga0439458_0009132 3300042157 Bacteria 2209
265 Ga0439459_0017450 3300042438 Bacteria 1338
266 Ga0450916_005594 3300042530 Bacteria 1457
267 Ga0466972_0010176 3300044658 Bacteria 4725
268 Ga0453684_0008725 3300044712 Bacteria 18022
269 Ga0466970_0000751 3300044765 Bacteria 15737
270 Ga0466959_0004397 3300045049 Bacteria 9432
271 Ga0451576_0010161 3300045051 Bacteria 10828
272 Ga0495592_0252501 3300046454 Bacteria 1165
273 Ga0495610_0009725 3300046512 Bacteria 6047
274 Ga0495643_0098239 3300046522 Bacteria 1503
275 Ga0495597_0002867 3300046542 Bacteria 10531
276 Ga0495656_0072927 3300046615 Bacteria 1530
277 Ga0495687_000850 3300047443 Bacteria 32575
278 Ga0495686_0020699 3300047472 Bacteria 4384
279 Ga0495686_0021921 3300047472 Bacteria 4232
280 Ga0496102_0064873 3300048905 Bacteria 3346
281 Ga0496102_0145449 3300048905 Bacteria 2225
282 Ga0496103_0019389 3300048906 Bacteria 4084
283 Ga0496103_0145309 3300048906 Bacteria 1518
284 Ga0496109_0171108 3300048912 Bacteria 2038
285 Ga0496117_0058046 3300048920 Bacteria 2683
286 Ga0496118_0000772 3300048921 Bacteria 51379
287 Ga0496118_0002390 3300048921 Bacteria 25368
288 Ga0496118_0047977 3300048921 Bacteria 3305
289 Ga0496122_0000401 3300048925 Bacteria 92031
290 Ga0496123_0000230 3300048926 Bacteria 113513
291 Ga0496125_0214972 3300048928 Bacteria 1244
292 Ga0501291_002368 3300049514 Bacteria 2252
293 Ga0501294_001826 3300049517 Bacteria 2080
294 Ga0501296_005141 3300049519 Bacteria 1449
295 Ga0501297_004815 3300049520 Bacteria 1394
296 Ga0501297_006100 3300049520 Bacteria 1279
297 Ga0501300_005080 3300049523 Bacteria 1945
298 Ga0501031_0004116 3300049568 Bacteria 9395
299 Ga0501031_0094245 3300049568 Bacteria 1953
300 Ga0501032_0003847 3300049569 Bacteria 11400
301 Ga0501032_0008004 3300049569 Bacteria 7704
302 Ga0501033_0000784 3300049570 Bacteria 29162
303 Ga0501033_0001217 3300049570 Bacteria 23116
304 Ga0501033_0024176 3300049570 Bacteria 4583
305 Ga0501034_0002409 3300049571 Bacteria 22644
306 Ga0501034_0020315 3300049571 Bacteria 6781
307 Ga0501036_0010482 3300049572 Bacteria 7656
308 Ga0501036_0058298 3300049572 Bacteria 3271
309 Ga0501037_0000913 3300049573 Bacteria 22000
310 Ga0501038_0000102 3300049574 Bacteria 72409
311 Ga0501039_0047580 3300049575 Bacteria 3315
312 Ga0501039_0127121 3300049575 Bacteria 1999
313 Ga0501040_0196506 3300049576 Bacteria 1432
314 Ga0501043_0012423 3300049579 Bacteria 6660
315 Ga0501043_0137685 3300049579 Bacteria 1912
316 Ga0501046_0001819 3300049580 Bacteria 20318
317 Ga0501046_0008994 3300049580 Bacteria 8667
318 Ga0501046_0057798 3300049580 Bacteria 3042
319 Ga0501047_0010290 3300049581 Bacteria 8846
320 Ga0501047_0277676 3300049581 Bacteria 1520
321 Ga0501067_0023108 3300049583 Bacteria 3444
322 Ga0501068_0100049 3300049584 Bacteria 1796
323 Ga0501069_0007003 3300049585 Bacteria 5901
324 Ga0501070_0163731 3300049586 Bacteria 1833
325 Ga0501070_0278692 3300049586 Bacteria 1364
326 Ga0501071_0314439 3300049587 Bacteria 1188
327 Ga0501073_0001706 3300049589 Bacteria 16294
328 Ga0501073_0010825 3300049589 Bacteria 6679
329 Ga0501073_0271393 3300049589 Bacteria 1170
330 Ga0501074_0029370 3300049590 Bacteria 3982
331 Ga0501074_0108408 3300049590 Bacteria 1987
332 Ga0501074_0110819 3300049590 Bacteria 1964
333 Ga0501075_0077285 3300049591 Bacteria 2519
334 Ga0501076_0207294 3300049592 Bacteria 1601
335 Ga0501076_0550636 3300049592 Bacteria 951
336 Ga0501077_0001845 3300049593 Bacteria 12811
337 Ga0501201_004122 3300049651 Bacteria 1342
338 Ga0501206_003613 3300049653 Bacteria 1966
339 Ga0501206_006633 3300049653 Bacteria 1506
340 Ga0501211_000640 3300049658 Bacteria 3518
341 Ga0501217_007708 3300049661 Bacteria 2313
342 Ga0501222_000231 3300049662 Bacteria 9636
343 Ga0501223_009685 3300049663 Bacteria 1947
344 Ga0501227_008346 3300049665 Bacteria 2222
345 Ga0501227_012097 3300049665 Bacteria 1887
346 Ga0501235_001787 3300049669 Bacteria 4610
347 Ga0501235_059487 3300049669 Bacteria 893
348 Ga0501236_010819 3300049670 Bacteria 1201
349 Ga0501255_002022 3300049684 Bacteria 1730
350 Ga0501255_002632 3300049684 Bacteria 1594
351 Ga0501258_000433 3300049687 Bacteria 2799
352 Ga0501221_000045 3300049704 Bacteria 12869
353 Ga0501221_004224 3300049704 Bacteria 2380
354 Ga0501229_000309 3300049706 Bacteria 5512
355 Ga0501079_0007815 3300049741 Bacteria 8097
356 Ga0501079_0295278 3300049741 Bacteria 1267
357 Ga0501080_0043207 3300049742 Bacteria 4196
358 Ga0501080_0080979 3300049742 Bacteria 3017
359 Ga0501083_0051107 3300049744 Bacteria 2780
360 Ga0501083_0135115 3300049744 Bacteria 1616
361 Ga0501232_000044 3300049757 Bacteria 6087
362 Ga0501262_002860 3300049759 Bacteria 1959
363 Ga0501265_000974 3300049762 Bacteria 3222
364 Ga0501265_004113 3300049762 Bacteria 1655
365 Ga0501266_029588 3300049763 Bacteria 777
366 Ga0501267_000285 3300049764 Bacteria 3693
367 Ga0501267_001276 3300049764 Bacteria 2132
368 Ga0501269_000079 3300049766 Bacteria 30112
369 Ga0501269_002346 3300049766 Bacteria 2345
370 Ga0501035_0002549 3300049822 Bacteria 17819
371 Ga0501035_0024959 3300049822 Bacteria 5481
372 Ga0501035_0082679 3300049822 Bacteria 2833
373 Ga0501035_0378583 3300049822 Bacteria 1181
374 Ga0501044_0001381 3300049823 Bacteria 28459
375 Ga0501044_0005275 3300049823 Bacteria 14373
376 Ga0501044_0008954 3300049823 Bacteria 10941
377 Ga0501045_0011208 3300049824 Bacteria 6288
378 nmdc:mga0k408_189076_c1 3300050493 Bacteria 1228
379 nmdc:mga06z11_23661_c1 3300050494 Bacteria 2889
380 nmdc:mga07m45_1733_c1 3300050496 Bacteria 10044
381 nmdc:mga07m45_306_c1 3300050496 Bacteria 19764
382 nmdc:mga07m45_54016_c1 3300050496 Bacteria 2271
383 nmdc:mga08y16_291238_c1 3300050511 Bacteria 1683
384 nmdc:mga08y16_377819_c1 3300050511 Bacteria 1453
385 Ga0500610_0000813 3300053079 Bacteria 9920
386 Ga0500646_0022671 3300053090 Bacteria 1680
387 Ga0500651_0061293 3300053093 Bacteria 2350
388 Ga0500651_0083914 3300053093 Bacteria 1970
389 Ga0500597_000185 3300053120 Bacteria 12764
390 Ga0500607_127322 3300053121 Bacteria 1221
391 Ga0500652_041841 3300053131 Bacteria 1846
392 Ga0500568_0000927 3300053139 Bacteria 20211
393 Ga0500568_0003392 3300053139 Bacteria 8903
394 Ga0500590_027191 3300053148 Bacteria 2966
395 Ga0500604_0000029 3300053151 Bacteria 58564
396 Ga0500616_0000702 3300053153 Bacteria 38878
397 Ga0500587_003211 3300053739 Bacteria 2299
398 Ga0501084_0005593 3300054114 Bacteria 10318
399 Ga0501084_0092106 3300054114 Bacteria 2545
400 Ga0501084_0140823 3300054114 Bacteria 2031
401 Ga0501082_0001112 3300060353 Bacteria 23764
402 Ga0501082_0003735 3300060353 Bacteria 13302
403 Ga0501082_0590512 3300060353 Bacteria 972
404 8054799798 8054795415 Bacteria 9785225
405 2643743590 2643221544 Bacteria 5886209
406 2643743732 2643221544 Bacteria 5886209
407 2643936517 2643221585 Bacteria 5812563
408 2643936654 2643221585 Bacteria 5812563
409 2644222356 2643221639 Bacteria 6649903
410 2644222541 2643221639 Bacteria 6649903
411 2644256370 2643221646 Bacteria 6433402
412 2644256619 2643221646 Bacteria 6433402
413 2644305810 2643221654 Bacteria 5273570
414 2644317873 2643221656 Bacteria 5809961
415 2644318010 2643221656 Bacteria 5809961
416 2739058118 2738541337 Bacteria 6183410
417 2739058383 2738541337 Bacteria 6183410
418 2819673777 2818991459 Bacteria 8736032
419 2842783782 2842780639 Bacteria 4337790
420 2904426354 2904424332 Bacteria 7633521
421 rootH1_10017786
422 rootH2_10076355
423 rootL2_10033751
424 rootL2_10049292
425 rootL2_10050587
426 rootH1_10024525
427 Ga0055525_1000161
428 Ga0055524_1000025
429 Ga0055531_10000117
430 Ga0055531_10000179
431 Ga0065704_10070355
432 Ga0065707_10268358
433 Ga0070690_100000481
434 Ga0068869_100007298
435 Ga0070666_10000270
436 Ga0070666_10009663
437 Ga0070666_10179824
438 Ga0070666_10263801
439 Ga0070680_100384682
440 Ga0070682_100018227
441 Ga0068868_100052090
442 Ga0070689_100027498
443 Ga0070691_10021144
444 Ga0070692_10008235
445 Ga0070671_100098111
446 Ga0070674_100166230
447 Ga0070673_100009828
448 Ga0070667_100000044
449 Ga0070667_100004287
450 Ga0070667_100063695
451 Ga0070667_100330624
452 Ga0070711_100000029
453 Ga0070705_100016314
454 Ga0070700_100000628
455 Ga0070694_100015451
456 Ga0070694_100092669
457 Ga0070663_100000528
458 Ga0070663_100018893
459 Ga0070663_100117553
460 Ga0070678_100016018
461 Ga0070681_10115981
462 Ga0068867_100001785
463 Ga0070679_100276339
464 Ga0070697_100390297
465 Ga0068853_100000701
466 Ga0068853_100001138
467 Ga0068853_100003059
468 Ga0068853_100038453
469 Ga0070672_100020144
470 Ga0070672_100071403
471 Ga0070672_100349820
472 Ga0070686_100006987
473 Ga0070695_100019170
474 Ga0070695_100144807
475 Ga0070696_100383514
476 Ga0070693_100008627
477 Ga0070693_100080804
478 Ga0070693_100318513
479 Ga0070665_100000095
480 Ga0070665_100024630
481 Ga0070665_100052032
482 Ga0070665_100085724
483 Ga0070665_100126384
484 Ga0070665_100472467
485 Ga0068855_100186319
486 Ga0068857_100021728
487 Ga0068857_100029726
488 Ga0068856_100083326
489 Ga0068856_100213257
490 Ga0068852_100367387
491 Ga0068859_100000295
492 Ga0068859_100259501
493 Ga0068866_10002792
494 Ga0068861_100059166
495 Ga0068861_100248802
496 Ga0068870_10018941
497 Ga0068870_10032336
498 Ga0068863_100098306
499 Ga0068863_100335295
500 Ga0068858_100010116
501 Ga0068858_100095644
502 Ga0068860_100045875
503 Ga0068862_100000507
504 Ga0081540_1011855
505 Ga0075367_10065533
506 Ga0075366_10001546
507 Ga0075366_10194274
508 Ga0075370_10000170
509 Ga0075370_10012946
510 Ga0075370_10017523
511 Ga0068871_100023115
512 Ga0075428_100007485
513 Ga0075428_100045978
514 Ga0075434_100249338
515 Ga0068865_100074655
516 Ga0097620_100000295
517 Ga0097620_100259521
518 Ga0099826_10000005
519 Ga0105240_10121688
520 Ga0111539_10017012
521 Ga0105245_10006831
522 Ga0105243_10094855
523 Ga0105241_10017636
524 Ga0105241_10455079
525 Ga0105242_10021236
526 Ga0105248_10000412
527 Ga0105248_10005709
528 Ga0105237_10034265
529 Ga0105237_10337039
530 Ga0105249_10000511
531 Ga0105028_103271
532 Ga0105239_10013302
533 Ga0105239_10086152
534 Ga0105239_10117983
535 Ga0105239_10462428
536 Ga0157370_10006412
537 Ga0157378_10001412
538 Ga0157378_10056153
539 Ga0157378_10079910
540 Ga0157378_10101323
541 Ga0157378_10302711
542 Ga0163162_10294601
543 Ga0157372_10111109
544 Ga0157372_10446697
545 Ga0157372_10477037
546 Ga0157375_10449380
547 Ga0163161_10004013
548 Ga0213872_10000198
549 Ga0213872_10001170
550 Ga0209563_100088
551 Ga0209565_1010026
552 Ga0209050_1003377
553 Ga0209050_1008765
554 Ga0209256_1000040
555 Ga0209051_1006196
556 Ga0209051_1018802
557 Ga0209051_1026468
558 Ga0209257_1000047
559 Ga0209257_1027568
560 Ga0207642_10021160
561 Ga0207680_10000262
562 Ga0207680_10005628
563 Ga0207680_10157284
564 Ga0207699_10010710
565 Ga0207643_10027686
566 Ga0207643_10049992
567 Ga0207654_10032116
568 Ga0207695_10043588
569 Ga0207671_10001458
570 Ga0207671_10162336
571 Ga0207663_10000050
572 Ga0207650_10212966
573 Ga0207687_10046983
574 Ga0207700_10000303
575 Ga0207644_10004733
576 Ga0207709_10029109
577 Ga0207670_10003667
578 Ga0207669_10212965
579 Ga0207704_10005543
580 Ga0207665_10017189
581 Ga0207691_10015297
582 Ga0207691_10110415
583 Ga0207711_10000596
584 Ga0207711_10011756
585 Ga0207689_10006569
586 Ga0207651_10011121
587 Ga0207712_10014350
588 Ga0207668_10036852
589 Ga0207668_10093035
590 Ga0207658_10000043
591 Ga0207658_10003006
592 Ga0207677_10011017
593 Ga0207677_10357756
594 Ga0207703_10137167
595 Ga0207639_10005566
596 Ga0207639_10086356
597 Ga0207639_10187286
598 Ga0207678_10000242
599 Ga0207678_10031782
600 Ga0207678_10139765
601 Ga0207708_10000948
602 Ga0207702_10068832
603 Ga0207702_10184846
604 Ga0207641_10023397
605 Ga0207648_10003813
606 Ga0207648_10004116
607 Ga0207648_10061219
608 Ga0207648_10207666
609 Ga0207674_10007980
610 Ga0207674_10010503
611 Ga0207674_10022966
612 Ga0207675_100005712
613 Ga0207675_100317418
614 Ga0207698_10002813
615 Ga0207698_10165366
616 Ga0207698_10242709
617 Ga0209967_1001326
618 Ga0210000_1001945
619 Ga0209995_1003612
620 Ga0209282_1000003
621 Ga0209974_10014351
622 Ga0209974_10034465
623 Ga0207428_10208996
624 Ga0268266_10000001
625 Ga0268266_10011510
626 Ga0268266_10358044
627 Ga0268265_10000140
628 Ga0268265_10027787
629 Ga0268265_10301102
630 Ga0307515_10007880
631 Ga0307515_10017006
632 Ga0307515_10032292
633 Ga0307515_10077937
634 Ga0307515_10166019
635 Ga0316181_1171476
636 Ga0265331_10001077
637 Ga0265327_10000078
638 Ga0307513_10303702
639 Ga0307509_10042226
640 Ga0307408_100000029
641 Ga0307408_100000109
642 Ga0307508_10000144
643 Ga0307416_100257755
644 Ga0307414_10018554
645 Ga0307411_10000237
646 Ga0307411_10010230
647 Ga0307507_10125034
648 Ga0307510_10000426
649 Ga0307510_10290018
650 Ga0373948_0026341
651 Ga0373939_0000040
652 Ga0373939_0000433
653 Ga0373960_0001069
654 Ga0373960_0001147
655 Ga0373924_0016783
656 Ga0373931_0030556
657 Ga0373933_0112198
658 Ga0373937_0220766
659 Ga0373937_0459387
660 Ga0395899_0203325
661 Ga0395900_0026802
662 Ga0395898_0015433
663 Ga0395905_0003219
664 Ga0395905_0015109
665 Ga0395901_0008138
666 Ga0436361_0099049
667 Ga0436361_0628908
668 Ga0436361_0648483
669 Ga0436361_0692684
670 Ga0439461_0005919
671 Ga0451793_0494313
672 Ga0451793_1422541
673 Ga0451807_0381198
674 Ga0451807_2037227
675 Ga0451833_0999607
676 Ga0450917_000213
677 Ga0450917_000319
678 Ga0450888_001106
679 Ga0450888_003111
680 Ga0450890_000779
681 Ga0450890_000945
682 Ga0450891_000196
683 Ga0450889_003712
684 Ga0439458_0009132
685 Ga0439459_0017450
686 Ga0450916_005594
687 Ga0466972_0010176
688 Ga0453684_0008725
689 Ga0466970_0000751
690 Ga0466959_0004397
691 Ga0451576_0010161
692 Ga0495592_0252501
693 Ga0495610_0009725
694 Ga0495643_0098239
695 Ga0495597_0002867
696 Ga0495656_0072927
697 Ga0495687_000850
698 Ga0495686_0020699
699 Ga0495686_0021921
700 Ga0496102_0064873
701 Ga0496102_0145449
702 Ga0496103_0019389
703 Ga0496103_0145309
704 Ga0496109_0171108
705 Ga0496117_0058046
706 Ga0496118_0000772
707 Ga0496118_0002390
708 Ga0496118_0047977
709 Ga0496122_0000401
710 Ga0496123_0000230
711 Ga0496125_0214972
712 Ga0501291_002368
713 Ga0501294_001826
714 Ga0501296_005141
715 Ga0501297_004815
716 Ga0501297_006100
717 Ga0501300_005080
718 Ga0501031_0004116
719 Ga0501031_0094245
720 Ga0501032_0003847
721 Ga0501032_0008004
722 Ga0501033_0000784
723 Ga0501033_0001217
724 Ga0501033_0024176
725 Ga0501034_0002409
726 Ga0501034_0020315
727 Ga0501036_0010482
728 Ga0501036_0058298
729 Ga0501037_0000913
730 Ga0501038_0000102
731 Ga0501039_0047580
732 Ga0501039_0127121
733 Ga0501040_0196506
734 Ga0501043_0012423
735 Ga0501043_0137685
736 Ga0501046_0001819
737 Ga0501046_0008994
738 Ga0501046_0057798
739 Ga0501047_0010290
740 Ga0501047_0277676
741 Ga0501067_0023108
742 Ga0501068_0100049
743 Ga0501069_0007003
744 Ga0501070_0163731
745 Ga0501070_0278692
746 Ga0501071_0314439
747 Ga0501073_0001706
748 Ga0501073_0010825
749 Ga0501073_0271393
750 Ga0501074_0029370
751 Ga0501074_0108408
752 Ga0501074_0110819
753 Ga0501075_0077285
754 Ga0501076_0207294
755 Ga0501076_0550636
756 Ga0501077_0001845
757 Ga0501201_004122
758 Ga0501206_003613
759 Ga0501206_006633
760 Ga0501211_000640
761 Ga0501217_007708
762 Ga0501222_000231
763 Ga0501223_009685
764 Ga0501227_008346
765 Ga0501227_012097
766 Ga0501235_001787
767 Ga0501235_059487
768 Ga0501236_010819
769 Ga0501255_002022
770 Ga0501255_002632
771 Ga0501258_000433
772 Ga0501221_000045
773 Ga0501221_004224
774 Ga0501229_000309
775 Ga0501079_0007815
776 Ga0501079_0295278
777 Ga0501080_0043207
778 Ga0501080_0080979
779 Ga0501083_0051107
780 Ga0501083_0135115
781 Ga0501232_000044
782 Ga0501262_002860
783 Ga0501265_000974
784 Ga0501265_004113
785 Ga0501266_029588
786 Ga0501267_000285
787 Ga0501267_001276
788 Ga0501269_000079
789 Ga0501269_002346
790 Ga0501035_0002549
791 Ga0501035_0024959
792 Ga0501035_0082679
793 Ga0501035_0378583
794 Ga0501044_0001381
795 Ga0501044_0005275
796 Ga0501044_0008954
797 Ga0501045_0011208
798 nmdc:mga0k408_189076_c1
799 nmdc:mga06z11_23661_c1
800 nmdc:mga07m45_1733_c1
801 nmdc:mga07m45_306_c1
802 nmdc:mga07m45_54016_c1
803 nmdc:mga08y16_291238_c1
804 nmdc:mga08y16_377819_c1
805 Ga0500610_0000813
806 Ga0500646_0022671
807 Ga0500651_0061293
808 Ga0500651_0083914
809 Ga0500597_000185
810 Ga0500607_127322
811 Ga0500652_041841
812 Ga0500568_0000927
813 Ga0500568_0003392
814 Ga0500590_027191
815 Ga0500604_0000029
816 Ga0500616_0000702
817 Ga0500587_003211
818 Ga0501084_0005593
819 Ga0501084_0092106
820 Ga0501084_0140823
821 Ga0501082_0001112
822 Ga0501082_0003735
823 Ga0501082_0590512
824 8054799798
825 2643743590
826 2643743732
827 2643936517
828 2643936654
829 2644222356
830 2644222541
831 2644256370
832 2644256619
833 2644305810
834 2644317873
835 2644318010
836 2739058118
837 2739058383
838 2819673777
839 2842783782
840 2904426354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

74

308

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9244 1 289
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9181 1 289
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9105 5 289
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.9065 1 290
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.8967 52 283
ID Description Score Start End Superfamily
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9452 57 294 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9414 53 292 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9263 53 292 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9246 53 292 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.912 57 294 1.10.3720.10
ID Description Score Start End GO Terms
AF-K2ANJ1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9583 10 294 GO:0005886
GO:0055085
AF-A0A366LQ21-F1-model_v4 Sugar ABC transporter permease 0.9577 2 294 GO:0005886
GO:0055085
AF-A0A3A9KQU5-F1-model_v4 ABC transporter permease 0.956 1 291 GO:0005886
GO:0055085
AF-A0A1F3V4B6-F1-model_v4 Sugar ABC transporter permease 0.9556 9 294 GO:0005886
GO:0055085
AF-A0A2V6PBY6-F1-model_v4 Sugar ABC transporter permease 0.9531 2 291 GO:0005886
GO:0055085

Map