F440249

General Info

Members Datasets Scaffolds Average Seq Length
422 178 422 560

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10017521|Ga0111539_100175212
Length 604
Sequence MTGLEIFTDIQSFRRVPALKALAPAAVMAFMLVAWTSMVIAQNKPLDPAQGKPFVPVTDEMLWKPNPADWLTWRRTLDSWGFSPLNQINKSNVAQMKMAWTRGMGPGNVQEATPLIYNGVMYLPNPSDLVQALDARTGDLLWQYQRKLPTDLGKFMPVFAINRNLAIYGDKIIDTSADDYVFALDAKTGALAWETKILDYQKGAQQTSGPIIANGKIISGRGCEPEGGPDACVITAHDAVTGKEIWRTRTIPKPGEPGYETWGNVPEEKRIHVGTWMVPSYDPQLNMVYIGTSVTSPAPKYMLAGNDKRYLYHNSTLALNADTGKIEWYYQHLVDHWDLDHPFERLLLETAVAPDPKQVAWINPKIKPGEKRRVITGIPGKTGIVYTLDRRTGEFLWARPTVQQNVISKIDGATGAVTGNPDVLFSAKGQEKLICPSVNGGKNWPAGAYSPQTNAMYYPLQNMCMKVTTQEPDASLYAVNMQPELAAGTDKVGTVFAISAETGRTLWKYEQRAGILSLVATGGGLILVGDAVGHFRALDDASGRVLFDVNLGSPVSGYPITFAVNGKQYVAVSTGPSLVAGGVGRLTPELKPGSANQMFVFALP

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 2.37
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004889 3300001977 Unclassified 2101
2 JGI25406J46586_10000393 3300003203 Bacteria 20038
3 JGI25406J46586_10002342 3300003203 Bacteria 8949
4 Ga0065712_10000378 3300005290 Bacteria 12537
5 Ga0065712_10002792 3300005290 Bacteria 4460
6 Ga0065712_10007244 3300005290 Bacteria 2884
7 Ga0065712_10103415 3300005290 Bacteria 1983
8 Ga0065715_10108547 3300005293 Bacteria 2713
9 Ga0065715_10135307 3300005293 Bacteria 1927
10 Ga0070658_10022095 3300005327 Bacteria 5104
11 Ga0070676_10017603 3300005328 Bacteria 3954
12 Ga0070676_10018175 3300005328 Bacteria 3893
13 Ga0070690_100003639 3300005330 Bacteria 8482
14 Ga0070690_100022240 3300005330 Bacteria 3878
15 Ga0070670_100010669 3300005331 Bacteria 7848
16 Ga0068869_100009749 3300005334 Bacteria 6237
17 Ga0068869_100012485 3300005334 Bacteria 5616
18 Ga0068869_100021711 3300005334 Bacteria 4418
19 Ga0068869_100024956 3300005334 Bacteria 4146
20 Ga0068869_100049122 3300005334 Bacteria 3053
21 Ga0070666_10030156 3300005335 Bacteria 3571
22 Ga0070682_100023253 3300005337 Bacteria 3679
23 Ga0070682_100047649 3300005337 Bacteria 2665
24 Ga0068868_100015352 3300005338 Bacteria 5663
25 Ga0068868_100027264 3300005338 Bacteria 4359
26 Ga0068868_100033474 3300005338 Bacteria 3961
27 Ga0068868_100035239 3300005338 Bacteria 3868
28 Ga0070689_100031724 3300005340 Bacteria 4016
29 Ga0070689_100110382 3300005340 Bacteria 2187
30 Ga0070687_100009547 3300005343 Bacteria 4163
31 Ga0070668_100131818 3300005347 Bacteria 2007
32 Ga0070669_100002774 3300005353 Bacteria 12639
33 Ga0070669_100005111 3300005353 Bacteria 9488
34 Ga0070669_100012855 3300005353 Bacteria 5945
35 Ga0070669_100027658 3300005353 Bacteria 4082
36 Ga0070669_100055898 3300005353 Unclassified 2892
37 Ga0070675_100003977 3300005354 Bacteria 11210
38 Ga0070675_100007116 3300005354 Bacteria 8615
39 Ga0070675_100013835 3300005354 Bacteria 6353
40 Ga0070675_100018573 3300005354 Bacteria 5536
41 Ga0070675_100030724 3300005354 Bacteria 4338
42 Ga0070671_100083270 3300005355 Unclassified 2675
43 Ga0070674_100000561 3300005356 Bacteria 18680
44 Ga0070674_100001192 3300005356 Bacteria 13654
45 Ga0070674_100021841 3300005356 Bacteria 4118
46 Ga0070674_100030425 3300005356 Bacteria 3567
47 Ga0070673_100014093 3300005364 Bacteria 5554
48 Ga0070673_100023022 3300005364 Bacteria 4545
49 Ga0070673_100026976 3300005364 Bacteria 4252
50 Ga0070673_100044916 3300005364 Unclassified 3423
51 Ga0070673_100054403 3300005364 Bacteria 3148
52 Ga0070673_100055252 3300005364 Bacteria 3128
53 Ga0070688_100007832 3300005365 Bacteria 5775
54 Ga0070688_100037447 3300005365 Bacteria 2956
55 Ga0070667_100089028 3300005367 Bacteria 2651
56 Ga0070709_10008166 3300005434 Bacteria 5747
57 Ga0070701_10002227 3300005438 Bacteria 7414
58 Ga0070701_10023264 3300005438 Bacteria 2982
59 Ga0070700_100002614 3300005441 Bacteria 9206
60 Ga0070700_100014827 3300005441 Bacteria 4404
61 Ga0070694_100029158 3300005444 Bacteria 3599
62 Ga0070694_100033505 3300005444 Bacteria 3381
63 Ga0070694_100109788 3300005444 Bacteria 1964
64 Ga0070708_100166870 3300005445 Bacteria 2054
65 Ga0070678_100114609 3300005456 Bacteria 2115
66 Ga0070678_100149000 3300005456 Bacteria 1882
67 Ga0070662_100047596 3300005457 Bacteria 3085
68 Ga0070662_100111738 3300005457 Bacteria 2082
69 Ga0068867_100001665 3300005459 Bacteria 15488
70 Ga0068867_100004975 3300005459 Bacteria 9363
71 Ga0068867_100019390 3300005459 Bacteria 4847
72 Ga0068867_100020353 3300005459 Bacteria 4728
73 Ga0068867_100027957 3300005459 Bacteria 4058
74 Ga0068867_100085343 3300005459 Unclassified 2387
75 Ga0070685_10001943 3300005466 Bacteria 10736
76 Ga0070685_10016202 3300005466 Bacteria 3968
77 Ga0070685_10021117 3300005466 Bacteria 3535
78 Ga0070684_100099409 3300005535 Bacteria 2597
79 Ga0070672_100004887 3300005543 Bacteria 8814
80 Ga0070672_100008743 3300005543 Bacteria 6951
81 Ga0070672_100025925 3300005543 Bacteria 4355
82 Ga0070672_100053238 3300005543 Unclassified 3164
83 Ga0070686_100009347 3300005544 Bacteria 5508
84 Ga0070686_100014828 3300005544 Bacteria 4499
85 Ga0070686_100015962 3300005544 Bacteria 4361
86 Ga0070686_100079209 3300005544 Bacteria 2171
87 Ga0070695_100087116 3300005545 Bacteria 2077
88 Ga0070696_100070456 3300005546 Bacteria 2459
89 Ga0070665_100086023 3300005548 Bacteria 3150
90 Ga0070665_100089298 3300005548 Bacteria 3088
91 Ga0070704_100014273 3300005549 Bacteria 4959
92 Ga0070704_100141113 3300005549 Bacteria 1881
93 Ga0070664_100014829 3300005564 Bacteria 6362
94 Ga0070664_100030635 3300005564 Bacteria 4490
95 Ga0070664_100097382 3300005564 Bacteria 2554
96 Ga0068857_100003848 3300005577 Bacteria 12629
97 Ga0068857_100163802 3300005577 Bacteria 2018
98 Ga0070702_100023782 3300005615 Bacteria 3260
99 Ga0070702_100035701 3300005615 Bacteria 2748
100 Ga0068859_100004353 3300005617 Bacteria 14451
101 Ga0068859_100030208 3300005617 Bacteria 5437
102 Ga0068859_100079909 3300005617 Bacteria 3311
103 Ga0068859_100120652 3300005617 Bacteria 2689
104 Ga0068859_100136974 3300005617 Bacteria 2521
105 Ga0068859_100198051 3300005617 Bacteria 2093
106 Ga0068864_100028152 3300005618 Bacteria 4748
107 Ga0068864_100063538 3300005618 Bacteria 3199
108 Ga0068866_10003094 3300005718 Bacteria 6858
109 Ga0068861_100008246 3300005719 Bacteria 7169
110 Ga0068861_100027913 3300005719 Bacteria 4116
111 Ga0068861_100037332 3300005719 Bacteria 3612
112 Ga0068861_100117844 3300005719 Bacteria 2138
113 Ga0068861_100117914 3300005719 Bacteria 2137
114 Ga0068870_10001328 3300005840 Bacteria 9957
115 Ga0068870_10019041 3300005840 Bacteria 3325
116 Ga0068863_100000973 3300005841 Bacteria 28792
117 Ga0068863_100006940 3300005841 Bacteria 11103
118 Ga0068863_100025314 3300005841 Bacteria 5657
119 Ga0068863_100104509 3300005841 Bacteria 2694
120 Ga0068863_100122660 3300005841 Bacteria 2479
121 Ga0068858_100008883 3300005842 Bacteria 9633
122 Ga0068858_100030634 3300005842 Bacteria 4996
123 Ga0068858_100031601 3300005842 Bacteria 4918
124 Ga0068858_100036060 3300005842 Bacteria 4586
125 Ga0068858_100095389 3300005842 Bacteria 2772
126 Ga0068860_100076590 3300005843 Bacteria 3181
127 Ga0068860_100205082 3300005843 Bacteria 1912
128 Ga0068862_100024613 3300005844 Bacteria 5053
129 Ga0068862_100092734 3300005844 Bacteria 2633
130 Ga0081455_10099819 3300005937 Bacteria 2334
131 Ga0081539_10000047 3300005985 Bacteria 275235
132 Ga0081539_10001878 3300005985 Bacteria 32925
133 Ga0081539_10005549 3300005985 Bacteria 12785
134 Ga0081539_10008461 3300005985 Bacteria 8951
135 Ga0081539_10025952 3300005985 Bacteria 3754
136 Ga0097621_100011182 3300006237 Bacteria 6606
137 Ga0097621_100030097 3300006237 Bacteria 4295
138 Ga0097621_100033488 3300006237 Bacteria 4092
139 Ga0068871_100045758 3300006358 Bacteria 3523
140 Ga0075428_100002991 3300006844 Bacteria 18429
141 Ga0075428_100003502 3300006844 Bacteria 17192
142 Ga0075428_100004145 3300006844 Bacteria 15957
143 Ga0075428_100050210 3300006844 Bacteria 4576
144 Ga0075428_100118476 3300006844 Bacteria 2883
145 Ga0075430_100019357 3300006846 Bacteria 5788
146 Ga0075430_100039899 3300006846 Bacteria 3974
147 Ga0075430_100045881 3300006846 Bacteria 3691
148 Ga0075430_100089096 3300006846 Unclassified 2582
149 Ga0075430_100090639 3300006846 Bacteria 2557
150 Ga0075431_100000792 3300006847 Bacteria 27592
151 Ga0075431_100024848 3300006847 Bacteria 6143
152 Ga0075431_100027436 3300006847 Bacteria 5842
153 Ga0075433_10007983 3300006852 Bacteria 8425
154 Ga0075434_100000984 3300006871 Bacteria 23029
155 Ga0075434_100067139 3300006871 Bacteria 3573
156 Ga0075434_100131076 3300006871 Bacteria 2526
157 Ga0075429_100000997 3300006880 Bacteria 22515
158 Ga0075429_100058141 3300006880 Bacteria 3367
159 Ga0075429_100061234 3300006880 Bacteria 3279
160 Ga0068865_100005703 3300006881 Bacteria 7564
161 Ga0068865_100024432 3300006881 Bacteria 3965
162 Ga0068865_100025894 3300006881 Bacteria 3864
163 Ga0097620_100004352 3300006931 Bacteria 14451
164 Ga0097620_100030207 3300006931 Bacteria 5437
165 Ga0097620_100079909 3300006931 Bacteria 3311
166 Ga0097620_100120648 3300006931 Bacteria 2689
167 Ga0097620_100136965 3300006931 Bacteria 2521
168 Ga0097620_100198057 3300006931 Bacteria 2093
169 Ga0075435_100013886 3300007076 Bacteria 6006
170 Ga0105240_10094101 3300009093 Bacteria 3656
171 Ga0111539_10001820 3300009094 Bacteria 28388
172 Ga0111539_10002166 3300009094 Bacteria 26275
173 Ga0111539_10002182 3300009094 Bacteria 26129
174 Ga0111539_10005765 3300009094 Bacteria 16006
175 Ga0111539_10007916 3300009094 Bacteria 13552
176 Ga0111539_10009050 3300009094 Bacteria 12604
177 Ga0111539_10015316 3300009094 Bacteria 9549
178 Ga0111539_10017521 3300009094 Bacteria 8867
179 Ga0111539_10051698 3300009094 Bacteria 4893
180 Ga0111539_10195762 3300009094 Bacteria 2358
181 Ga0105245_10019637 3300009098 Bacteria 5920
182 Ga0105245_10063389 3300009098 Bacteria 3337
183 Ga0105247_10002442 3300009101 Bacteria 12640
184 Ga0105247_10013636 3300009101 Bacteria 4875
185 Ga0105247_10019502 3300009101 Bacteria 4072
186 Ga0114129_10016062 3300009147 Bacteria 10650
187 Ga0114129_10076555 3300009147 Bacteria 4658
188 Ga0114129_10140136 3300009147 Bacteria 3316
189 Ga0105243_10015764 3300009148 Bacteria 5716
190 Ga0105243_10034803 3300009148 Bacteria 3903
191 Ga0105243_10099756 3300009148 Bacteria 2408
192 Ga0105242_10003718 3300009176 Bacteria 11860
193 Ga0105242_10062173 3300009176 Bacteria 3072
194 Ga0105242_10096718 3300009176 Bacteria 2495
195 Ga0105248_10002184 3300009177 Bacteria 21641
196 Ga0105248_10026721 3300009177 Bacteria 6419
197 Ga0105248_10105062 3300009177 Bacteria 3184
198 Ga0105248_10179707 3300009177 Bacteria 2384
199 Ga0105238_10004165 3300009551 Bacteria 14348
200 Ga0105238_10007860 3300009551 Bacteria 10668
201 Ga0105238_10011880 3300009551 Bacteria 8772
202 Ga0105238_10014663 3300009551 Bacteria 7924
203 Ga0105249_10007086 3300009553 Bacteria 9786
204 Ga0105246_10012754 3300011119 Bacteria 5253
205 Ga0105246_10100287 3300011119 Bacteria 2107
206 Ga0157374_10026112 3300013296 Bacteria 5252
207 Ga0163162_10007700 3300013306 Bacteria 10494
208 Ga0163162_10008759 3300013306 Bacteria 9841
209 Ga0163162_10010247 3300013306 Bacteria 9105
210 Ga0163162_10065268 3300013306 Bacteria 3687
211 Ga0157375_10001084 3300013308 Bacteria 23634
212 Ga0157375_10002923 3300013308 Bacteria 14815
213 Ga0157375_10014358 3300013308 Bacteria 7062
214 Ga0157375_10115854 3300013308 Bacteria 2783
215 Ga0163163_10000522 3300014325 Bacteria 34276
216 Ga0163163_10041659 3300014325 Bacteria 4492
217 Ga0163163_10045105 3300014325 Bacteria 4327
218 Ga0163163_10076048 3300014325 Bacteria 3352
219 Ga0163163_10086137 3300014325 Bacteria 3150
220 Ga0163163_10087554 3300014325 Bacteria 3125
221 Ga0157380_10001264 3300014326 Bacteria 16407
222 Ga0157380_10001966 3300014326 Bacteria 13683
223 Ga0157380_10002044 3300014326 Bacteria 13493
224 Ga0157380_10002890 3300014326 Bacteria 11674
225 Ga0157380_10008303 3300014326 Bacteria 7400
226 Ga0157380_10008590 3300014326 Bacteria 7302
227 Ga0157380_10012613 3300014326 Bacteria 6132
228 Ga0157377_10015373 3300014745 Bacteria 3915
229 Ga0157377_10020241 3300014745 Bacteria 3484
230 Ga0157379_10007582 3300014968 Bacteria 9396
231 Ga0157379_10015885 3300014968 Bacteria 6617
232 Ga0157379_10165694 3300014968 Bacteria 1994
233 Ga0157376_10014864 3300014969 Bacteria 5859
234 Ga0157376_10026209 3300014969 Bacteria 4604
235 Ga0157376_10073859 3300014969 Bacteria 2905
236 Ga0163161_10030393 3300017792 Bacteria 3844
237 Ga0207682_10001490 3300025893 Bacteria 10808
238 Ga0207682_10006069 3300025893 Bacteria 4887
239 Ga0207642_10005539 3300025899 Bacteria 4127
240 Ga0207642_10037076 3300025899 Unclassified 2098
241 Ga0207688_10000527 3300025901 Bacteria 18549
242 Ga0207685_10023867 3300025905 Bacteria 2088
243 Ga0207645_10004987 3300025907 Bacteria 9729
244 Ga0207645_10008961 3300025907 Bacteria 6947
245 Ga0207645_10035009 3300025907 Bacteria 3225
246 Ga0207645_10046664 3300025907 Bacteria 2767
247 Ga0207645_10054015 3300025907 Bacteria 2566
248 Ga0207643_10017822 3300025908 Bacteria 3888
249 Ga0207662_10056305 3300025918 Bacteria 2348
250 Ga0207681_10014355 3300025923 Bacteria 4921
251 Ga0207681_10017345 3300025923 Bacteria 4521
252 Ga0207681_10086496 3300025923 Bacteria 2227
253 Ga0207694_10006426 3300025924 Bacteria 8957
254 Ga0207694_10036508 3300025924 Bacteria 3772
255 Ga0207650_10039583 3300025925 Bacteria 3444
256 Ga0207659_10002473 3300025926 Bacteria 11016
257 Ga0207659_10003593 3300025926 Bacteria 9335
258 Ga0207659_10005986 3300025926 Bacteria 7420
259 Ga0207659_10019170 3300025926 Bacteria 4497
260 Ga0207659_10028152 3300025926 Bacteria 3815
261 Ga0207687_10007820 3300025927 Bacteria 7012
262 Ga0207706_10016746 3300025933 Bacteria 6617
263 Ga0207706_10071703 3300025933 Bacteria 3047
264 Ga0207686_10013291 3300025934 Bacteria 4552
265 Ga0207686_10054783 3300025934 Unclassified 2499
266 Ga0207709_10013130 3300025935 Bacteria 4568
267 Ga0207670_10046176 3300025936 Bacteria 2892
268 Ga0207670_10047223 3300025936 Bacteria 2866
269 Ga0207670_10074557 3300025936 Bacteria 2356
270 Ga0207669_10000628 3300025937 Bacteria 15239
271 Ga0207669_10077040 3300025937 Bacteria 2119
272 Ga0207704_10007473 3300025938 Bacteria 5166
273 Ga0207704_10019705 3300025938 Bacteria 3550
274 Ga0207704_10023437 3300025938 Bacteria 3327
275 Ga0207691_10009367 3300025940 Bacteria 9401
276 Ga0207691_10009464 3300025940 Bacteria 9356
277 Ga0207691_10029542 3300025940 Bacteria 5128
278 Ga0207691_10037253 3300025940 Bacteria 4505
279 Ga0207691_10045009 3300025940 Bacteria 4059
280 Ga0207691_10075461 3300025940 Unclassified 3040
281 Ga0207691_10096097 3300025940 Bacteria 2649
282 Ga0207711_10016325 3300025941 Bacteria 6169
283 Ga0207711_10039279 3300025941 Bacteria 4026
284 Ga0207711_10077106 3300025941 Bacteria 2904
285 Ga0207689_10002182 3300025942 Bacteria 18371
286 Ga0207689_10016927 3300025942 Bacteria 6167
287 Ga0207689_10020726 3300025942 Bacteria 5527
288 Ga0207689_10030731 3300025942 Bacteria 4476
289 Ga0207679_10014779 3300025945 Bacteria 5141
290 Ga0207651_10004214 3300025960 Bacteria 7207
291 Ga0207651_10012655 3300025960 Bacteria 4786
292 Ga0207651_10014738 3300025960 Bacteria 4523
293 Ga0207651_10019307 3300025960 Bacteria 4080
294 Ga0207677_10049348 3300026023 Bacteria 2839
295 Ga0207703_10004861 3300026035 Bacteria 10936
296 Ga0207708_10010376 3300026075 Bacteria 6915
297 Ga0207708_10011393 3300026075 Bacteria 6623
298 Ga0207708_10012336 3300026075 Bacteria 6368
299 Ga0207708_10020530 3300026075 Bacteria 4982
300 Ga0207708_10031748 3300026075 Bacteria 4010
301 Ga0207641_10005002 3300026088 Bacteria 11363
302 Ga0207641_10087541 3300026088 Bacteria 2718
303 Ga0207648_10000436 3300026089 Bacteria 46118
304 Ga0207648_10003747 3300026089 Bacteria 15893
305 Ga0207648_10011035 3300026089 Bacteria 8528
306 Ga0207648_10030705 3300026089 Bacteria 4756
307 Ga0207648_10058601 3300026089 Bacteria 3358
308 Ga0207648_10103197 3300026089 Unclassified 2500
309 Ga0207676_10011572 3300026095 Bacteria 6309
310 Ga0207676_10044853 3300026095 Bacteria 3413
311 Ga0207676_10057354 3300026095 Bacteria 3066
312 Ga0207674_10161290 3300026116 Bacteria 2196
313 Ga0207675_100007767 3300026118 Bacteria 10119
314 Ga0207675_100013278 3300026118 Bacteria 7689
315 Ga0207675_100037534 3300026118 Bacteria 4519
316 Ga0207683_10029703 3300026121 Unclassified 4734
317 Ga0207683_10055447 3300026121 Bacteria 3475
318 Ga0207683_10066868 3300026121 Bacteria 3170
319 Ga0207683_10119851 3300026121 Bacteria 2361
320 Ga0207428_10017459 3300027907 Bacteria 6158
321 Ga0207428_10019420 3300027907 Bacteria 5796
322 Ga0207428_10054473 3300027907 Bacteria 3186
323 Ga0207428_10056899 3300027907 Bacteria 3106
324 Ga0268266_10088907 3300028379 Bacteria 2704
325 Ga0268265_10096416 3300028380 Bacteria 2377
326 Ga0268264_10029571 3300028381 Bacteria 4488
327 Ga0307408_100041323 3300031548 Bacteria 3269
328 Ga0265314_10047738 3300031711 Bacteria 3011
329 Ga0307405_10035427 3300031731 Bacteria 2980
330 Ga0307405_10085323 3300031731 Bacteria 2075
331 Ga0307413_10017137 3300031824 Bacteria 3767
332 Ga0307413_10020333 3300031824 Bacteria 3529
333 Ga0307406_10011896 3300031901 Bacteria 4946
334 Ga0307412_10069604 3300031911 Bacteria 2396
335 Ga0307409_100007752 3300031995 Bacteria 6455
336 Ga0307416_100004883 3300032002 Bacteria 8163
337 Ga0373927_0070483 3300035695 Bacteria 2263
338 Ga0373933_0053855 3300035724 Bacteria 2410
339 Ga0373947_0009312 3300035725 Bacteria 5642
340 Ga0373937_0190490 3300036401 Bacteria 1927
341 Ga0439433_0002367 3300041999 Bacteria 3991
342 Ga0439435_0008918 3300042436 Bacteria 2339
343 Ga0495608_0013627 3300046511 Bacteria 5640
344 Ga0495628_0115398 3300046516 Bacteria 2062
345 Ga0495587_0013860 3300046536 Bacteria 5064
346 Ga0495598_0006504 3300046537 Unclassified 2642
347 Ga0495634_0011324 3300046642 Bacteria 6496
348 Ga0495658_0019457 3300046683 Bacteria 3545
349 Ga0495658_0033478 3300046683 Unclassified 2815
350 Ga0495613_0000790 3300046689 Bacteria 24652
351 Ga0495581_0103996 3300047315 Bacteria 1650
352 Ga0495684_0000697 3300047471 Bacteria 26977
353 Ga0496100_0006086 3300048903 Bacteria 6558
354 Ga0496100_0027684 3300048903 Bacteria 3488
355 Ga0496101_0009045 3300048904 Bacteria 6534
356 Ga0496104_0004112 3300048907 Bacteria 12635
357 Ga0496104_0136494 3300048907 Bacteria 2357
358 Ga0496104_0172478 3300048907 Bacteria 2074
359 Ga0496107_0046015 3300048910 Bacteria 3140
360 Ga0496114_0000363 3300048917 Bacteria 33231
361 Ga0496114_0001356 3300048917 Bacteria 18567
362 Ga0496114_0003823 3300048917 Bacteria 11614
363 Ga0501033_0016007 3300049570 Bacteria 5681
364 Ga0501036_0012164 3300049572 Bacteria 7130
365 Ga0501036_0057653 3300049572 Bacteria 3290
366 Ga0501038_0104345 3300049574 Bacteria 2356
367 Ga0501038_0125701 3300049574 Bacteria 2111
368 Ga0501039_0007475 3300049575 Bacteria 8342
369 Ga0501039_0057179 3300049575 Bacteria 3021
370 Ga0501040_0001978 3300049576 Bacteria 13214
371 Ga0501040_0011408 3300049576 Bacteria 5818
372 Ga0501041_0016553 3300049577 Bacteria 4385
373 Ga0501043_0073108 3300049579 Bacteria 2693
374 Ga0501046_0012891 3300049580 Bacteria 7108
375 Ga0501046_0019801 3300049580 Bacteria 5575
376 Ga0501048_0014288 3300049582 Bacteria 5880
377 Ga0501068_0026371 3300049584 Bacteria 3423
378 Ga0501071_0044404 3300049587 Bacteria 3187
379 Ga0501071_0077922 3300049587 Bacteria 2421
380 Ga0501072_0043323 3300049588 Bacteria 3537
381 Ga0501074_0130666 3300049590 Bacteria 1796
382 Ga0501075_0003476 3300049591 Bacteria 10540
383 Ga0501076_0014467 3300049592 Bacteria 5945
384 Ga0501076_0127420 3300049592 Bacteria 2063
385 Ga0501077_0044824 3300049593 Bacteria 2809
386 Ga0501079_0027332 3300049741 Bacteria 4373
387 Ga0501080_0027490 3300049742 Bacteria 5290
388 Ga0501080_0032385 3300049742 Bacteria 4875
389 Ga0501081_0003625 3300049743 Bacteria 9883
390 Ga0501081_0054293 3300049743 Bacteria 2768
391 Ga0501045_0025595 3300049824 Bacteria 4243
392 Ga0501045_0067514 3300049824 Bacteria 2626
393 nmdc:mga05p37_11148_c1 3300050507 Bacteria 10681
394 nmdc:mga09592_52815_c1 3300050508 Bacteria 3430
395 nmdc:mga09592_56216_c1 3300050508 Bacteria 3325
396 nmdc:mga09592_92246_c1 3300050508 Bacteria 2589
397 nmdc:mga0qj67_106916_c1 3300050509 Bacteria 2257
398 nmdc:mga0qj67_1129_c1 3300050509 Bacteria 18518
399 nmdc:mga0qj67_37454_c1 3300050509 Bacteria 3799
400 nmdc:mga0qj67_77704_c1 3300050509 Bacteria 2656
401 nmdc:mga0qj67_81282_c1 3300050509 Unclassified 2598
402 nmdc:mga06r32_5831_c1 3300050510 Bacteria 11092
403 nmdc:mga08y16_114321_c1 3300050511 Unclassified 2810
404 nmdc:mga08y16_136727_c1 3300050511 Bacteria 2547
405 nmdc:mga08y16_18087_c1 3300050511 Bacteria 7423
406 nmdc:mga08y16_28441_c1 3300050511 Bacteria 5894
407 nmdc:mga08y16_347_c1 3300050511 Bacteria 41642
408 nmdc:mga08y16_42998_c1 3300050511 Unclassified 4732
409 nmdc:mga08y16_60551_c1 3300050511 Unclassified 3954
410 nmdc:mga08y16_6420_c1 3300050511 Bacteria 12326
411 nmdc:mga0n895_130487_c1 3300050512 Bacteria 2538
412 nmdc:mga0n895_167152_c1 3300050512 Bacteria 2231
413 nmdc:mga0n895_28331_c1 3300050512 Bacteria 5327
414 nmdc:mga0rr50_31038_c1 3300050513 Bacteria 3790
415 nmdc:mga0a205_19469_c1 3300050515 Bacteria 6399
416 nmdc:mga0a205_3517_c1 3300050515 Bacteria 14001
417 nmdc:mga0a205_453_c1 3300050515 Bacteria 31784
418 nmdc:mga0a205_4683_c1 3300050515 Bacteria 12274
419 Ga0500643_000434 3300053087 Bacteria 31543
420 Ga0500643_003518 3300053087 Bacteria 7493
421 Ga0501084_0015275 3300054114 Bacteria 6367
422 Ga0501082_0001526 3300060353 Bacteria 20365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0013627 Ga0495608_0013627_11_1342 393
2 3300025960 Ga0207651_10014738 Ga0207651_100147382 425
3 3300050508 nmdc:mga09592_92246_c1 nmdc:mga09592_92246_c1_808_2337 463
4 3300026121 Ga0207683_10119851 Ga0207683_101198512 472
5 3300047315 Ga0495581_0103996 Ga0495581_0103996_34_1626 473
6 3300026075 Ga0207708_10011393 Ga0207708_100113933 475
7 3300005290 Ga0065712_10007244 Ga0065712_100072443 481
8 3300005293 Ga0065715_10108547 Ga0065715_101085473 481
9 3300005340 Ga0070689_100031724 Ga0070689_1000317243 481
10 3300005354 Ga0070675_100030724 Ga0070675_1000307243 481
11 3300005364 Ga0070673_100026976 Ga0070673_1000269763 481
12 3300005365 Ga0070688_100037447 Ga0070688_1000374472 481
13 3300005543 Ga0070672_100025925 Ga0070672_1000259253 481
14 3300005719 Ga0068861_100117844 Ga0068861_1001178441 481
15 3300005841 Ga0068863_100122660 Ga0068863_1001226602 481
16 3300014325 Ga0163163_10076048 Ga0163163_100760482 481
17 3300025940 Ga0207691_10037253 Ga0207691_100372533 481
18 3300025945 Ga0207679_10014779 Ga0207679_100147792 481
19 3300025960 Ga0207651_10012655 Ga0207651_100126553 481
20 3300026088 Ga0207641_10087541 Ga0207641_100875413 481
21 3300026095 Ga0207676_10057354 Ga0207676_100573542 481
22 3300035695 Ga0373927_0070483 Ga0373927_0070483_79_1785 492
23 3300050509 nmdc:mga0qj67_77704_c1 nmdc:mga0qj67_77704_c1_992_2620 493
24 3300009148 Ga0105243_10099756 Ga0105243_100997561 495
25 3300053087 Ga0500643_000434 Ga0500643_000434_12008_13801 495
26 3300005338 Ga0068868_100035239 Ga0068868_1000352392 496
27 3300005459 Ga0068867_100019390 Ga0068867_1000193901 496
28 3300005842 Ga0068858_100036060 Ga0068858_1000360601 496
29 3300009177 Ga0105248_10026721 Ga0105248_100267213 496
30 3300013306 Ga0163162_10065268 Ga0163162_100652682 496
31 3300025927 Ga0207687_10007820 Ga0207687_100078204 496
32 3300031731 Ga0307405_10035427 Ga0307405_100354273 496
33 3300031824 Ga0307413_10017137 Ga0307413_100171374 496
34 3300031901 Ga0307406_10011896 Ga0307406_100118963 496
35 3300031995 Ga0307409_100007752 Ga0307409_1000077524 496
36 3300032002 Ga0307416_100004883 Ga0307416_1000048838 496
37 3300041999 Ga0439433_0002367 Ga0439433_0002367_461_2203 496
38 3300013308 Ga0157375_10014358 Ga0157375_100143582 497
39 3300025937 Ga0207669_10077040 Ga0207669_100770401 497
40 3300048903 Ga0496100_0027684 Ga0496100_0027684_242_1993 497
41 3300048904 Ga0496101_0009045 Ga0496101_0009045_3167_4918 497
42 3300048917 Ga0496114_0000363 Ga0496114_0000363_28522_30273 497
43 3300009094 Ga0111539_10001820 Ga0111539_100018209 498
44 3300025925 Ga0207650_10039583 Ga0207650_100395833 498
45 3300027907 Ga0207428_10017459 Ga0207428_100174592 498
46 3300049590 Ga0501074_0130666 Ga0501074_0130666_117_1751 498
47 3300050511 nmdc:mga08y16_347_c1 nmdc:mga08y16_347_c1_18969_20693 498
48 3300005364 Ga0070673_100023022 Ga0070673_1000230221 499
49 3300025935 Ga0207709_10013130 Ga0207709_100131303 499
50 3300036401 Ga0373937_0190490 Ga0373937_0190490_125_1870 499
51 3300046516 Ga0495628_0115398 Ga0495628_0115398_193_1938 499
52 3300046536 Ga0495587_0013860 Ga0495587_0013860_905_2650 499
53 3300046689 Ga0495613_0000790 Ga0495613_0000790_10988_12733 499
54 3300047471 Ga0495684_0000697 Ga0495684_0000697_25085_26830 499
55 3300005842 Ga0068858_100095389 Ga0068858_1000953892 500
56 3300009094 Ga0111539_10009050 Ga0111539_1000905013 500
57 3300009551 Ga0105238_10014663 Ga0105238_100146638 500
58 3300013308 Ga0157375_10115854 Ga0157375_101158542 500
59 3300014325 Ga0163163_10087554 Ga0163163_100875542 500
60 3300025924 Ga0207694_10036508 Ga0207694_100365082 500
61 3300050511 nmdc:mga08y16_18087_c1 nmdc:mga08y16_18087_c1_5375_7114 500
62 3300006237 Ga0097621_100011182 Ga0097621_1000111822 501
63 3300006358 Ga0068871_100045758 Ga0068871_1000457582 501
64 3300006847 Ga0075431_100024848 Ga0075431_1000248483 501
65 3300014969 Ga0157376_10026209 Ga0157376_100262093 501
66 3300025938 Ga0207704_10019705 Ga0207704_100197052 501
67 3300050511 nmdc:mga08y16_136727_c1 nmdc:mga08y16_136727_c1_409_2151 501
68 3300035725 Ga0373947_0009312 Ga0373947_0009312_1219_2964 503
69 3300006844 Ga0075428_100004145 Ga0075428_10000414515 504
70 3300005444 Ga0070694_100033505 Ga0070694_1000335052 505
71 3300006846 Ga0075430_100090639 Ga0075430_1000906392 505
72 3300031548 Ga0307408_100041323 Ga0307408_1000413232 505
73 3300031731 Ga0307405_10085323 Ga0307405_100853231 505
74 3300031824 Ga0307413_10020333 Ga0307413_100203332 505
75 3300005356 Ga0070674_100021841 Ga0070674_1000218412 506
76 3300005456 Ga0070678_100149000 Ga0070678_1001490001 506
77 3300009094 Ga0111539_10002182 Ga0111539_100021826 506
78 3300026075 Ga0207708_10010376 Ga0207708_100103767 506
79 3300027907 Ga0207428_10056899 Ga0207428_100568992 506
80 3300050511 nmdc:mga08y16_6420_c1 nmdc:mga08y16_6420_c1_2428_4185 506
81 3300005290 Ga0065712_10002792 Ga0065712_100027922 507
82 3300005340 Ga0070689_100110382 Ga0070689_1001103821 507
83 3300005353 Ga0070669_100005111 Ga0070669_1000051119 507
84 3300005434 Ga0070709_10008166 Ga0070709_100081662 507
85 3300005564 Ga0070664_100030635 Ga0070664_1000306354 507
86 3300005719 Ga0068861_100037332 Ga0068861_1000373322 507
87 3300005844 Ga0068862_100092734 Ga0068862_1000927342 507
88 3300025936 Ga0207670_10047223 Ga0207670_100472232 507
89 3300026118 Ga0207675_100037534 Ga0207675_1000375342 507
90 3300028380 Ga0268265_10096416 Ga0268265_100964162 507
91 3300005549 Ga0070704_100014273 Ga0070704_1000142735 508
92 3300006844 Ga0075428_100002991 Ga0075428_1000029911 508
93 3300009094 Ga0111539_10005765 Ga0111539_1000576514 508
94 3300009094 Ga0111539_10007916 Ga0111539_1000791611 508
95 3300026075 Ga0207708_10031748 Ga0207708_100317482 508
96 3300050511 nmdc:mga08y16_42998_c1 nmdc:mga08y16_42998_c1_2936_4675 508
97 3300005353 Ga0070669_100055898 Ga0070669_1000558982 509
98 3300005354 Ga0070675_100007116 Ga0070675_1000071163 509
99 3300005355 Ga0070671_100083270 Ga0070671_1000832701 509
100 3300005466 Ga0070685_10001943 Ga0070685_100019434 509
101 3300005466 Ga0070685_10021117 Ga0070685_100211171 509
102 3300005543 Ga0070672_100053238 Ga0070672_1000532382 509
103 3300005617 Ga0068859_100004353 Ga0068859_1000043537 509
104 3300005841 Ga0068863_100000973 Ga0068863_10000097319 509
105 3300005842 Ga0068858_100030634 Ga0068858_1000306342 509
106 3300006931 Ga0097620_100004352 Ga0097620_1000043524 509
107 3300009094 Ga0111539_10051698 Ga0111539_100516982 509
108 3300013306 Ga0163162_10010247 Ga0163162_100102475 509
109 3300014745 Ga0157377_10020241 Ga0157377_100202412 509
110 3300025926 Ga0207659_10003593 Ga0207659_100035933 509
111 3300025940 Ga0207691_10075461 Ga0207691_100754612 509
112 3300026121 Ga0207683_10029703 Ga0207683_100297035 509
113 3300050511 nmdc:mga08y16_60551_c1 nmdc:mga08y16_60551_c1_2108_3943 509
114 3300005334 Ga0068869_100021711 Ga0068869_1000217115 510
115 3300005338 Ga0068868_100027264 Ga0068868_1000272643 510
116 3300005354 Ga0070675_100003977 Ga0070675_1000039772 510
117 3300005618 Ga0068864_100063538 Ga0068864_1000635381 510
118 3300005841 Ga0068863_100006940 Ga0068863_1000069405 510
119 3300005842 Ga0068858_100008883 Ga0068858_1000088832 510
120 3300009101 Ga0105247_10019502 Ga0105247_100195022 510
121 3300009148 Ga0105243_10034803 Ga0105243_100348035 510
122 3300009551 Ga0105238_10007860 Ga0105238_100078603 510
123 3300014325 Ga0163163_10000522 Ga0163163_1000052215 510
124 3300025926 Ga0207659_10002473 Ga0207659_100024732 510
125 3300025936 Ga0207670_10074557 Ga0207670_100745572 510
126 3300025941 Ga0207711_10016325 Ga0207711_100163254 510
127 3300026023 Ga0207677_10049348 Ga0207677_100493482 510
128 3300026095 Ga0207676_10011572 Ga0207676_100115724 510
129 3300006871 Ga0075434_100067139 Ga0075434_1000671392 511
130 3300013308 Ga0157375_10001084 Ga0157375_100010849 511
131 3300014326 Ga0157380_10008303 Ga0157380_100083032 511
132 3300049588 Ga0501072_0043323 Ga0501072_0043323_1739_3484 511
133 3300049741 Ga0501079_0027332 Ga0501079_0027332_2673_4349 511
134 3300005337 Ga0070682_100047649 Ga0070682_1000476492 512
135 3300005544 Ga0070686_100009347 Ga0070686_1000093475 512
136 3300009177 Ga0105248_10002184 Ga0105248_100021843 512
137 3300014326 Ga0157380_10002044 Ga0157380_100020449 512
138 3300050509 nmdc:mga0qj67_106916_c1 nmdc:mga0qj67_106916_c1_477_2213 512
139 3300005438 Ga0070701_10002227 Ga0070701_100022272 513
140 3300005441 Ga0070700_100014827 Ga0070700_1000148273 513
141 3300005617 Ga0068859_100079909 Ga0068859_1000799092 513
142 3300005719 Ga0068861_100027913 Ga0068861_1000279133 513
143 3300005844 Ga0068862_100024613 Ga0068862_1000246133 513
144 3300006931 Ga0097620_100079909 Ga0097620_1000799092 513
145 3300014326 Ga0157380_10008590 Ga0157380_100085906 513
146 3300026075 Ga0207708_10020530 Ga0207708_100205302 513
147 3300050515 nmdc:mga0a205_453_c1 nmdc:mga0a205_453_c1_20845_22569 513
148 3300009551 Ga0105238_10004165 Ga0105238_100041656 514
149 3300014968 Ga0157379_10007582 Ga0157379_100075823 514
150 3300025924 Ga0207694_10006426 Ga0207694_100064264 514
151 3300005364 Ga0070673_100054403 Ga0070673_1000544032 515
152 3300003203 JGI25406J46586_10002342 JGI25406J46586_100023425 517
153 3300005334 Ga0068869_100049122 Ga0068869_1000491223 517
154 3300005441 Ga0070700_100002614 Ga0070700_1000026141 517
155 3300005459 Ga0068867_100004975 Ga0068867_1000049752 517
156 3300005985 Ga0081539_10008461 Ga0081539_100084617 517
157 3300006846 Ga0075430_100045881 Ga0075430_1000458812 517
158 3300006881 Ga0068865_100005703 Ga0068865_1000057035 517
159 3300025893 Ga0207682_10006069 Ga0207682_100060695 517
160 3300025907 Ga0207645_10046664 Ga0207645_100466642 517
161 3300025926 Ga0207659_10019170 Ga0207659_100191702 517
162 3300025942 Ga0207689_10016927 Ga0207689_100169272 517
163 3300026089 Ga0207648_10003747 Ga0207648_100037477 517
164 3300046683 Ga0495658_0019457 Ga0495658_0019457_22_1896 518
165 3300009098 Ga0105245_10019637 Ga0105245_100196374 519
166 3300014969 Ga0157376_10073859 Ga0157376_100738591 519
167 3300042436 Ga0439435_0008918 Ga0439435_0008918_451_2172 519
168 3300005364 Ga0070673_100014093 Ga0070673_1000140934 520
169 3300005459 Ga0068867_100001665 Ga0068867_10000166515 520
170 3300005459 Ga0068867_100085343 Ga0068867_1000853432 520
171 3300005543 Ga0070672_100004887 Ga0070672_1000048875 520
172 3300006846 Ga0075430_100039899 Ga0075430_1000398992 520
173 3300006852 Ga0075433_10007983 Ga0075433_100079833 520
174 3300009176 Ga0105242_10003718 Ga0105242_100037184 520
175 3300014326 Ga0157380_10001264 Ga0157380_100012644 520
176 3300025899 Ga0207642_10037076 Ga0207642_100370762 520
177 3300025907 Ga0207645_10004987 Ga0207645_100049879 520
178 3300025923 Ga0207681_10017345 Ga0207681_100173453 520
179 3300025934 Ga0207686_10054783 Ga0207686_100547832 520
180 3300025938 Ga0207704_10023437 Ga0207704_100234373 520
181 3300025940 Ga0207691_10009367 Ga0207691_100093675 520
182 3300025942 Ga0207689_10002182 Ga0207689_100021826 520
183 3300026089 Ga0207648_10000436 Ga0207648_1000043637 520
184 3300026089 Ga0207648_10103197 Ga0207648_101031973 520
185 3300028381 Ga0268264_10029571 Ga0268264_100295715 520
186 3300035724 Ga0373933_0053855 Ga0373933_0053855_637_2373 520
187 3300050509 nmdc:mga0qj67_37454_c1 nmdc:mga0qj67_37454_c1_906_2654 520
188 3300050515 nmdc:mga0a205_4683_c1 nmdc:mga0a205_4683_c1_2960_4696 520
189 3300005937 Ga0081455_10099819 Ga0081455_100998192 521
190 3300048907 Ga0496104_0136494 Ga0496104_0136494_179_1876 521
191 3300014325 Ga0163163_10041659 Ga0163163_100416592 523
192 3300025942 Ga0207689_10030731 Ga0207689_100307312 523
193 3300005356 Ga0070674_100001192 Ga0070674_10000119213 524
194 3300005457 Ga0070662_100047596 Ga0070662_1000475961 524
195 3300006871 Ga0075434_100000984 Ga0075434_10000098419 524
196 3300007076 Ga0075435_100013886 Ga0075435_1000138864 524
197 3300014326 Ga0157380_10002890 Ga0157380_1000289010 524
198 3300025933 Ga0207706_10071703 Ga0207706_100717032 524
199 3300025937 Ga0207669_10000628 Ga0207669_100006281 524
200 3300050512 nmdc:mga0n895_28331_c1 nmdc:mga0n895_28331_c1_1066_2793 524
201 3300050513 nmdc:mga0rr50_31038_c1 nmdc:mga0rr50_31038_c1_1243_2970 524
202 3300050515 nmdc:mga0a205_3517_c1 nmdc:mga0a205_3517_c1_2460_4187 524
203 3300005290 Ga0065712_10103415 Ga0065712_101034151 525
204 3300005544 Ga0070686_100079209 Ga0070686_1000792091 525
205 3300005617 Ga0068859_100120652 Ga0068859_1001206522 525
206 3300005618 Ga0068864_100028152 Ga0068864_1000281522 525
207 3300006846 Ga0075430_100089096 Ga0075430_1000890962 525
208 3300006931 Ga0097620_100120648 Ga0097620_1001206482 525
209 3300009094 Ga0111539_10002166 Ga0111539_100021669 525
210 3300009094 Ga0111539_10195762 Ga0111539_101957623 525
211 3300009147 Ga0114129_10016062 Ga0114129_100160624 525
212 3300017792 Ga0163161_10030393 Ga0163161_100303932 525
213 3300025907 Ga0207645_10054015 Ga0207645_100540152 525
214 3300025940 Ga0207691_10045009 Ga0207691_100450092 525
215 3300026095 Ga0207676_10044853 Ga0207676_100448532 525
216 3300026121 Ga0207683_10055447 Ga0207683_100554472 525
217 3300027907 Ga0207428_10019420 Ga0207428_100194203 525
218 3300031711 Ga0265314_10047738 Ga0265314_100477382 525
219 3300049572 Ga0501036_0057653 Ga0501036_0057653_840_2573 525
220 3300049574 Ga0501038_0104345 Ga0501038_0104345_318_2051 525
221 3300049575 Ga0501039_0057179 Ga0501039_0057179_895_2628 525
222 3300049576 Ga0501040_0011408 Ga0501040_0011408_3393_5126 525
223 3300049580 Ga0501046_0012891 Ga0501046_0012891_1089_2822 525
224 3300049582 Ga0501048_0014288 Ga0501048_0014288_513_2246 525
225 3300049587 Ga0501071_0077922 Ga0501071_0077922_169_1902 525
226 3300049592 Ga0501076_0127420 Ga0501076_0127420_296_2029 525
227 3300049742 Ga0501080_0027490 Ga0501080_0027490_1905_3638 525
228 3300049743 Ga0501081_0054293 Ga0501081_0054293_882_2615 525
229 3300049824 Ga0501045_0025595 Ga0501045_0025595_847_2580 525
230 3300050507 nmdc:mga05p37_11148_c1 nmdc:mga05p37_11148_c1_725_2488 525
231 3300050509 nmdc:mga0qj67_81282_c1 nmdc:mga0qj67_81282_c1_655_2418 525
232 3300050511 nmdc:mga08y16_114321_c1 nmdc:mga08y16_114321_c1_445_2208 525
233 3300054114 Ga0501084_0015275 Ga0501084_0015275_4000_5733 525
234 3300005354 Ga0070675_100013835 Ga0070675_1000138353 526
235 3300005445 Ga0070708_100166870 Ga0070708_1001668701 526
236 3300005577 Ga0068857_100163802 Ga0068857_1001638021 526
237 3300025926 Ga0207659_10005986 Ga0207659_100059865 526
238 3300025960 Ga0207651_10004214 Ga0207651_100042143 526
239 3300026116 Ga0207674_10161290 Ga0207674_101612902 526
240 3300046537 Ga0495598_0006504 Ga0495598_0006504_820_2583 526
241 3300005290 Ga0065712_10000378 Ga0065712_100003788 527
242 3300005331 Ga0070670_100010669 Ga0070670_1000106696 527
243 3300005338 Ga0068868_100015352 Ga0068868_1000153523 527
244 3300005365 Ga0070688_100007832 Ga0070688_1000078325 527
245 3300005367 Ga0070667_100089028 Ga0070667_1000890282 527
246 3300005535 Ga0070684_100099409 Ga0070684_1000994091 527
247 3300005548 Ga0070665_100086023 Ga0070665_1000860232 527
248 3300005548 Ga0070665_100089298 Ga0070665_1000892982 527
249 3300005564 Ga0070664_100014829 Ga0070664_1000148293 527
250 3300005564 Ga0070664_100097382 Ga0070664_1000973822 527
251 3300005615 Ga0070702_100035701 Ga0070702_1000357012 527
252 3300005617 Ga0068859_100030208 Ga0068859_1000302083 527
253 3300005841 Ga0068863_100104509 Ga0068863_1001045092 527
254 3300006237 Ga0097621_100033488 Ga0097621_1000334882 527
255 3300006844 Ga0075428_100050210 Ga0075428_1000502103 527
256 3300006871 Ga0075434_100131076 Ga0075434_1001310762 527
257 3300006931 Ga0097620_100030207 Ga0097620_1000302073 527
258 3300009093 Ga0105240_10094101 Ga0105240_100941012 527
259 3300009098 Ga0105245_10063389 Ga0105245_100633892 527
260 3300009101 Ga0105247_10013636 Ga0105247_100136363 527
261 3300009551 Ga0105238_10011880 Ga0105238_100118801 527
262 3300011119 Ga0105246_10100287 Ga0105246_101002872 527
263 3300013296 Ga0157374_10026112 Ga0157374_100261123 527
264 3300013306 Ga0163162_10008759 Ga0163162_100087599 527
265 3300013308 Ga0157375_10002923 Ga0157375_100029232 527
266 3300014325 Ga0163163_10045105 Ga0163163_100451052 527
267 3300014745 Ga0157377_10015373 Ga0157377_100153733 527
268 3300014969 Ga0157376_10014864 Ga0157376_100148643 527
269 3300025941 Ga0207711_10077106 Ga0207711_100771061 527
270 3300028379 Ga0268266_10088907 Ga0268266_100889072 527
271 3300050512 nmdc:mga0n895_130487_c1 nmdc:mga0n895_130487_c1_479_2242 527
272 3300005843 Ga0068860_100205082 Ga0068860_1002050821 528
273 3300009147 Ga0114129_10140136 Ga0114129_101401362 528
274 3300046683 Ga0495658_0033478 Ga0495658_0033478_895_2634 528
275 3300049570 Ga0501033_0016007 Ga0501033_0016007_59_1792 528
276 3300049572 Ga0501036_0012164 Ga0501036_0012164_5149_6882 528
277 3300049575 Ga0501039_0007475 Ga0501039_0007475_5889_7622 528
278 3300049576 Ga0501040_0001978 Ga0501040_0001978_3276_5009 528
279 3300049579 Ga0501043_0073108 Ga0501043_0073108_938_2671 528
280 3300049580 Ga0501046_0019801 Ga0501046_0019801_314_2047 528
281 3300049584 Ga0501068_0026371 Ga0501068_0026371_72_1805 528
282 3300049587 Ga0501071_0044404 Ga0501071_0044404_1413_3146 528
283 3300049591 Ga0501075_0003476 Ga0501075_0003476_8379_10112 528
284 3300049593 Ga0501077_0044824 Ga0501077_0044824_1042_2775 528
285 3300049742 Ga0501080_0032385 Ga0501080_0032385_2143_3876 528
286 3300049743 Ga0501081_0003625 Ga0501081_0003625_4317_6050 528
287 3300049824 Ga0501045_0067514 Ga0501045_0067514_515_2248 528
288 3300053087 Ga0500643_003518 Ga0500643_003518_4288_6111 528
289 3300060353 Ga0501082_0001526 Ga0501082_0001526_11114_12847 528
290 3300005328 Ga0070676_10017603 Ga0070676_100176032 529
291 3300005719 Ga0068861_100117914 Ga0068861_1001179142 529
292 3300006846 Ga0075430_100019357 Ga0075430_1000193572 529
293 3300006847 Ga0075431_100027436 Ga0075431_1000274364 529
294 3300006880 Ga0075429_100058141 Ga0075429_1000581412 529
295 3300009177 Ga0105248_10105062 Ga0105248_101050622 529
296 3300025941 Ga0207711_10039279 Ga0207711_100392791 529
297 3300026089 Ga0207648_10030705 Ga0207648_100307053 529
298 3300046642 Ga0495634_0011324 Ga0495634_0011324_3949_5679 529
299 3300050508 nmdc:mga09592_52815_c1 nmdc:mga09592_52815_c1_543_2282 529
300 3300050509 nmdc:mga0qj67_1129_c1 nmdc:mga0qj67_1129_c1_1543_3282 529
301 3300005353 Ga0070669_100027658 Ga0070669_1000276582 530
302 3300006844 Ga0075428_100118476 Ga0075428_1001184762 531
303 3300031911 Ga0307412_10069604 Ga0307412_100696042 531
304 3300005327 Ga0070658_10022095 Ga0070658_100220953 532
305 3300005334 Ga0068869_100024956 Ga0068869_1000249562 532
306 3300005356 Ga0070674_100000561 Ga0070674_1000005616 532
307 3300005444 Ga0070694_100109788 Ga0070694_1001097882 532
308 3300005545 Ga0070695_100087116 Ga0070695_1000871161 532
309 3300005546 Ga0070696_100070456 Ga0070696_1000704562 532
310 3300005549 Ga0070704_100141113 Ga0070704_1001411131 532
311 3300005617 Ga0068859_100136974 Ga0068859_1001369741 532
312 3300005617 Ga0068859_100198051 Ga0068859_1001980512 532
313 3300005842 Ga0068858_100031601 Ga0068858_1000316012 532
314 3300006844 Ga0075428_100003502 Ga0075428_1000035029 532
315 3300006847 Ga0075431_100000792 Ga0075431_1000007929 532
316 3300006880 Ga0075429_100000997 Ga0075429_1000009977 532
317 3300006931 Ga0097620_100136965 Ga0097620_1001369651 532
318 3300006931 Ga0097620_100198057 Ga0097620_1001980571 532
319 3300009101 Ga0105247_10002442 Ga0105247_100024429 532
320 3300009147 Ga0114129_10076555 Ga0114129_100765552 532
321 3300014968 Ga0157379_10015885 Ga0157379_100158853 532
322 3300025905 Ga0207685_10023867 Ga0207685_100238672 532
323 3300026035 Ga0207703_10004861 Ga0207703_100048613 532
324 3300026089 Ga0207648_10058601 Ga0207648_100586011 532
325 3300048907 Ga0496104_0004112 Ga0496104_0004112_6203_7963 532
326 3300049577 Ga0501041_0016553 Ga0501041_0016553_2230_3981 532
327 3300049592 Ga0501076_0014467 Ga0501076_0014467_2545_4296 532
328 3300050510 nmdc:mga06r32_5831_c1 nmdc:mga06r32_5831_c1_820_2568 532
329 3300005444 Ga0070694_100029158 Ga0070694_1000291582 533
330 3300005459 Ga0068867_100027957 Ga0068867_1000279571 533
331 3300006237 Ga0097621_100030097 Ga0097621_1000300973 533
332 3300009176 Ga0105242_10096718 Ga0105242_100967181 533
333 3300048903 Ga0496100_0006086 Ga0496100_0006086_2611_4374 533
334 3300048910 Ga0496107_0046015 Ga0496107_0046015_629_2392 533
335 3300048917 Ga0496114_0001356 Ga0496114_0001356_6848_8611 533
336 3300048917 Ga0496114_0003823 Ga0496114_0003823_1856_3592 533
337 3300005328 Ga0070676_10018175 Ga0070676_100181751 534
338 3300005330 Ga0070690_100003639 Ga0070690_1000036392 534
339 3300005334 Ga0068869_100012485 Ga0068869_1000124853 534
340 3300005343 Ga0070687_100009547 Ga0070687_1000095472 534
341 3300005353 Ga0070669_100012855 Ga0070669_1000128555 534
342 3300005354 Ga0070675_100018573 Ga0070675_1000185734 534
343 3300005356 Ga0070674_100030425 Ga0070674_1000304252 534
344 3300005364 Ga0070673_100044916 Ga0070673_1000449162 534
345 3300005456 Ga0070678_100114609 Ga0070678_1001146091 534
346 3300005459 Ga0068867_100020353 Ga0068867_1000203532 534
347 3300005543 Ga0070672_100008743 Ga0070672_1000087435 534
348 3300005544 Ga0070686_100014828 Ga0070686_1000148282 534
349 3300005615 Ga0070702_100023782 Ga0070702_1000237823 534
350 3300005718 Ga0068866_10003094 Ga0068866_100030944 534
351 3300005719 Ga0068861_100008246 Ga0068861_1000082464 534
352 3300005840 Ga0068870_10019041 Ga0068870_100190412 534
353 3300006881 Ga0068865_100025894 Ga0068865_1000258944 534
354 3300009094 Ga0111539_10017521 Ga0111539_100175212 534
355 3300009148 Ga0105243_10015764 Ga0105243_100157644 534
356 3300009176 Ga0105242_10062173 Ga0105242_100621733 534
357 3300014326 Ga0157380_10012613 Ga0157380_100126134 534
358 3300025899 Ga0207642_10005539 Ga0207642_100055392 534
359 3300025907 Ga0207645_10008961 Ga0207645_100089617 534
360 3300025908 Ga0207643_10017822 Ga0207643_100178222 534
361 3300025918 Ga0207662_10056305 Ga0207662_100563052 534
362 3300025923 Ga0207681_10014355 Ga0207681_100143552 534
363 3300025934 Ga0207686_10013291 Ga0207686_100132912 534
364 3300025938 Ga0207704_10007473 Ga0207704_100074732 534
365 3300025940 Ga0207691_10029542 Ga0207691_100295424 534
366 3300025942 Ga0207689_10020726 Ga0207689_100207262 534
367 3300026075 Ga0207708_10012336 Ga0207708_100123362 534
368 3300026089 Ga0207648_10011035 Ga0207648_100110353 534
369 3300026118 Ga0207675_100013278 Ga0207675_1000132784 534
370 3300026121 Ga0207683_10066868 Ga0207683_100668683 534
371 3300050511 nmdc:mga08y16_28441_c1 nmdc:mga08y16_28441_c1_567_2381 534
372 3300005985 Ga0081539_10025952 Ga0081539_100259522 535
373 3300049574 Ga0501038_0125701 Ga0501038_0125701_33_1796 535
374 3300050512 nmdc:mga0n895_167152_c1 nmdc:mga0n895_167152_c1_49_1800 535
375 3300005337 Ga0070682_100023253 Ga0070682_1000232532 536
376 3300003203 JGI25406J46586_10000393 JGI25406J46586_1000039318 537
377 3300005985 Ga0081539_10000047 Ga0081539_1000004755 537
378 3300005985 Ga0081539_10001878 Ga0081539_1000187827 537
379 3300005985 Ga0081539_10005549 Ga0081539_1000554912 537
380 3300005577 Ga0068857_100003848 Ga0068857_1000038489 539
381 3300005364 Ga0070673_100055252 Ga0070673_1000552523 541
382 3300009177 Ga0105248_10179707 Ga0105248_101797071 541
383 3300014325 Ga0163163_10086137 Ga0163163_100861372 541
384 3300025940 Ga0207691_10096097 Ga0207691_100960973 541
385 3300048907 Ga0496104_0172478 Ga0496104_0172478_269_2035 541
386 3300001977 JGI24746J21847_1004889 JGI24746J21847_10048891 542
387 3300005293 Ga0065715_10135307 Ga0065715_101353071 542
388 3300005330 Ga0070690_100022240 Ga0070690_1000222401 542
389 3300005334 Ga0068869_100009749 Ga0068869_1000097496 542
390 3300005335 Ga0070666_10030156 Ga0070666_100301561 542
391 3300005338 Ga0068868_100033474 Ga0068868_1000334742 542
392 3300005347 Ga0070668_100131818 Ga0070668_1001318182 542
393 3300005353 Ga0070669_100002774 Ga0070669_1000027744 542
394 3300005438 Ga0070701_10023264 Ga0070701_100232642 542
395 3300005457 Ga0070662_100111738 Ga0070662_1001117382 542
396 3300005466 Ga0070685_10016202 Ga0070685_100162022 542
397 3300005544 Ga0070686_100015962 Ga0070686_1000159622 542
398 3300005840 Ga0068870_10001328 Ga0068870_100013284 542
399 3300005841 Ga0068863_100025314 Ga0068863_1000253143 542
400 3300005843 Ga0068860_100076590 Ga0068860_1000765902 542
401 3300006880 Ga0075429_100061234 Ga0075429_1000612342 542
402 3300006881 Ga0068865_100024432 Ga0068865_1000244322 542
403 3300009094 Ga0111539_10015316 Ga0111539_100153162 542
404 3300009553 Ga0105249_10007086 Ga0105249_100070864 542
405 3300011119 Ga0105246_10012754 Ga0105246_100127546 542
406 3300013306 Ga0163162_10007700 Ga0163162_100077007 542
407 3300014326 Ga0157380_10001966 Ga0157380_100019662 542
408 3300014968 Ga0157379_10165694 Ga0157379_101656942 542
409 3300025893 Ga0207682_10001490 Ga0207682_100014903 542
410 3300025901 Ga0207688_10000527 Ga0207688_100005272 542
411 3300025907 Ga0207645_10035009 Ga0207645_100350091 542
412 3300025923 Ga0207681_10086496 Ga0207681_100864962 542
413 3300025926 Ga0207659_10028152 Ga0207659_100281522 542
414 3300025933 Ga0207706_10016746 Ga0207706_100167462 542
415 3300025936 Ga0207670_10046176 Ga0207670_100461762 542
416 3300025940 Ga0207691_10009464 Ga0207691_100094642 542
417 3300025960 Ga0207651_10019307 Ga0207651_100193073 542
418 3300026088 Ga0207641_10005002 Ga0207641_100050022 542
419 3300026118 Ga0207675_100007767 Ga0207675_1000077672 542
420 3300027907 Ga0207428_10054473 Ga0207428_100544732 542
421 3300050508 nmdc:mga09592_56216_c1 nmdc:mga09592_56216_c1_796_2541 542
422 3300050515 nmdc:mga0a205_19469_c1 nmdc:mga0a205_19469_c1_349_2094 542

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

503

542

0.96

PF13360

PQQ_2

PQQ-like domain

491

581

0.84

PF13360

PQQ_2

PQQ-like domain

70

222

0.79

PF13360

PQQ_2

PQQ-like domain

230

457

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8992 432 488
4cvb-assembly1.cif.gz_A crystal structure of quinone-dependent alcohol dehydrogenase from pseudogluconobacter saccharoketogenenes 0.8905 29 542
4cvb-assembly1.cif.gz_A crystal structure of quinone-dependent alcohol dehydrogenase from pseudogluconobacter saccharoketogenenes 0.8448 29 542
7wmk-assembly1.cif.gz_A pqq-dependent alcohol dehydrogenase complexed with pqq 0.8396 23 542
1flg-assembly1.cif.gz_B crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa 0.826 36 542
ID Description Score Start End Superfamily
af_Q5RG49_936_1023_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.9122 432 503 2.40.128.630
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8992 432 488 2.40.10.480
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8845 432 487 2.40.10.480
af_A0A1D8PNG5_157_281_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8563 432 513 2.40.128.630
af_Q86HN6_279_402_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8198 384 512 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A7X4FQ54-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9995 456 542
AF-A0A2E1W141-F1-model_v4 ATP-binding protein 0.9885 422 542 GO:0005524
AF-A0A6L7WJA2-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.988 432 542
AF-A0A3C0TE46-F1-model_v4 Pyrrolo-quinoline quinone 0.9742 423 542
AF-A0A7W1PQK8-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.961 434 515

Feature Viewer

pLDDT pTM Quality
77.77 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map