F440229

General Info

Members Datasets Scaffolds Average Seq Length
422 240 844 347

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1000003|Ga0081540_1000003187
Length 416
Sequence MGTHLPQADGWRNHADRGVLNGQASGMLDKPQDPGYPQGHTEYGWARRGTPQKMNVDSYQHDLRTAVPVAFADTPILIVPYMWIGDFVRCHTVVKLLKQRYPDRPVDVLTTSRAAPLIDYMPGVRKGVVCDLPRKRLALGQHRELAARLKAEQYGQSLVMPRTWKAALAPFLAGIPQRTGFFGEGRFGLLSDMRFGERKLPRMVDRCAALALDPGEPLPQKLPLPDLVVPTAEIAAWRQRLGLAADGRPVAVFAPGAVGPSKRWPAAYYADLARALVAQGFCIWIVGGPEEKELAAEIAGGETINVRNLAGTDLRNAIIALAAADIAVSNDSGLLHVAAALGTPAIGIFGPTSAWHWAPLNPIAATIETKSELGCRPCHRPVCRVGHHRCMRDIPVDQVLAAAQRALAPQPAGRLH

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
225 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
226 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
235 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.32
Nodule 0
Rhizoplane 8.29
Rhizosphere 75.59
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1000003 3300005983 Bacteria 233942
2 Ga0070670_100090043 3300005331 Bacteria 2637
3 Ga0068869_100121501 3300005334 Bacteria 1998
4 Ga0070680_100147585 3300005336 Bacteria 1974
5 Ga0068868_100078393 3300005338 Bacteria 2645
6 Ga0070660_100120184 3300005339 Bacteria 2096
7 Ga0070669_100141929 3300005353 Bacteria 1852
8 Ga0070675_100141148 3300005354 Bacteria 2059
9 Ga0070671_100217909 3300005355 Bacteria 1619
10 Ga0070674_100023629 3300005356 Bacteria 3981
11 Ga0070674_100094824 3300005356 Bacteria 2162
12 Ga0070667_100048952 3300005367 Bacteria 3559
13 Ga0070709_10217540 3300005434 Bacteria 1361
14 Ga0070714_100079945 3300005435 Bacteria 2843
15 Ga0070714_100107311 3300005435 Bacteria 2468
16 Ga0070713_100056460 3300005436 Bacteria 3266
17 Ga0070710_10020598 3300005437 Bacteria 3424
18 Ga0070710_10032801 3300005437 Bacteria 2816
19 Ga0070711_100025633 3300005439 Bacteria 3860
20 Ga0070711_100045359 3300005439 Bacteria 2990
21 Ga0070711_100093412 3300005439 Bacteria 2172
22 Ga0070700_100043178 3300005441 Bacteria 2772
23 Ga0070678_100170514 3300005456 Bacteria 1772
24 Ga0070679_100211790 3300005530 Bacteria 1901
25 Ga0070679_100275730 3300005530 Bacteria 1635
26 Ga0068853_100374862 3300005539 Bacteria 1328
27 Ga0068855_100054964 3300005563 Bacteria 4678
28 Ga0081455_10019307 3300005937 Bacteria 6453
29 Ga0081455_10105950 3300005937 Bacteria 2246
30 Ga0081538_10019214 3300005981 Bacteria 5090
31 Ga0081539_10037793 3300005985 Bacteria 2869
32 Ga0075365_10018107 3300006038 Bacteria 4325
33 Ga0075365_10029260 3300006038 Bacteria 3519
34 Ga0075365_10108095 3300006038 Bacteria 1910
35 Ga0075365_10131454 3300006038 Bacteria 1732
36 Ga0075363_100002166 3300006048 Bacteria 7902
37 Ga0075364_10095475 3300006051 Bacteria 1977
38 Ga0075364_10156010 3300006051 Bacteria 1540
39 Ga0075364_10229617 3300006051 Bacteria 1260
40 Ga0070715_10100045 3300006163 Bacteria 1351
41 Ga0070712_100002949 3300006175 Bacteria 10539
42 Ga0070712_100005993 3300006175 Bacteria 7520
43 Ga0075362_10031767 3300006177 Bacteria 2287
44 Ga0075362_10033154 3300006177 Bacteria 2245
45 Ga0075367_10037171 3300006178 Bacteria 2828
46 Ga0075367_10068141 3300006178 Bacteria 2134
47 Ga0075367_10210902 3300006178 Bacteria 1214
48 Ga0097621_100030592 3300006237 Bacteria 4263
49 Ga0075370_10030303 3300006353 Bacteria 3018
50 Ga0075370_10113366 3300006353 Bacteria 1575
51 Ga0075428_100070469 3300006844 Bacteria 3821
52 Ga0075428_100187392 3300006844 Bacteria 2238
53 Ga0075430_100083386 3300006846 Bacteria 2678
54 Ga0075431_100021984 3300006847 Bacteria 6522
55 Ga0075431_100027355 3300006847 Bacteria 5850
56 Ga0075434_100044201 3300006871 Bacteria 4420
57 Ga0075429_100021915 3300006880 Bacteria 5538
58 Ga0075436_100002402 3300006914 Bacteria 12912
59 Ga0075436_100238030 3300006914 Bacteria 1294
60 Ga0099795_10029786 3300007788 Bacteria 1868
61 Ga0099795_10033594 3300007788 Bacteria 1783
62 Ga0111539_10040332 3300009094 Bacteria 5622
63 Ga0111539_10282564 3300009094 Bacteria 1931
64 Ga0105245_10094493 3300009098 Bacteria 2756
65 Ga0105247_10240709 3300009101 Unclassified 1233
66 Ga0114129_10000707 3300009147 Bacteria 42108
67 Ga0114129_10013399 3300009147 Bacteria 11685
68 Ga0114129_10039470 3300009147 Bacteria 6655
69 Ga0114129_10140931 3300009147 Bacteria 3305
70 Ga0114129_10302288 3300009147 Bacteria 2132
71 Ga0105248_10032779 3300009177 Bacteria 5804
72 Ga0105248_10218615 3300009177 Bacteria 2145
73 Ga0105248_10327994 3300009177 Bacteria 1724
74 Ga0105238_10006694 3300009551 Bacteria 11497
75 Ga0105238_10030572 3300009551 Bacteria 5482
76 Ga0099796_10000883 3300010159 Bacteria 5561
77 Ga0099796_10007449 3300010159 Bacteria 2862
78 Ga0105239_10165035 3300010375 Bacteria 2476
79 Ga0105239_10563756 3300010375 Unclassified 1298
80 Ga0105246_10040244 3300011119 Bacteria 3153
81 Ga0157370_10144336 3300013104 Bacteria 2217
82 Ga0157378_10058250 3300013297 Bacteria 3445
83 Ga0157378_10081506 3300013297 Bacteria 2925
84 Ga0163162_10332849 3300013306 Bacteria 1651
85 Ga0163163_10091893 3300014325 Bacteria 3050
86 Ga0213874_10039188 3300021377 Bacteria 1410
87 Ga0213875_10000003 3300021388 Bacteria 719367
88 Ga0209564_1000468 3300025295 Bacteria 67696
89 Ga0209758_1000183 3300025297 Bacteria 140623
90 Ga0207692_10030822 3300025898 Bacteria 2562
91 Ga0207642_10016041 3300025899 Bacteria 2811
92 Ga0207685_10088845 3300025905 Bacteria 1296
93 Ga0207699_10029104 3300025906 Bacteria 3077
94 Ga0207705_10079417 3300025909 Bacteria 2389
95 Ga0207693_10001110 3300025915 Bacteria 24219
96 Ga0207693_10097275 3300025915 Bacteria 2308
97 Ga0207663_10065462 3300025916 Bacteria 2324
98 Ga0207660_10051841 3300025917 Bacteria 2919
99 Ga0207660_10101377 3300025917 Bacteria 2151
100 Ga0207657_10095268 3300025919 Bacteria 2477
101 Ga0207681_10132199 3300025923 Bacteria 1847
102 Ga0207694_10030163 3300025924 Bacteria 4141
103 Ga0207650_10098776 3300025925 Bacteria 2244
104 Ga0207700_10205393 3300025928 Bacteria 1662
105 Ga0207664_10009565 3300025929 Bacteria 6807
106 Ga0207664_10414238 3300025929 Bacteria 1200
107 Ga0207644_10226277 3300025931 Bacteria 1485
108 Ga0207704_10129347 3300025938 Bacteria 1745
109 Ga0207665_10055024 3300025939 Bacteria 2684
110 Ga0207711_10030134 3300025941 Bacteria 4576
111 Ga0207711_10051374 3300025941 Bacteria 3530
112 Ga0207658_10053724 3300025986 Bacteria 2978
113 Ga0207677_10062961 3300026023 Bacteria 2576
114 Ga0207678_10299159 3300026067 Bacteria 1383
115 Ga0207708_10004114 3300026075 Bacteria 10708
116 Ga0207641_10211048 3300026088 Bacteria 1796
117 Ga0207648_10004599 3300026089 Bacteria 14147
118 Ga0209179_1021568 3300027512 Bacteria 1258
119 Ga0209813_10033896 3300027866 Bacteria 1520
120 Ga0265328_10060626 3300031239 Bacteria 1389
121 Ga0265325_10001718 3300031241 Bacteria 15212
122 Ga0265325_10031673 3300031241 Bacteria 2828
123 Ga0265313_10015850 3300031595 Bacteria 4362
124 Ga0265342_10164147 3300031712 Bacteria 1226
125 Ga0316578_10003537 3300031728 Bacteria 7177
126 Ga0373934_0058928 3300035086 Bacteria 1528
127 Ga0373936_0000237 3300035113 Bacteria 18250
128 Ga0373936_0055030 3300035113 Bacteria 1615
129 Ga0373936_0078808 3300035113 Bacteria 1368
130 Ga0373945_0024894 3300035116 Bacteria 2076
131 Ga0373953_0004313 3300035117 Bacteria 4524
132 Ga0373954_0001934 3300035118 Bacteria 8581
133 Ga0373954_0013274 3300035118 Bacteria 3670
134 Ga0373954_0059429 3300035118 Bacteria 1802
135 Ga0373956_0012295 3300035119 Bacteria 3546
136 Ga0373960_0021298 3300035121 Bacteria 1723
137 Ga0373943_0000394 3300035170 Bacteria 18328
138 Ga0373946_0000232 3300035171 Bacteria 17447
139 Ga0373955_0000061 3300035172 Bacteria 42652
140 Ga0316574_0000478 3300035398 Bacteria 16180
141 Ga0373924_0017341 3300035410 Bacteria 2761
142 Ga0373931_0041027 3300035691 Bacteria 2430
143 Ga0373931_0113514 3300035691 Bacteria 1540
144 Ga0373935_0000031 3300035692 Bacteria 55218
145 Ga0373935_0198758 3300035692 Bacteria 1384
146 Ga0373927_0006628 3300035695 Bacteria 7887
147 Ga0373927_0027474 3300035695 Bacteria 3715
148 Ga0373927_0037863 3300035695 Bacteria 3134
149 Ga0373933_0001012 3300035724 Bacteria 17071
150 Ga0373933_0003068 3300035724 Bacteria 9321
151 Ga0373947_0039546 3300035725 Bacteria 2806
152 Ga0373947_0288897 3300035725 Bacteria 1091
153 Ga0373937_0000917 3300036401 Bacteria 24992
154 Ga0373937_0001778 3300036401 Bacteria 18113
155 Ga0373937_0053831 3300036401 Bacteria 3691
156 Ga0373937_0321281 3300036401 Bacteria 1465
157 Ga0316584_0006790 3300036712 Bacteria 7767
158 Ga0373925_0000047 3300037068 Bacteria 130221
159 Ga0373925_0231884 3300037068 Bacteria 1476
160 Ga0373925_0252926 3300037068 Bacteria 1413
161 Ga0395898_0042750 3300037466 Bacteria 4469
162 Ga0436364_0615013 3300037853 Bacteria 2894
163 Ga0436364_0832396 3300037853 Bacteria 21955
164 Ga0436364_1142144 3300037853 Bacteria 1836
165 Ga0436364_1168117 3300037853 Bacteria 1878
166 Ga0436364_1406501 3300037853 Unclassified 2930
167 Ga0436365_0342121 3300039437 Bacteria 4092
168 Ga0436365_0853172 3300039437 Bacteria 2469
169 Ga0436365_1824067 3300039437 Bacteria 3053
170 Ga0436365_1846117 3300039437 Bacteria 3051
171 Ga0436363_1504542 3300039450 Bacteria 1363
172 Ga0495592_0000323 3300046454 Bacteria 39878
173 Ga0495592_0016615 3300046454 Bacteria 5585
174 Ga0495592_0325533 3300046454 Bacteria 992
175 Ga0495603_0201724 3300046455 Bacteria 1149
176 Ga0495629_0004045 3300046459 Bacteria 11023
177 Ga0495629_0011035 3300046459 Bacteria 6565
178 Ga0495651_0000168 3300046462 Bacteria 48211
179 Ga0495653_0000027 3300046463 Bacteria 154096
180 Ga0495653_0016772 3300046463 Bacteria 5960
181 Ga0495580_0067269 3300046472 Bacteria 2507
182 Ga0495580_0111917 3300046472 Bacteria 1896
183 Ga0495582_0063962 3300046473 Bacteria 2031
184 Ga0495605_0059847 3300046474 Bacteria 1828
185 Ga0495639_0127209 3300046475 Bacteria 1218
186 Ga0495662_0001686 3300046476 Bacteria 11028
187 Ga0495664_0000021 3300046477 Bacteria 145551
188 Ga0495664_0042148 3300046477 Bacteria 2702
189 Ga0495585_0125154 3300046492 Unclassified 1357
190 Ga0495596_0070985 3300046500 Unclassified 1353
191 Ga0495607_0104981 3300046501 Bacteria 1507
192 Ga0495608_0000020 3300046511 Bacteria 169036
193 Ga0495608_0003600 3300046511 Bacteria 11116
194 Ga0495618_0000117 3300046514 Bacteria 58104
195 Ga0495618_0004717 3300046514 Bacteria 8336
196 Ga0495628_0000005 3300046516 Bacteria 420969
197 Ga0495630_0000272 3300046517 Bacteria 42046
198 Ga0495630_0113919 3300046517 Bacteria 2049
199 Ga0495644_0102374 3300046523 Bacteria 1084
200 Ga0495652_0000001 3300046529 Bacteria 1045081
201 Ga0495652_0004593 3300046529 Bacteria 13163
202 Ga0495665_0043107 3300046531 Bacteria 2400
203 Ga0495640_0000035 3300046533 Bacteria 73471
204 Ga0495640_0018973 3300046533 Bacteria 5086
205 Ga0495586_0069900 3300046535 Bacteria 1917
206 Ga0495587_0000017 3300046536 Bacteria 172923
207 Ga0495587_0010595 3300046536 Bacteria 5859
208 Ga0495645_0000014 3300046543 Bacteria 172712
209 Ga0495645_0055030 3300046543 Bacteria 2890
210 Ga0495622_0040657 3300046557 Bacteria 2164
211 Ga0495667_0000031 3300046559 Bacteria 147377
212 Ga0495667_0002184 3300046559 Bacteria 13079
213 Ga0495634_0000006 3300046642 Bacteria 172775
214 Ga0495635_0000030 3300046663 Bacteria 117651
215 Ga0495635_0007131 3300046663 Bacteria 7814
216 Ga0495588_0030733 3300046674 Bacteria 2701
217 Ga0495657_0001166 3300046675 Bacteria 23015
218 Ga0495599_0000002 3300046678 Bacteria 348168
219 Ga0495623_0000089 3300046679 Bacteria 53855
220 Ga0495623_0001753 3300046679 Bacteria 14560
221 Ga0495646_0000018 3300046680 Bacteria 121135
222 Ga0495646_0010018 3300046680 Bacteria 6025
223 Ga0495647_0034628 3300046681 Bacteria 1892
224 Ga0495647_0119569 3300046681 Unclassified 1107
225 Ga0495658_0176494 3300046683 Bacteria 1324
226 Ga0495624_0001400 3300046690 Bacteria 18808
227 Ga0495624_0034884 3300046690 Bacteria 3251
228 Ga0495600_0000048 3300046809 Bacteria 70636
229 Ga0495581_0005977 3300047315 Bacteria 7050
230 Ga0495581_0076591 3300047315 Bacteria 1935
231 Ga0495604_0000007 3300047317 Bacteria 412174
232 Ga0495604_0001751 3300047317 Bacteria 17746
233 Ga0495674_0000001 3300047319 Bacteria 778665
234 Ga0495674_0006049 3300047319 Bacteria 11620
235 Ga0495676_0186946 3300047321 Bacteria 1447
236 Ga0495680_0000308 3300047322 Bacteria 54837
237 Ga0495680_0009804 3300047322 Bacteria 8589
238 Ga0495675_0012536 3300047444 Bacteria 5336
239 Ga0495684_0000009 3300047471 Bacteria 199436
240 Ga0495684_0004059 3300047471 Bacteria 11423
241 Ga0495593_0001635 3300047673 Bacteria 13269
242 Ga0495593_0007523 3300047673 Bacteria 6368
243 Ga0495602_0000004 3300048088 Bacteria 326932
244 Ga0495602_0018460 3300048088 Bacteria 6966
245 Ga0496100_0062946 3300048903 Bacteria 2450
246 Ga0496100_0156858 3300048903 Bacteria 1628
247 Ga0496102_0010314 3300048905 Bacteria 8034
248 Ga0496102_0026588 3300048905 Bacteria 5164
249 Ga0496104_0002067 3300048907 Bacteria 17440
250 Ga0496104_0029708 3300048907 Bacteria 5072
251 Ga0496104_0167624 3300048907 Bacteria 2106
252 Ga0496104_0241716 3300048907 Bacteria 1718
253 Ga0496105_0039825 3300048908 Bacteria 3874
254 Ga0496105_0121057 3300048908 Bacteria 2158
255 Ga0496105_0407778 3300048908 Unclassified 1078
256 Ga0496107_0079316 3300048910 Bacteria 2393
257 Ga0496107_0194569 3300048910 Unclassified 1507
258 Ga0496108_0012170 3300048911 Bacteria 6996
259 Ga0496108_0030283 3300048911 Bacteria 4485
260 Ga0496108_0056484 3300048911 Bacteria 3298
261 Ga0496109_0005231 3300048912 Bacteria 10834
262 Ga0496109_0006022 3300048912 Bacteria 10188
263 Ga0496109_0055470 3300048912 Bacteria 3615
264 Ga0496109_0123147 3300048912 Bacteria 2416
265 Ga0496109_0208826 3300048912 Bacteria 1836
266 Ga0496110_0021177 3300048913 Bacteria 5498
267 Ga0496111_0041703 3300048914 Bacteria 3294
268 Ga0496111_0076439 3300048914 Bacteria 2440
269 Ga0496111_0138647 3300048914 Bacteria 1802
270 Ga0496112_0015908 3300048915 Bacteria 7030
271 Ga0496112_0053014 3300048915 Bacteria 3982
272 Ga0496112_0123013 3300048915 Bacteria 2565
273 Ga0496112_0138759 3300048915 Bacteria 2401
274 Ga0496112_0215521 3300048915 Bacteria 1876
275 Ga0496113_0000321 3300048916 Bacteria 22831
276 Ga0496113_0157417 3300048916 Bacteria 1795
277 Ga0496114_0111218 3300048917 Bacteria 2347
278 Ga0496115_0065158 3300048918 Bacteria 2942
279 Ga0496115_0318506 3300048918 Bacteria 1272
280 Ga0496119_0063585 3300048922 Bacteria 2194
281 Ga0496122_0065666 3300048925 Bacteria 2629
282 Ga0496124_0053613 3300048927 Bacteria 3417
283 Ga0496125_0000063 3300048928 Bacteria 250260
284 Ga0501031_0081653 3300049568 Bacteria 2107
285 Ga0501032_0005451 3300049569 Bacteria 9444
286 Ga0501033_0009491 3300049570 Bacteria 7493
287 Ga0501033_0033040 3300049570 Bacteria 3885
288 Ga0501034_0032536 3300049571 Bacteria 5294
289 Ga0501034_0062536 3300049571 Bacteria 3738
290 Ga0501034_0101393 3300049571 Bacteria 2872
291 Ga0501034_0163601 3300049571 Bacteria 2194
292 Ga0501034_0209847 3300049571 Bacteria 1903
293 Ga0501036_0003505 3300049572 Bacteria 12546
294 Ga0501036_0047124 3300049572 Bacteria 3650
295 Ga0501037_0001074 3300049573 Bacteria 20271
296 Ga0501037_0025271 3300049573 Bacteria 4388
297 Ga0501037_0175168 3300049573 Bacteria 1523
298 Ga0501038_0012201 3300049574 Bacteria 7845
299 Ga0501038_0054759 3300049574 Bacteria 3429
300 Ga0501038_0119023 3300049574 Bacteria 2180
301 Ga0501038_0131374 3300049574 Bacteria 2056
302 Ga0501038_0147060 3300049574 Bacteria 1923
303 Ga0501039_0088553 3300049575 Bacteria 2411
304 Ga0501039_0178609 3300049575 Bacteria 1669
305 Ga0501040_0081195 3300049576 Bacteria 2247
306 Ga0501043_0033656 3300049579 Bacteria 4032
307 Ga0501043_0112042 3300049579 Bacteria 2142
308 Ga0501046_0007498 3300049580 Bacteria 9572
309 Ga0501046_0008284 3300049580 Bacteria 9076
310 Ga0501046_0061167 3300049580 Bacteria 2945
311 Ga0501046_0065530 3300049580 Bacteria 2833
312 Ga0501047_0000901 3300049581 Bacteria 30317
313 Ga0501047_0046029 3300049581 Bacteria 4217
314 Ga0501047_0079177 3300049581 Bacteria 3160
315 Ga0501047_0104122 3300049581 Bacteria 2718
316 Ga0501047_0148033 3300049581 Bacteria 2225
317 Ga0501048_0001201 3300049582 Bacteria 19594
318 Ga0501048_0087540 3300049582 Bacteria 2197
319 Ga0501069_0019139 3300049585 Bacteria 3698
320 Ga0501070_0008691 3300049586 Bacteria 8585
321 Ga0501070_0018943 3300049586 Bacteria 5773
322 Ga0501070_0079290 3300049586 Bacteria 2717
323 Ga0501070_0098420 3300049586 Bacteria 2419
324 Ga0501070_0103268 3300049586 Bacteria 2357
325 Ga0501070_0405109 3300049586 Bacteria 1103
326 Ga0501071_0044885 3300049587 Bacteria 3171
327 Ga0501071_0210108 3300049587 Bacteria 1463
328 Ga0501072_0013237 3300049588 Bacteria 6318
329 Ga0501072_0106170 3300049588 Bacteria 2234
330 Ga0501073_0030215 3300049589 Bacteria 3869
331 Ga0501073_0046709 3300049589 Bacteria 3044
332 Ga0501073_0167203 3300049589 Bacteria 1523
333 Ga0501074_0004837 3300049590 Bacteria 9653
334 Ga0501074_0030805 3300049590 Bacteria 3886
335 Ga0501074_0051152 3300049590 Bacteria 2982
336 Ga0501074_0060503 3300049590 Bacteria 2729
337 Ga0501074_0068086 3300049590 Bacteria 2559
338 Ga0501075_0085458 3300049591 Bacteria 2390
339 Ga0501076_0013496 3300049592 Bacteria 6127
340 Ga0501076_0224795 3300049592 Bacteria 1534
341 Ga0501077_0008569 3300049593 Bacteria 6337
342 Ga0501077_0050596 3300049593 Bacteria 2641
343 Ga0501079_0003685 3300049741 Bacteria 11294
344 Ga0501079_0112769 3300049741 Bacteria 2113
345 Ga0501079_0247085 3300049741 Bacteria 1394
346 Ga0501079_0289080 3300049741 Bacteria 1282
347 Ga0501080_0014774 3300049742 Bacteria 7191
348 Ga0501080_0041516 3300049742 Bacteria 4286
349 Ga0501080_0049335 3300049742 Bacteria 3918
350 Ga0501080_0073560 3300049742 Bacteria 3179
351 Ga0501080_0081550 3300049742 Bacteria 3005
352 Ga0501080_0132795 3300049742 Bacteria 2305
353 Ga0501080_0266077 3300049742 Bacteria 1561
354 Ga0501081_0002709 3300049743 Bacteria 11210
355 Ga0501081_0236202 3300049743 Bacteria 1332
356 Ga0501083_0001378 3300049744 Bacteria 16511
357 Ga0501035_0106545 3300049822 Bacteria 2457
358 Ga0501035_0181800 3300049822 Bacteria 1811
359 Ga0501044_0001046 3300049823 Bacteria 33251
360 Ga0501044_0074413 3300049823 Bacteria 3451
361 Ga0501044_0165801 3300049823 Bacteria 2183
362 Ga0501044_0182053 3300049823 Bacteria 2067
363 Ga0501044_0416838 3300049823 Bacteria 1253
364 Ga0501045_0004051 3300049824 Bacteria 10109
365 nmdc:mga03683_89466_c1 3300050489 Bacteria 1341
366 nmdc:mga03n38_2427_c1 3300050490 Bacteria 5755
367 nmdc:mga00v17_34736_c1 3300050491 Bacteria 2997
368 nmdc:mga0yw44_100276_c1 3300050492 Bacteria 1844
369 nmdc:mga0yw44_113323_c1 3300050492 Bacteria 1740
370 nmdc:mga0yw44_42029_c1 3300050492 Bacteria 2724
371 nmdc:mga0yw44_52442_c1 3300050492 Bacteria 2473
372 nmdc:mga0yw44_7165_c1 3300050492 Bacteria 5461
373 nmdc:mga0k408_49448_c1 3300050493 Bacteria 2433
374 nmdc:mga06z11_166606_c1 3300050494 Bacteria 1263
375 nmdc:mga06z11_258086_c1 3300050494 Bacteria 1028
376 nmdc:mga06z11_28066_c1 3300050494 Bacteria 2697
377 nmdc:mga04h51_55083_c1 3300050495 Bacteria 1346
378 nmdc:mga07m45_39017_c2 3300050496 Bacteria 2252
379 nmdc:mga07m45_79255_c1 3300050496 Bacteria 1875
380 nmdc:mga05p37_12319_c1 3300050507 Bacteria 6492
381 nmdc:mga05p37_21062_c1 3300050507 Bacteria 7892
382 nmdc:mga0qj67_127082_c1 3300050509 Unclassified 1450
383 nmdc:mga06r32_456933_c1 3300050510 Bacteria 1256
384 nmdc:mga06r32_7884_c1 3300050510 Bacteria 9569
385 nmdc:mga08y16_200259_c1 3300050511 Bacteria 2069
386 nmdc:mga08y16_27552_c2 3300050511 Bacteria 3995
387 nmdc:mga0n895_18648_c1 3300050512 Bacteria 6426
388 nmdc:mga0n895_79563_c1 3300050512 Bacteria 3264
389 Ga0495601_0000020 3300053077 Bacteria 160011
390 Ga0495601_0021467 3300053077 Bacteria 3954
391 Ga0495612_0000020 3300053078 Bacteria 137759
392 Ga0495595_0000047 3300053084 Bacteria 62097
393 Ga0495595_0002838 3300053084 Bacteria 6817
394 Ga0495619_0000011 3300053085 Bacteria 287128
395 Ga0495619_0000666 3300053085 Bacteria 22530
396 Ga0495619_0013125 3300053085 Bacteria 5221
397 Ga0495619_0031029 3300053085 Bacteria 3461
398 Ga0500566_0000153 3300053094 Bacteria 35620
399 Ga0500640_007920 3300053095 Bacteria 4170
400 Ga0500572_000037 3300053111 Bacteria 42272
401 Ga0500572_003966 3300053111 Bacteria 3362
402 Ga0500591_016088 3300053115 Bacteria 3603
403 Ga0500595_004348 3300053119 Bacteria 6374
404 Ga0500614_001350 3300053123 Bacteria 5906
405 Ga0500652_000006 3300053131 Bacteria 167437
406 Ga0500559_0001249 3300053136 Bacteria 14963
407 Ga0500559_0009672 3300053136 Bacteria 4163
408 Ga0500568_0023577 3300053139 Bacteria 2617
409 Ga0500568_0028847 3300053139 Bacteria 2310
410 Ga0500603_002170 3300053150 Bacteria 4333
411 Ga0500616_0112333 3300053153 Bacteria 1314
412 Ga0500630_046362 3300053159 Bacteria 2109
413 Ga0500639_029738 3300053163 Bacteria 2886
414 Ga0500639_029795 3300053163 Bacteria 2884
415 Ga0500636_0012290 3300053177 Bacteria 5016
416 Ga0500596_000261 3300053735 Bacteria 9281
417 Ga0501084_0009129 3300054114 Bacteria 8203
418 Ga0501082_0000007 3300060353 Bacteria 126506
419 Ga0501082_0025183 3300060353 Bacteria 5127
420 Ga0501082_0063766 3300060353 Bacteria 3172
421 Ga0530510_0091932 3300061734 Bacteria 2214
422 Ga0530510_0304390 3300061734 Bacteria 1193
423 Ga0081540_1000003
424 Ga0070670_100090043
425 Ga0068869_100121501
426 Ga0070680_100147585
427 Ga0068868_100078393
428 Ga0070660_100120184
429 Ga0070669_100141929
430 Ga0070675_100141148
431 Ga0070671_100217909
432 Ga0070674_100023629
433 Ga0070674_100094824
434 Ga0070667_100048952
435 Ga0070709_10217540
436 Ga0070714_100079945
437 Ga0070714_100107311
438 Ga0070713_100056460
439 Ga0070710_10020598
440 Ga0070710_10032801
441 Ga0070711_100025633
442 Ga0070711_100045359
443 Ga0070711_100093412
444 Ga0070700_100043178
445 Ga0070678_100170514
446 Ga0070679_100211790
447 Ga0070679_100275730
448 Ga0068853_100374862
449 Ga0068855_100054964
450 Ga0081455_10019307
451 Ga0081455_10105950
452 Ga0081538_10019214
453 Ga0081539_10037793
454 Ga0075365_10018107
455 Ga0075365_10029260
456 Ga0075365_10108095
457 Ga0075365_10131454
458 Ga0075363_100002166
459 Ga0075364_10095475
460 Ga0075364_10156010
461 Ga0075364_10229617
462 Ga0070715_10100045
463 Ga0070712_100002949
464 Ga0070712_100005993
465 Ga0075362_10031767
466 Ga0075362_10033154
467 Ga0075367_10037171
468 Ga0075367_10068141
469 Ga0075367_10210902
470 Ga0097621_100030592
471 Ga0075370_10030303
472 Ga0075370_10113366
473 Ga0075428_100070469
474 Ga0075428_100187392
475 Ga0075430_100083386
476 Ga0075431_100021984
477 Ga0075431_100027355
478 Ga0075434_100044201
479 Ga0075429_100021915
480 Ga0075436_100002402
481 Ga0075436_100238030
482 Ga0099795_10029786
483 Ga0099795_10033594
484 Ga0111539_10040332
485 Ga0111539_10282564
486 Ga0105245_10094493
487 Ga0105247_10240709
488 Ga0114129_10000707
489 Ga0114129_10013399
490 Ga0114129_10039470
491 Ga0114129_10140931
492 Ga0114129_10302288
493 Ga0105248_10032779
494 Ga0105248_10218615
495 Ga0105248_10327994
496 Ga0105238_10006694
497 Ga0105238_10030572
498 Ga0099796_10000883
499 Ga0099796_10007449
500 Ga0105239_10165035
501 Ga0105239_10563756
502 Ga0105246_10040244
503 Ga0157370_10144336
504 Ga0157378_10058250
505 Ga0157378_10081506
506 Ga0163162_10332849
507 Ga0163163_10091893
508 Ga0213874_10039188
509 Ga0213875_10000003
510 Ga0209564_1000468
511 Ga0209758_1000183
512 Ga0207692_10030822
513 Ga0207642_10016041
514 Ga0207685_10088845
515 Ga0207699_10029104
516 Ga0207705_10079417
517 Ga0207693_10001110
518 Ga0207693_10097275
519 Ga0207663_10065462
520 Ga0207660_10051841
521 Ga0207660_10101377
522 Ga0207657_10095268
523 Ga0207681_10132199
524 Ga0207694_10030163
525 Ga0207650_10098776
526 Ga0207700_10205393
527 Ga0207664_10009565
528 Ga0207664_10414238
529 Ga0207644_10226277
530 Ga0207704_10129347
531 Ga0207665_10055024
532 Ga0207711_10030134
533 Ga0207711_10051374
534 Ga0207658_10053724
535 Ga0207677_10062961
536 Ga0207678_10299159
537 Ga0207708_10004114
538 Ga0207641_10211048
539 Ga0207648_10004599
540 Ga0209179_1021568
541 Ga0209813_10033896
542 Ga0265328_10060626
543 Ga0265325_10001718
544 Ga0265325_10031673
545 Ga0265313_10015850
546 Ga0265342_10164147
547 Ga0316578_10003537
548 Ga0373934_0058928
549 Ga0373936_0000237
550 Ga0373936_0055030
551 Ga0373936_0078808
552 Ga0373945_0024894
553 Ga0373953_0004313
554 Ga0373954_0001934
555 Ga0373954_0013274
556 Ga0373954_0059429
557 Ga0373956_0012295
558 Ga0373960_0021298
559 Ga0373943_0000394
560 Ga0373946_0000232
561 Ga0373955_0000061
562 Ga0316574_0000478
563 Ga0373924_0017341
564 Ga0373931_0041027
565 Ga0373931_0113514
566 Ga0373935_0000031
567 Ga0373935_0198758
568 Ga0373927_0006628
569 Ga0373927_0027474
570 Ga0373927_0037863
571 Ga0373933_0001012
572 Ga0373933_0003068
573 Ga0373947_0039546
574 Ga0373947_0288897
575 Ga0373937_0000917
576 Ga0373937_0001778
577 Ga0373937_0053831
578 Ga0373937_0321281
579 Ga0316584_0006790
580 Ga0373925_0000047
581 Ga0373925_0231884
582 Ga0373925_0252926
583 Ga0395898_0042750
584 Ga0436364_0615013
585 Ga0436364_0832396
586 Ga0436364_1142144
587 Ga0436364_1168117
588 Ga0436364_1406501
589 Ga0436365_0342121
590 Ga0436365_0853172
591 Ga0436365_1824067
592 Ga0436365_1846117
593 Ga0436363_1504542
594 Ga0495592_0000323
595 Ga0495592_0016615
596 Ga0495592_0325533
597 Ga0495603_0201724
598 Ga0495629_0004045
599 Ga0495629_0011035
600 Ga0495651_0000168
601 Ga0495653_0000027
602 Ga0495653_0016772
603 Ga0495580_0067269
604 Ga0495580_0111917
605 Ga0495582_0063962
606 Ga0495605_0059847
607 Ga0495639_0127209
608 Ga0495662_0001686
609 Ga0495664_0000021
610 Ga0495664_0042148
611 Ga0495585_0125154
612 Ga0495596_0070985
613 Ga0495607_0104981
614 Ga0495608_0000020
615 Ga0495608_0003600
616 Ga0495618_0000117
617 Ga0495618_0004717
618 Ga0495628_0000005
619 Ga0495630_0000272
620 Ga0495630_0113919
621 Ga0495644_0102374
622 Ga0495652_0000001
623 Ga0495652_0004593
624 Ga0495665_0043107
625 Ga0495640_0000035
626 Ga0495640_0018973
627 Ga0495586_0069900
628 Ga0495587_0000017
629 Ga0495587_0010595
630 Ga0495645_0000014
631 Ga0495645_0055030
632 Ga0495622_0040657
633 Ga0495667_0000031
634 Ga0495667_0002184
635 Ga0495634_0000006
636 Ga0495635_0000030
637 Ga0495635_0007131
638 Ga0495588_0030733
639 Ga0495657_0001166
640 Ga0495599_0000002
641 Ga0495623_0000089
642 Ga0495623_0001753
643 Ga0495646_0000018
644 Ga0495646_0010018
645 Ga0495647_0034628
646 Ga0495647_0119569
647 Ga0495658_0176494
648 Ga0495624_0001400
649 Ga0495624_0034884
650 Ga0495600_0000048
651 Ga0495581_0005977
652 Ga0495581_0076591
653 Ga0495604_0000007
654 Ga0495604_0001751
655 Ga0495674_0000001
656 Ga0495674_0006049
657 Ga0495676_0186946
658 Ga0495680_0000308
659 Ga0495680_0009804
660 Ga0495675_0012536
661 Ga0495684_0000009
662 Ga0495684_0004059
663 Ga0495593_0001635
664 Ga0495593_0007523
665 Ga0495602_0000004
666 Ga0495602_0018460
667 Ga0496100_0062946
668 Ga0496100_0156858
669 Ga0496102_0010314
670 Ga0496102_0026588
671 Ga0496104_0002067
672 Ga0496104_0029708
673 Ga0496104_0167624
674 Ga0496104_0241716
675 Ga0496105_0039825
676 Ga0496105_0121057
677 Ga0496105_0407778
678 Ga0496107_0079316
679 Ga0496107_0194569
680 Ga0496108_0012170
681 Ga0496108_0030283
682 Ga0496108_0056484
683 Ga0496109_0005231
684 Ga0496109_0006022
685 Ga0496109_0055470
686 Ga0496109_0123147
687 Ga0496109_0208826
688 Ga0496110_0021177
689 Ga0496111_0041703
690 Ga0496111_0076439
691 Ga0496111_0138647
692 Ga0496112_0015908
693 Ga0496112_0053014
694 Ga0496112_0123013
695 Ga0496112_0138759
696 Ga0496112_0215521
697 Ga0496113_0000321
698 Ga0496113_0157417
699 Ga0496114_0111218
700 Ga0496115_0065158
701 Ga0496115_0318506
702 Ga0496119_0063585
703 Ga0496122_0065666
704 Ga0496124_0053613
705 Ga0496125_0000063
706 Ga0501031_0081653
707 Ga0501032_0005451
708 Ga0501033_0009491
709 Ga0501033_0033040
710 Ga0501034_0032536
711 Ga0501034_0062536
712 Ga0501034_0101393
713 Ga0501034_0163601
714 Ga0501034_0209847
715 Ga0501036_0003505
716 Ga0501036_0047124
717 Ga0501037_0001074
718 Ga0501037_0025271
719 Ga0501037_0175168
720 Ga0501038_0012201
721 Ga0501038_0054759
722 Ga0501038_0119023
723 Ga0501038_0131374
724 Ga0501038_0147060
725 Ga0501039_0088553
726 Ga0501039_0178609
727 Ga0501040_0081195
728 Ga0501043_0033656
729 Ga0501043_0112042
730 Ga0501046_0007498
731 Ga0501046_0008284
732 Ga0501046_0061167
733 Ga0501046_0065530
734 Ga0501047_0000901
735 Ga0501047_0046029
736 Ga0501047_0079177
737 Ga0501047_0104122
738 Ga0501047_0148033
739 Ga0501048_0001201
740 Ga0501048_0087540
741 Ga0501069_0019139
742 Ga0501070_0008691
743 Ga0501070_0018943
744 Ga0501070_0079290
745 Ga0501070_0098420
746 Ga0501070_0103268
747 Ga0501070_0405109
748 Ga0501071_0044885
749 Ga0501071_0210108
750 Ga0501072_0013237
751 Ga0501072_0106170
752 Ga0501073_0030215
753 Ga0501073_0046709
754 Ga0501073_0167203
755 Ga0501074_0004837
756 Ga0501074_0030805
757 Ga0501074_0051152
758 Ga0501074_0060503
759 Ga0501074_0068086
760 Ga0501075_0085458
761 Ga0501076_0013496
762 Ga0501076_0224795
763 Ga0501077_0008569
764 Ga0501077_0050596
765 Ga0501079_0003685
766 Ga0501079_0112769
767 Ga0501079_0247085
768 Ga0501079_0289080
769 Ga0501080_0014774
770 Ga0501080_0041516
771 Ga0501080_0049335
772 Ga0501080_0073560
773 Ga0501080_0081550
774 Ga0501080_0132795
775 Ga0501080_0266077
776 Ga0501081_0002709
777 Ga0501081_0236202
778 Ga0501083_0001378
779 Ga0501035_0106545
780 Ga0501035_0181800
781 Ga0501044_0001046
782 Ga0501044_0074413
783 Ga0501044_0165801
784 Ga0501044_0182053
785 Ga0501044_0416838
786 Ga0501045_0004051
787 nmdc:mga03683_89466_c1
788 nmdc:mga03n38_2427_c1
789 nmdc:mga00v17_34736_c1
790 nmdc:mga0yw44_100276_c1
791 nmdc:mga0yw44_113323_c1
792 nmdc:mga0yw44_42029_c1
793 nmdc:mga0yw44_52442_c1
794 nmdc:mga0yw44_7165_c1
795 nmdc:mga0k408_49448_c1
796 nmdc:mga06z11_166606_c1
797 nmdc:mga06z11_258086_c1
798 nmdc:mga06z11_28066_c1
799 nmdc:mga04h51_55083_c1
800 nmdc:mga07m45_39017_c2
801 nmdc:mga07m45_79255_c1
802 nmdc:mga05p37_12319_c1
803 nmdc:mga05p37_21062_c1
804 nmdc:mga0qj67_127082_c1
805 nmdc:mga06r32_456933_c1
806 nmdc:mga06r32_7884_c1
807 nmdc:mga08y16_200259_c1
808 nmdc:mga08y16_27552_c2
809 nmdc:mga0n895_18648_c1
810 nmdc:mga0n895_79563_c1
811 Ga0495601_0000020
812 Ga0495601_0021467
813 Ga0495612_0000020
814 Ga0495595_0000047
815 Ga0495595_0002838
816 Ga0495619_0000011
817 Ga0495619_0000666
818 Ga0495619_0013125
819 Ga0495619_0031029
820 Ga0500566_0000153
821 Ga0500640_007920
822 Ga0500572_000037
823 Ga0500572_003966
824 Ga0500591_016088
825 Ga0500595_004348
826 Ga0500614_001350
827 Ga0500652_000006
828 Ga0500559_0001249
829 Ga0500559_0009672
830 Ga0500568_0023577
831 Ga0500568_0028847
832 Ga0500603_002170
833 Ga0500616_0112333
834 Ga0500630_046362
835 Ga0500639_029738
836 Ga0500639_029795
837 Ga0500636_0012290
838 Ga0500596_000261
839 Ga0501084_0009129
840 Ga0501082_0000007
841 Ga0501082_0025183
842 Ga0501082_0063766
843 Ga0530510_0091932
844 Ga0530510_0304390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

142

388

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1psw-assembly1.cif.gz_A structure of e. coli adp-heptose lps heptosyltransferase ii 0.8414 4 329
3tov-assembly1.cif.gz_A the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8352 1 329
1psw-assembly1.cif.gz_A structure of e. coli adp-heptose lps heptosyltransferase ii 0.8268 4 329
3tov-assembly1.cif.gz_A the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8015 1 329
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7926 1 329
ID Description Score Start End Superfamily
af_P37692_2_151_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8943 6 136 3.40.50.2000
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8597 169 329 3.40.50.2000
1pswA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8508 151 329 3.40.50.2000
1pswA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8278 151 329 3.40.50.2000
3tovB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8148 152 329 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A833GGH4-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9454 4 192 GO:0005829
GO:0008713
GO:0009244
AF-A0A257N6K0-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9199 4 109 GO:0005829
GO:0008713
GO:0009244
AF-A0A1W9IH44-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9167 4 334 GO:0005829
GO:0008713
GO:0009244
AF-B3QJ49-F1-model_v4 deleted 0.9162 4 331
AF-A0A447CPW0-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9158 37 332 GO:0005829
GO:0008713
GO:0009244

Map