F440201

General Info

Members Datasets Scaffolds Average Seq Length
422 216 844 157

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_101169114|Ga0070678_1011691141
Length 187
Sequence VFEKIKDELHYFLALFMSRNWWFDNGIMANSPELKLKEGDPAPGFTAATHRTERISLSDFKGKNVILYFYPKDNTPGCTKEACAFRDEFAAFKKSGAAILGVSTDSEKSHKKFVEKYQLPFELVADPDKQIVNAYGVWGEKMFMGVKYQGIHRVTFLIGPDGKIKKIWPKVKPAEHAAEVLAALAGN

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
98 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
99 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
109 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 4.27
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.98
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_101169114 3300005456 Bacteria 712
2 LJQas_1003636 3300000549 Bacteria 2050
3 JGI25406J46586_10006346 3300003203 Bacteria 5455
4 Ga0058862_12754724 3300004803 Bacteria 1053
5 Ga0065707_10198533 3300005295 Bacteria 1322
6 Ga0065707_10416116 3300005295 Bacteria 836
7 Ga0070676_11610913 3300005328 Bacteria 502
8 Ga0070690_100252427 3300005330 Bacteria 1248
9 Ga0070670_100885700 3300005331 Bacteria 809
10 Ga0070680_100036018 3300005336 Bacteria 3997
11 Ga0070689_100082470 3300005340 Bacteria 2526
12 Ga0070689_100213848 3300005340 Bacteria 1579
13 Ga0070669_100278585 3300005353 Bacteria 1339
14 Ga0070675_100292377 3300005354 Bacteria 1434
15 Ga0070688_100705874 3300005365 Bacteria 782
16 Ga0070667_101450039 3300005367 Bacteria 644
17 Ga0070709_10053715 3300005434 Bacteria 2538
18 Ga0070714_100212812 3300005435 Bacteria 1772
19 Ga0070713_100081274 3300005436 Bacteria 2765
20 Ga0070710_10184904 3300005437 Bacteria 1307
21 Ga0070705_100075886 3300005440 Bacteria 2048
22 Ga0070705_100112899 3300005440 Bacteria 1740
23 Ga0070694_100025284 3300005444 Bacteria 3841
24 Ga0070694_100829645 3300005444 Bacteria 760
25 Ga0070708_100160361 3300005445 Bacteria 2096
26 Ga0070706_100029994 3300005467 Bacteria 5009
27 Ga0070707_100077294 3300005468 Bacteria 3212
28 Ga0070707_101989604 3300005468 Bacteria 549
29 Ga0070679_100809806 3300005530 Bacteria 880
30 Ga0070695_100289894 3300005545 Bacteria 1206
31 Ga0070696_100085460 3300005546 Bacteria 2239
32 Ga0070696_100175695 3300005546 Bacteria 1586
33 Ga0070704_100011046 3300005549 Bacteria 5512
34 Ga0068857_100000915 3300005577 Bacteria 22274
35 Ga0068856_100010883 3300005614 Bacteria 8829
36 Ga0068859_100238175 3300005617 Bacteria 1908
37 Ga0068859_100340486 3300005617 Bacteria 1594
38 Ga0068859_100441650 3300005617 Bacteria 1397
39 Ga0068864_100485316 3300005618 Bacteria 1187
40 Ga0068864_100899141 3300005618 Unclassified 874
41 Ga0068861_100135306 3300005719 Bacteria 2005
42 Ga0068858_101285173 3300005842 Bacteria 720
43 Ga0081538_10155471 3300005981 Bacteria 1027
44 Ga0081540_1044196 3300005983 Bacteria 2276
45 Ga0081539_10000020 3300005985 Bacteria 366549
46 Ga0070716_100162957 3300006173 Bacteria 1447
47 Ga0070712_100342564 3300006175 Bacteria 1221
48 Ga0075428_100046664 3300006844 Bacteria 4758
49 Ga0075428_100087968 3300006844 Bacteria 3389
50 Ga0075428_100122643 3300006844 Bacteria 2829
51 Ga0075428_100890583 3300006844 Bacteria 944
52 Ga0075430_100000047 3300006846 Bacteria 63972
53 Ga0075430_100002884 3300006846 Bacteria 14397
54 Ga0075430_100921898 3300006846 Bacteria 720
55 Ga0075431_100000424 3300006847 Bacteria 34431
56 Ga0075431_100008175 3300006847 Bacteria 10452
57 Ga0075431_100026771 3300006847 Bacteria 5914
58 Ga0075431_100113041 3300006847 Bacteria 2803
59 Ga0075431_100906318 3300006847 Bacteria 851
60 Ga0075433_10359144 3300006852 Bacteria 1287
61 Ga0075434_100264810 3300006871 Bacteria 1738
62 Ga0075429_100114464 3300006880 Bacteria 2358
63 Ga0075429_100135195 3300006880 Bacteria 2158
64 Ga0097620_100238168 3300006931 Bacteria 1908
65 Ga0097620_100340486 3300006931 Bacteria 1594
66 Ga0097620_100441640 3300006931 Bacteria 1397
67 Ga0075435_100429984 3300007076 Bacteria 1137
68 Ga0111539_10341373 3300009094 Bacteria 1743
69 Ga0111539_10370631 3300009094 Bacteria 1667
70 Ga0111539_10471541 3300009094 Bacteria 1462
71 Ga0111539_10824080 3300009094 Bacteria 1080
72 Ga0111539_11023784 3300009094 Bacteria 960
73 Ga0114129_10021214 3300009147 Bacteria 9225
74 Ga0114129_10053997 3300009147 Bacteria 5634
75 Ga0114129_10084824 3300009147 Bacteria 4396
76 Ga0114129_10145031 3300009147 Bacteria 3253
77 Ga0114129_10200711 3300009147 Bacteria 2701
78 Ga0114129_10566365 3300009147 Bacteria 1476
79 Ga0114129_10742710 3300009147 Bacteria 1257
80 Ga0105243_10006204 3300009148 Bacteria 9244
81 Ga0105241_10647417 3300009174 Bacteria 959
82 Ga0105242_10095050 3300009176 Unclassified 2515
83 Ga0105242_10256351 3300009176 Bacteria 1578
84 Ga0105242_12327344 3300009176 Bacteria 582
85 Ga0105248_10079763 3300009177 Bacteria 3679
86 Ga0105248_10335903 3300009177 Bacteria 1701
87 Ga0105238_10485893 3300009551 Bacteria 1235
88 Ga0105239_11812340 3300010375 Bacteria 707
89 Ga0157373_10078616 3300013100 Bacteria 2326
90 Ga0157373_10133346 3300013100 Bacteria 1746
91 Ga0157378_10529564 3300013297 Bacteria 1181
92 Ga0157378_10807668 3300013297 Bacteria 964
93 Ga0163162_10064047 3300013306 Bacteria 3721
94 Ga0157375_10000016 3300013308 Bacteria 295002
95 Ga0157375_10368788 3300013308 Bacteria 1602
96 Ga0157375_10686143 3300013308 Bacteria 1178
97 Ga0157375_12170344 3300013308 Bacteria 661
98 Ga0163163_10000038 3300014325 Bacteria 154457
99 Ga0163163_10110961 3300014325 Unclassified 2771
100 Ga0163163_10339468 3300014325 Bacteria 1557
101 Ga0163163_10367566 3300014325 Bacteria 1495
102 Ga0157380_10595947 3300014326 Bacteria 1092
103 Ga0157377_10145591 3300014745 Bacteria 1460
104 Ga0157376_10632413 3300014969 Unclassified 1069
105 Ga0213876_10075242 3300021384 Bacteria 1783
106 Ga0207692_10243230 3300025898 Bacteria 1075
107 Ga0207699_10045170 3300025906 Bacteria 2570
108 Ga0207654_10126097 3300025911 Bacteria 1614
109 Ga0207707_10099471 3300025912 Bacteria 2542
110 Ga0207693_10247537 3300025915 Bacteria 1399
111 Ga0207659_11405955 3300025926 Bacteria 598
112 Ga0207700_10075591 3300025928 Bacteria 2611
113 Ga0207664_10029054 3300025929 Bacteria 4209
114 Ga0207690_10993887 3300025932 Bacteria 698
115 Ga0207706_10079980 3300025933 Bacteria 2874
116 Ga0207706_10161222 3300025933 Bacteria 1971
117 Ga0207686_10062670 3300025934 Unclassified 2362
118 Ga0207686_10383546 3300025934 Bacteria 1066
119 Ga0207670_10371726 3300025936 Bacteria 1137
120 Ga0207670_10386969 3300025936 Bacteria 1115
121 Ga0207665_10178191 3300025939 Bacteria 1538
122 Ga0207702_10002572 3300026078 Bacteria 17056
123 Ga0207674_10002805 3300026116 Bacteria 21684
124 Ga0207675_100105997 3300026118 Bacteria 2650
125 Ga0207675_101078791 3300026118 Bacteria 822
126 Ga0209998_10052925 3300027717 Bacteria 943
127 Ga0209974_10126409 3300027876 Bacteria 909
128 Ga0207428_10330329 3300027907 Bacteria 1124
129 Ga0268264_11148076 3300028381 Bacteria 786
130 Ga0265337_1000183 3300028556 Bacteria 33003
131 Ga0265337_1002126 3300028556 Bacteria 9341
132 Ga0265337_1120884 3300028556 Bacteria 710
133 Ga0265318_10072554 3300028577 Unclassified 1275
134 Ga0265323_10000016 3300028653 Bacteria 96953
135 Ga0265336_10016060 3300028666 Bacteria 2451
136 Ga0265336_10097529 3300028666 Bacteria 876
137 Ga0265338_10015579 3300028800 Bacteria 8333
138 Ga0265338_10021506 3300028800 Bacteria 6723
139 Ga0265338_10202255 3300028800 Bacteria 1497
140 Ga0265338_10317174 3300028800 Bacteria 1129
141 Ga0265338_10443156 3300028800 Bacteria 920
142 Ga0265324_10198379 3300029957 Bacteria 682
143 Ga0265320_10208464 3300031240 Bacteria 872
144 Ga0265340_10014264 3300031247 Bacteria 4155
145 Ga0265316_10014127 3300031344 Bacteria 7045
146 Ga0265316_10014882 3300031344 Bacteria 6824
147 Ga0265316_10253613 3300031344 Bacteria 1291
148 Ga0265314_10216253 3300031711 Bacteria 1121
149 Ga0316576_10000299 3300031727 Bacteria 21886
150 Ga0307409_100248467 3300031995 Bacteria 1625
151 Ga0307416_101917502 3300032002 Bacteria 696
152 Ga0373940_0297103 3300035088 Bacteria 555
153 Ga0373949_0033930 3300035090 Bacteria 1228
154 Ga0373951_0094891 3300035091 Bacteria 787
155 Ga0373923_0270634 3300035111 Bacteria 799
156 Ga0373932_0032774 3300035112 Bacteria 1456
157 Ga0373941_0051153 3300035115 Bacteria 1314
158 Ga0373955_0038480 3300035172 Bacteria 2549
159 Ga0373955_0396386 3300035172 Bacteria 838
160 Ga0373931_0023082 3300035691 Bacteria 3138
161 Ga0373937_1505829 3300036401 Bacteria 620
162 Ga0373925_1065549 3300037068 Bacteria 665
163 Ga0436365_0559439 3300039437 Bacteria 1732
164 Ga0451798_0907138 3300041458 Bacteria 1014
165 Ga0439463_146041 3300042016 Bacteria 613
166 Ga0439435_0081426 3300042436 Bacteria 972
167 Ga0439460_0043607 3300042461 Bacteria 1326
168 Ga0451577_0000065 3300042876 Bacteria 260821
169 Ga0451577_0096484 3300042876 Bacteria 2640
170 Ga0453684_0000743 3300044712 Bacteria 113711
171 Ga0451576_0589777 3300045051 Unclassified 1168
172 Ga0495592_0720123 3300046454 Bacteria 599
173 Ga0495653_0049157 3300046463 Bacteria 3251
174 Ga0495580_0011012 3300046472 Bacteria 7009
175 Ga0495582_0070788 3300046473 Bacteria 1930
176 Ga0495639_0213597 3300046475 Bacteria 947
177 Ga0495584_0698173 3300046491 Bacteria 517
178 Ga0495594_0200436 3300046499 Bacteria 1138
179 Ga0495628_0049419 3300046516 Bacteria 3331
180 Ga0495630_0013833 3300046517 Bacteria 5868
181 Ga0495630_0127989 3300046517 Bacteria 1928
182 Ga0495630_0531383 3300046517 Bacteria 902
183 Ga0495643_0137852 3300046522 Bacteria 1219
184 Ga0495666_0331038 3300046526 Bacteria 687
185 Ga0495642_0056800 3300046528 Bacteria 1617
186 Ga0495642_0119493 3300046528 Bacteria 1130
187 Ga0495665_0020396 3300046531 Bacteria 3560
188 Ga0495640_0195304 3300046533 Bacteria 1285
189 Ga0495586_0006435 3300046535 Bacteria 6275
190 Ga0495598_0216724 3300046537 Unclassified 697
191 Ga0495656_0361761 3300046615 Bacteria 753
192 Ga0495634_0297505 3300046642 Bacteria 976
193 Ga0495659_0165867 3300046664 Bacteria 894
194 Ga0495588_0318560 3300046674 Bacteria 818
195 Ga0495670_0031436 3300046691 Bacteria 2638
196 Ga0495670_0101109 3300046691 Bacteria 1485
197 Ga0495600_0073200 3300046809 Bacteria 2237
198 Ga0495581_0046710 3300047315 Bacteria 2502
199 Ga0495680_0020174 3300047322 Bacteria 5613
200 Ga0495675_0129853 3300047444 Bacteria 1566
201 Ga0495684_0426490 3300047471 Bacteria 926
202 Ga0496100_1004471 3300048903 Bacteria 656
203 Ga0496102_0062337 3300048905 Bacteria 3414
204 Ga0496102_0240079 3300048905 Bacteria 1709
205 Ga0496102_0347043 3300048905 Bacteria 1397
206 Ga0496102_0410347 3300048905 Bacteria 1272
207 Ga0496103_0073137 3300048906 Bacteria 2147
208 Ga0496103_0233407 3300048906 Bacteria 1183
209 Ga0496103_0452444 3300048906 Bacteria 823
210 Ga0496105_1360000 3300048908 Bacteria 516
211 Ga0496106_0047024 3300048909 Bacteria 3245
212 Ga0496107_0002267 3300048910 Bacteria 12409
213 Ga0496107_0253037 3300048910 Bacteria 1311
214 Ga0496108_1119438 3300048911 Bacteria 668
215 Ga0496109_0274522 3300048912 Bacteria 1588
216 Ga0496109_1070213 3300048912 Bacteria 744
217 Ga0496110_0032163 3300048913 Bacteria 4528
218 Ga0496111_0009380 3300048914 Bacteria 6526
219 Ga0496111_0549925 3300048914 Bacteria 847
220 Ga0496112_0293260 3300048915 Bacteria 1572
221 Ga0496113_0408465 3300048916 Bacteria 1090
222 Ga0501031_0005593 3300049568 Bacteria 8191
223 Ga0501031_0032545 3300049568 Bacteria 3400
224 Ga0501031_0108824 3300049568 Bacteria 1810
225 Ga0501032_0226743 3300049569 Bacteria 1215
226 Ga0501032_0329884 3300049569 Bacteria 984
227 Ga0501033_0008476 3300049570 Bacteria 7958
228 Ga0501033_0124694 3300049570 Bacteria 1868
229 Ga0501033_0314503 3300049570 Bacteria 1101
230 Ga0501036_0002948 3300049572 Bacteria 13518
231 Ga0501036_0005831 3300049572 Bacteria 9972
232 Ga0501036_0184672 3300049572 Bacteria 1755
233 Ga0501036_0228085 3300049572 Bacteria 1563
234 Ga0501036_1103029 3300049572 Bacteria 648
235 Ga0501037_0032591 3300049573 Bacteria 3848
236 Ga0501037_0148103 3300049573 Bacteria 1679
237 Ga0501038_0001025 3300049574 Bacteria 25187
238 Ga0501038_0003218 3300049574 Bacteria 15235
239 Ga0501038_0093650 3300049574 Bacteria 2513
240 Ga0501038_0229531 3300049574 Bacteria 1478
241 Ga0501039_0008312 3300049575 Bacteria 7908
242 Ga0501039_0624722 3300049575 Bacteria 844
243 Ga0501039_0877146 3300049575 Bacteria 699
244 Ga0501040_0000631 3300049576 Bacteria 21526
245 Ga0501040_0195573 3300049576 Bacteria 1435
246 Ga0501040_0266669 3300049576 Bacteria 1222
247 Ga0501040_0314206 3300049576 Bacteria 1120
248 Ga0501040_0493613 3300049576 Bacteria 882
249 Ga0501041_0004489 3300049577 Bacteria 8088
250 Ga0501041_0006940 3300049577 Bacteria 6643
251 Ga0501041_0010025 3300049577 Bacteria 5583
252 Ga0501041_0022855 3300049577 Bacteria 3746
253 Ga0501041_0091028 3300049577 Bacteria 1883
254 Ga0501041_0296585 3300049577 Bacteria 1018
255 Ga0501041_0375629 3300049577 Bacteria 899
256 Ga0501042_0000828 3300049578 Bacteria 17181
257 Ga0501042_0004651 3300049578 Bacteria 8759
258 Ga0501042_0026685 3300049578 Bacteria 4058
259 Ga0501042_0129400 3300049578 Bacteria 1819
260 Ga0501043_0006508 3300049579 Bacteria 9373
261 Ga0501046_0007522 3300049580 Bacteria 9557
262 Ga0501046_0012261 3300049580 Bacteria 7305
263 Ga0501046_0196946 3300049580 Bacteria 1500
264 Ga0501046_0200152 3300049580 Bacteria 1486
265 Ga0501046_0233221 3300049580 Bacteria 1359
266 Ga0501046_0285066 3300049580 Bacteria 1209
267 Ga0501046_0581408 3300049580 Bacteria 796
268 Ga0501048_0000457 3300049582 Bacteria 28577
269 Ga0501048_0033551 3300049582 Bacteria 3708
270 Ga0501048_0070229 3300049582 Bacteria 2474
271 Ga0501048_0070658 3300049582 Bacteria 2465
272 Ga0501048_0106184 3300049582 Bacteria 1982
273 Ga0501048_0612938 3300049582 Bacteria 781
274 Ga0501067_0038062 3300049583 Bacteria 2671
275 Ga0501068_0051897 3300049584 Bacteria 2482
276 Ga0501068_0124157 3300049584 Bacteria 1611
277 Ga0501068_0190372 3300049584 Bacteria 1299
278 Ga0501068_0404442 3300049584 Bacteria 880
279 Ga0501068_0463181 3300049584 Bacteria 821
280 Ga0501069_0137009 3300049585 Bacteria 1403
281 Ga0501070_0021522 3300049586 Bacteria 5410
282 Ga0501070_0511832 3300049586 Bacteria 964
283 Ga0501070_0970536 3300049586 Bacteria 660
284 Ga0501071_0000456 3300049587 Bacteria 20604
285 Ga0501071_0004702 3300049587 Bacteria 8678
286 Ga0501071_0107959 3300049587 Bacteria 2056
287 Ga0501071_0157915 3300049587 Bacteria 1694
288 Ga0501071_0203484 3300049587 Bacteria 1487
289 Ga0501071_0537879 3300049587 Bacteria 897
290 Ga0501072_0001602 3300049588 Bacteria 16913
291 Ga0501072_0001951 3300049588 Bacteria 15365
292 Ga0501072_0009111 3300049588 Bacteria 7537
293 Ga0501072_0011674 3300049588 Bacteria 6711
294 Ga0501072_0241043 3300049588 Bacteria 1440
295 Ga0501073_0150100 3300049589 Bacteria 1615
296 Ga0501073_0715410 3300049589 Bacteria 691
297 Ga0501074_0002370 3300049590 Bacteria 13122
298 Ga0501074_0035469 3300049590 Bacteria 3614
299 Ga0501074_0123176 3300049590 Bacteria 1854
300 Ga0501074_0179512 3300049590 Bacteria 1510
301 Ga0501074_0233345 3300049590 Bacteria 1310
302 Ga0501074_0382831 3300049590 Bacteria 998
303 Ga0501074_0544132 3300049590 Bacteria 822
304 Ga0501075_0000003 3300049591 Bacteria 173182
305 Ga0501075_0017229 3300049591 Bacteria 5216
306 Ga0501075_0026301 3300049591 Bacteria 4283
307 Ga0501075_0068243 3300049591 Bacteria 2686
308 Ga0501075_0082416 3300049591 Bacteria 2436
309 Ga0501075_0092002 3300049591 Bacteria 2302
310 Ga0501075_0245377 3300049591 Bacteria 1365
311 Ga0501076_0000010 3300049592 Bacteria 116774
312 Ga0501076_0008443 3300049592 Bacteria 7550
313 Ga0501076_0014040 3300049592 Bacteria 6020
314 Ga0501076_0025727 3300049592 Bacteria 4556
315 Ga0501076_0047637 3300049592 Bacteria 3389
316 Ga0501076_0067287 3300049592 Bacteria 2860
317 Ga0501076_0093472 3300049592 Bacteria 2420
318 Ga0501076_0202210 3300049592 Bacteria 1622
319 Ga0501076_0908095 3300049592 Bacteria 726
320 Ga0501077_0000456 3300049593 Bacteria 24833
321 Ga0501077_0008419 3300049593 Bacteria 6388
322 Ga0501077_0049444 3300049593 Bacteria 2672
323 Ga0501077_0106141 3300049593 Bacteria 1780
324 Ga0501077_0150366 3300049593 Bacteria 1477
325 Ga0501077_0363543 3300049593 Bacteria 924
326 Ga0501079_0000036 3300049741 Bacteria 57722
327 Ga0501079_0002680 3300049741 Bacteria 12948
328 Ga0501079_0023904 3300049741 Bacteria 4688
329 Ga0501079_0181610 3300049741 Bacteria 1642
330 Ga0501079_0214003 3300049741 Bacteria 1505
331 Ga0501079_0248209 3300049741 Bacteria 1391
332 Ga0501080_0000401 3300049742 Bacteria 33489
333 Ga0501080_0012051 3300049742 Bacteria 7923
334 Ga0501080_0218608 3300049742 Bacteria 1744
335 Ga0501080_0259624 3300049742 Bacteria 1583
336 Ga0501080_0373090 3300049742 Bacteria 1286
337 Ga0501081_0001211 3300049743 Bacteria 15691
338 Ga0501081_0009377 3300049743 Bacteria 6376
339 Ga0501081_0018792 3300049743 Bacteria 4591
340 Ga0501081_0311415 3300049743 Bacteria 1156
341 Ga0501083_0018014 3300049744 Bacteria 4925
342 Ga0501083_0079098 3300049744 Bacteria 2181
343 Ga0501083_0159480 3300049744 Bacteria 1476
344 Ga0501035_0013314 3300049822 Bacteria 7590
345 Ga0501035_0298314 3300049822 Bacteria 1358
346 Ga0501035_0391604 3300049822 Bacteria 1157
347 Ga0501035_0492349 3300049822 Bacteria 1010
348 Ga0501044_0355022 3300049823 Bacteria 1385
349 Ga0501045_0000013 3300049824 Bacteria 73989
350 Ga0501045_0004892 3300049824 Bacteria 9277
351 Ga0501045_0022035 3300049824 Bacteria 4559
352 Ga0501045_0392817 3300049824 Bacteria 1032
353 Ga0501045_1289023 3300049824 Bacteria 532
354 nmdc:mga05p37_142007_c1 3300050507 Bacteria 2941
355 nmdc:mga05p37_15394_c1 3300050507 Bacteria 9188
356 nmdc:mga05p37_16113_c1 3300050507 Bacteria 8999
357 nmdc:mga05p37_16691_c1 3300050507 Bacteria 8847
358 nmdc:mga05p37_1680664_c1 3300050507 Bacteria 620
359 nmdc:mga05p37_208353_c1 3300050507 Bacteria 2364
360 nmdc:mga05p37_240988_c2 3300050507 Bacteria 1584
361 nmdc:mga09592_107044_c1 3300050508 Bacteria 2398
362 nmdc:mga09592_28649_c1 3300050508 Bacteria 4628
363 nmdc:mga09592_764356_c1 3300050508 Bacteria 819
364 nmdc:mga0qj67_101353_c1 3300050509 Bacteria 2321
365 nmdc:mga0qj67_1339135_c1 3300050509 Bacteria 554
366 nmdc:mga0qj67_203_c1 3300050509 Bacteria 40147
367 nmdc:mga0qj67_75626_c1 3300050509 Bacteria 2692
368 nmdc:mga06r32_12265_c1 3300050510 Bacteria 7729
369 nmdc:mga06r32_217129_c1 3300050510 Bacteria 1900
370 nmdc:mga06r32_566201_c1 3300050510 Bacteria 1109
371 nmdc:mga06r32_61503_c1 3300050510 Bacteria 3615
372 nmdc:mga08y16_581168_c1 3300050511 Bacteria 1131
373 nmdc:mga0n895_145791_c1 3300050512 Bacteria 2397
374 nmdc:mga0n895_262401_c1 3300050512 Bacteria 1753
375 nmdc:mga0n895_267579_c1 3300050512 Bacteria 1734
376 nmdc:mga0rr50_324315_c1 3300050513 Bacteria 1292
377 nmdc:mga0a205_356433_c1 3300050515 Bacteria 1330
378 Ga0495612_0035134 3300053078 Bacteria 2031
379 Ga0500636_0068539 3300053177 Bacteria 2060
380 Ga0501084_0000346 3300054114 Bacteria 35396
381 Ga0501084_0002305 3300054114 Bacteria 15326
382 Ga0501084_0002351 3300054114 Bacteria 15208
383 Ga0501084_0004293 3300054114 Bacteria 11606
384 Ga0501084_0051159 3300054114 Bacteria 3457
385 Ga0501084_0346872 3300054114 Bacteria 1254
386 Ga0501084_0347227 3300054114 Bacteria 1253
387 Ga0590071_001155 3300059421 Bacteria 7138
388 Ga0590075_011688 3300059424 Bacteria 2125
389 Ga0587084_096719 3300059477 Bacteria 593
390 Ga0587066_056803 3300059490 Bacteria 787
391 Ga0587070_128001 3300059491 Bacteria 615
392 Ga0587073_0129164 3300059492 Bacteria 692
393 Ga0587080_056443 3300059503 Bacteria 754
394 Ga0587083_0095675 3300059505 Bacteria 732
395 Ga0587091_108357 3300059511 Bacteria 660
396 Ga0587092_094233 3300059512 Bacteria 608
397 Ga0587094_055002 3300059513 Bacteria 683
398 Ga0587098_040159 3300059604 Bacteria 678
399 Ga0587106_022445 3300059605 Bacteria 949
400 Ga0587101_025084 3300059623 Bacteria 890
401 Ga0587109_121667 3300059624 Bacteria 620
402 Ga0587122_023926 3300059628 Bacteria 682
403 Ga0587067_084173 3300059640 Bacteria 709
404 Ga0587068_082076 3300059641 Bacteria 652
405 Ga0587071_072182 3300060344 Bacteria 754
406 Ga0501082_0000478 3300060353 Bacteria 35347
407 Ga0501082_0007464 3300060353 Bacteria 9434
408 Ga0501082_0014133 3300060353 Bacteria 6869
409 Ga0501082_0018438 3300060353 Bacteria 6011
410 Ga0501082_0021829 3300060353 Bacteria 5518
411 Ga0501082_0025238 3300060353 Bacteria 5121
412 Ga0501082_0169761 3300060353 Bacteria 1896
413 Ga0501082_0814126 3300060353 Bacteria 817
414 Ga0501082_0909049 3300060353 Bacteria 770
415 Ga0530510_0000008 3300061734 Bacteria 165671
416 Ga0530510_0013645 3300061734 Bacteria 5717
417 Ga0530510_0029018 3300061734 Bacteria 3968
418 Ga0530510_0051705 3300061734 Bacteria 2969
419 Ga0530510_0074049 3300061734 Bacteria 2472
420 Ga0530510_0121162 3300061734 Bacteria 1920
421 Ga0530510_0171797 3300061734 Bacteria 1606
422 8054109324 8054107350 Bacteria 5022511
423 Ga0070678_101169114
424 LJQas_1003636
425 JGI25406J46586_10006346
426 Ga0058862_12754724
427 Ga0065707_10198533
428 Ga0065707_10416116
429 Ga0070676_11610913
430 Ga0070690_100252427
431 Ga0070670_100885700
432 Ga0070680_100036018
433 Ga0070689_100082470
434 Ga0070689_100213848
435 Ga0070669_100278585
436 Ga0070675_100292377
437 Ga0070688_100705874
438 Ga0070667_101450039
439 Ga0070709_10053715
440 Ga0070714_100212812
441 Ga0070713_100081274
442 Ga0070710_10184904
443 Ga0070705_100075886
444 Ga0070705_100112899
445 Ga0070694_100025284
446 Ga0070694_100829645
447 Ga0070708_100160361
448 Ga0070706_100029994
449 Ga0070707_100077294
450 Ga0070707_101989604
451 Ga0070679_100809806
452 Ga0070695_100289894
453 Ga0070696_100085460
454 Ga0070696_100175695
455 Ga0070704_100011046
456 Ga0068857_100000915
457 Ga0068856_100010883
458 Ga0068859_100238175
459 Ga0068859_100340486
460 Ga0068859_100441650
461 Ga0068864_100485316
462 Ga0068864_100899141
463 Ga0068861_100135306
464 Ga0068858_101285173
465 Ga0081538_10155471
466 Ga0081540_1044196
467 Ga0081539_10000020
468 Ga0070716_100162957
469 Ga0070712_100342564
470 Ga0075428_100046664
471 Ga0075428_100087968
472 Ga0075428_100122643
473 Ga0075428_100890583
474 Ga0075430_100000047
475 Ga0075430_100002884
476 Ga0075430_100921898
477 Ga0075431_100000424
478 Ga0075431_100008175
479 Ga0075431_100026771
480 Ga0075431_100113041
481 Ga0075431_100906318
482 Ga0075433_10359144
483 Ga0075434_100264810
484 Ga0075429_100114464
485 Ga0075429_100135195
486 Ga0097620_100238168
487 Ga0097620_100340486
488 Ga0097620_100441640
489 Ga0075435_100429984
490 Ga0111539_10341373
491 Ga0111539_10370631
492 Ga0111539_10471541
493 Ga0111539_10824080
494 Ga0111539_11023784
495 Ga0114129_10021214
496 Ga0114129_10053997
497 Ga0114129_10084824
498 Ga0114129_10145031
499 Ga0114129_10200711
500 Ga0114129_10566365
501 Ga0114129_10742710
502 Ga0105243_10006204
503 Ga0105241_10647417
504 Ga0105242_10095050
505 Ga0105242_10256351
506 Ga0105242_12327344
507 Ga0105248_10079763
508 Ga0105248_10335903
509 Ga0105238_10485893
510 Ga0105239_11812340
511 Ga0157373_10078616
512 Ga0157373_10133346
513 Ga0157378_10529564
514 Ga0157378_10807668
515 Ga0163162_10064047
516 Ga0157375_10000016
517 Ga0157375_10368788
518 Ga0157375_10686143
519 Ga0157375_12170344
520 Ga0163163_10000038
521 Ga0163163_10110961
522 Ga0163163_10339468
523 Ga0163163_10367566
524 Ga0157380_10595947
525 Ga0157377_10145591
526 Ga0157376_10632413
527 Ga0213876_10075242
528 Ga0207692_10243230
529 Ga0207699_10045170
530 Ga0207654_10126097
531 Ga0207707_10099471
532 Ga0207693_10247537
533 Ga0207659_11405955
534 Ga0207700_10075591
535 Ga0207664_10029054
536 Ga0207690_10993887
537 Ga0207706_10079980
538 Ga0207706_10161222
539 Ga0207686_10062670
540 Ga0207686_10383546
541 Ga0207670_10371726
542 Ga0207670_10386969
543 Ga0207665_10178191
544 Ga0207702_10002572
545 Ga0207674_10002805
546 Ga0207675_100105997
547 Ga0207675_101078791
548 Ga0209998_10052925
549 Ga0209974_10126409
550 Ga0207428_10330329
551 Ga0268264_11148076
552 Ga0265337_1000183
553 Ga0265337_1002126
554 Ga0265337_1120884
555 Ga0265318_10072554
556 Ga0265323_10000016
557 Ga0265336_10016060
558 Ga0265336_10097529
559 Ga0265338_10015579
560 Ga0265338_10021506
561 Ga0265338_10202255
562 Ga0265338_10317174
563 Ga0265338_10443156
564 Ga0265324_10198379
565 Ga0265320_10208464
566 Ga0265340_10014264
567 Ga0265316_10014127
568 Ga0265316_10014882
569 Ga0265316_10253613
570 Ga0265314_10216253
571 Ga0316576_10000299
572 Ga0307409_100248467
573 Ga0307416_101917502
574 Ga0373940_0297103
575 Ga0373949_0033930
576 Ga0373951_0094891
577 Ga0373923_0270634
578 Ga0373932_0032774
579 Ga0373941_0051153
580 Ga0373955_0038480
581 Ga0373955_0396386
582 Ga0373931_0023082
583 Ga0373937_1505829
584 Ga0373925_1065549
585 Ga0436365_0559439
586 Ga0451798_0907138
587 Ga0439463_146041
588 Ga0439435_0081426
589 Ga0439460_0043607
590 Ga0451577_0000065
591 Ga0451577_0096484
592 Ga0453684_0000743
593 Ga0451576_0589777
594 Ga0495592_0720123
595 Ga0495653_0049157
596 Ga0495580_0011012
597 Ga0495582_0070788
598 Ga0495639_0213597
599 Ga0495584_0698173
600 Ga0495594_0200436
601 Ga0495628_0049419
602 Ga0495630_0013833
603 Ga0495630_0127989
604 Ga0495630_0531383
605 Ga0495643_0137852
606 Ga0495666_0331038
607 Ga0495642_0056800
608 Ga0495642_0119493
609 Ga0495665_0020396
610 Ga0495640_0195304
611 Ga0495586_0006435
612 Ga0495598_0216724
613 Ga0495656_0361761
614 Ga0495634_0297505
615 Ga0495659_0165867
616 Ga0495588_0318560
617 Ga0495670_0031436
618 Ga0495670_0101109
619 Ga0495600_0073200
620 Ga0495581_0046710
621 Ga0495680_0020174
622 Ga0495675_0129853
623 Ga0495684_0426490
624 Ga0496100_1004471
625 Ga0496102_0062337
626 Ga0496102_0240079
627 Ga0496102_0347043
628 Ga0496102_0410347
629 Ga0496103_0073137
630 Ga0496103_0233407
631 Ga0496103_0452444
632 Ga0496105_1360000
633 Ga0496106_0047024
634 Ga0496107_0002267
635 Ga0496107_0253037
636 Ga0496108_1119438
637 Ga0496109_0274522
638 Ga0496109_1070213
639 Ga0496110_0032163
640 Ga0496111_0009380
641 Ga0496111_0549925
642 Ga0496112_0293260
643 Ga0496113_0408465
644 Ga0501031_0005593
645 Ga0501031_0032545
646 Ga0501031_0108824
647 Ga0501032_0226743
648 Ga0501032_0329884
649 Ga0501033_0008476
650 Ga0501033_0124694
651 Ga0501033_0314503
652 Ga0501036_0002948
653 Ga0501036_0005831
654 Ga0501036_0184672
655 Ga0501036_0228085
656 Ga0501036_1103029
657 Ga0501037_0032591
658 Ga0501037_0148103
659 Ga0501038_0001025
660 Ga0501038_0003218
661 Ga0501038_0093650
662 Ga0501038_0229531
663 Ga0501039_0008312
664 Ga0501039_0624722
665 Ga0501039_0877146
666 Ga0501040_0000631
667 Ga0501040_0195573
668 Ga0501040_0266669
669 Ga0501040_0314206
670 Ga0501040_0493613
671 Ga0501041_0004489
672 Ga0501041_0006940
673 Ga0501041_0010025
674 Ga0501041_0022855
675 Ga0501041_0091028
676 Ga0501041_0296585
677 Ga0501041_0375629
678 Ga0501042_0000828
679 Ga0501042_0004651
680 Ga0501042_0026685
681 Ga0501042_0129400
682 Ga0501043_0006508
683 Ga0501046_0007522
684 Ga0501046_0012261
685 Ga0501046_0196946
686 Ga0501046_0200152
687 Ga0501046_0233221
688 Ga0501046_0285066
689 Ga0501046_0581408
690 Ga0501048_0000457
691 Ga0501048_0033551
692 Ga0501048_0070229
693 Ga0501048_0070658
694 Ga0501048_0106184
695 Ga0501048_0612938
696 Ga0501067_0038062
697 Ga0501068_0051897
698 Ga0501068_0124157
699 Ga0501068_0190372
700 Ga0501068_0404442
701 Ga0501068_0463181
702 Ga0501069_0137009
703 Ga0501070_0021522
704 Ga0501070_0511832
705 Ga0501070_0970536
706 Ga0501071_0000456
707 Ga0501071_0004702
708 Ga0501071_0107959
709 Ga0501071_0157915
710 Ga0501071_0203484
711 Ga0501071_0537879
712 Ga0501072_0001602
713 Ga0501072_0001951
714 Ga0501072_0009111
715 Ga0501072_0011674
716 Ga0501072_0241043
717 Ga0501073_0150100
718 Ga0501073_0715410
719 Ga0501074_0002370
720 Ga0501074_0035469
721 Ga0501074_0123176
722 Ga0501074_0179512
723 Ga0501074_0233345
724 Ga0501074_0382831
725 Ga0501074_0544132
726 Ga0501075_0000003
727 Ga0501075_0017229
728 Ga0501075_0026301
729 Ga0501075_0068243
730 Ga0501075_0082416
731 Ga0501075_0092002
732 Ga0501075_0245377
733 Ga0501076_0000010
734 Ga0501076_0008443
735 Ga0501076_0014040
736 Ga0501076_0025727
737 Ga0501076_0047637
738 Ga0501076_0067287
739 Ga0501076_0093472
740 Ga0501076_0202210
741 Ga0501076_0908095
742 Ga0501077_0000456
743 Ga0501077_0008419
744 Ga0501077_0049444
745 Ga0501077_0106141
746 Ga0501077_0150366
747 Ga0501077_0363543
748 Ga0501079_0000036
749 Ga0501079_0002680
750 Ga0501079_0023904
751 Ga0501079_0181610
752 Ga0501079_0214003
753 Ga0501079_0248209
754 Ga0501080_0000401
755 Ga0501080_0012051
756 Ga0501080_0218608
757 Ga0501080_0259624
758 Ga0501080_0373090
759 Ga0501081_0001211
760 Ga0501081_0009377
761 Ga0501081_0018792
762 Ga0501081_0311415
763 Ga0501083_0018014
764 Ga0501083_0079098
765 Ga0501083_0159480
766 Ga0501035_0013314
767 Ga0501035_0298314
768 Ga0501035_0391604
769 Ga0501035_0492349
770 Ga0501044_0355022
771 Ga0501045_0000013
772 Ga0501045_0004892
773 Ga0501045_0022035
774 Ga0501045_0392817
775 Ga0501045_1289023
776 nmdc:mga05p37_142007_c1
777 nmdc:mga05p37_15394_c1
778 nmdc:mga05p37_16113_c1
779 nmdc:mga05p37_16691_c1
780 nmdc:mga05p37_1680664_c1
781 nmdc:mga05p37_208353_c1
782 nmdc:mga05p37_240988_c2
783 nmdc:mga09592_107044_c1
784 nmdc:mga09592_28649_c1
785 nmdc:mga09592_764356_c1
786 nmdc:mga0qj67_101353_c1
787 nmdc:mga0qj67_1339135_c1
788 nmdc:mga0qj67_203_c1
789 nmdc:mga0qj67_75626_c1
790 nmdc:mga06r32_12265_c1
791 nmdc:mga06r32_217129_c1
792 nmdc:mga06r32_566201_c1
793 nmdc:mga06r32_61503_c1
794 nmdc:mga08y16_581168_c1
795 nmdc:mga0n895_145791_c1
796 nmdc:mga0n895_262401_c1
797 nmdc:mga0n895_267579_c1
798 nmdc:mga0rr50_324315_c1
799 nmdc:mga0a205_356433_c1
800 Ga0495612_0035134
801 Ga0500636_0068539
802 Ga0501084_0000346
803 Ga0501084_0002305
804 Ga0501084_0002351
805 Ga0501084_0004293
806 Ga0501084_0051159
807 Ga0501084_0346872
808 Ga0501084_0347227
809 Ga0590071_001155
810 Ga0590075_011688
811 Ga0587084_096719
812 Ga0587066_056803
813 Ga0587070_128001
814 Ga0587073_0129164
815 Ga0587080_056443
816 Ga0587083_0095675
817 Ga0587091_108357
818 Ga0587092_094233
819 Ga0587094_055002
820 Ga0587098_040159
821 Ga0587106_022445
822 Ga0587101_025084
823 Ga0587109_121667
824 Ga0587122_023926
825 Ga0587067_084173
826 Ga0587068_082076
827 Ga0587071_072182
828 Ga0501082_0000478
829 Ga0501082_0007464
830 Ga0501082_0014133
831 Ga0501082_0018438
832 Ga0501082_0021829
833 Ga0501082_0025238
834 Ga0501082_0169761
835 Ga0501082_0814126
836 Ga0501082_0909049
837 Ga0530510_0000008
838 Ga0530510_0013645
839 Ga0530510_0029018
840 Ga0530510_0051705
841 Ga0530510_0074049
842 Ga0530510_0121162
843 Ga0530510_0171797
844 8054109324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

38

167

0.99

PF08534

Redoxin

Redoxin

37

184

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9507 18 140
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9453 18 140
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9444 18 140
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9408 18 140
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9404 18 140
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9695 18 140 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9538 18 140 3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9468 17 88 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9445 18 140 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9355 18 140 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A379SND6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 1.005 20 81 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A147EIV2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9893 19 141 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A369W5E8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9893 18 140 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A127SI80-F1-model_v4 AhpC/TSA family 0.9882 30 124 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2D8HQ72-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9867 20 94 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454

Map