F440273

General Info

Members Datasets Scaffolds Average Seq Length
422 255 413 154

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_11105985|Ga0157378_111059852
Length 183
Sequence VVQAGIVGYIPLDPSGGLPGRLKEAAMKVSDILRVKGGTLFTVTPGESLSAALDVMSQHDIGSLVVMDHGELVGMLTFREVIQAIVKNGGALGNTRVQTVMDDHPLTCTPETDLDEVRRIMLGRHARYTPVVSDRTLMGVISFYDVARAVVDSQDFENRMLKAYIRDWPVESRDERPSSQQPN

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
7 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
153 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
190 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
191 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
192 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
252 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
255 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.24
Isolates 2.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.62
Nodule 0.47
Rhizoplane 2.84
Rhizosphere 70.14
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000071 3300002705 Bacteria 80446
2 JGI25154J39366_1000093 3300002738 Bacteria 80476
3 JGI25157J39369_1000088 3300002741 Bacteria 80446
4 JGI25150J39212_1011399 3300002774 Bacteria 1613
5 JGI25159J45721_1000214 3300002987 Bacteria 27289
6 JGI25159J45721_1003648 3300002987 Bacteria 5353
7 JGI25159J45721_1009610 3300002987 Bacteria 2537
8 JGI25151J46595_10015945 3300003187 Bacteria 3297
9 JGI25151J46595_10023613 3300003187 Bacteria 2529
10 JGI25151J46595_10032419 3300003187 Bacteria 2025
11 JGI25160J50197_1000059 3300003354 Bacteria 116962
12 JGI25161J50226_1000008 3300003374 Bacteria 239245
13 Ga0055526_1002443 3300003771 Bacteria 12581
14 Ga0055526_1011635 3300003771 Bacteria 3939
15 Ga0055537_1000245 3300003773 Bacteria 39851
16 Ga0055537_1000249 3300003773 Bacteria 39449
17 Ga0055537_1011323 3300003773 Bacteria 1817
18 Ga0055524_1000057 3300003775 Bacteria 139566
19 Ga0055536_1013155 3300003781 Bacteria 3010
20 Ga0055536_1024864 3300003781 Bacteria 1723
21 Ga0055534_1001259 3300003784 Bacteria 10385
22 Ga0055528_1000888 3300003790 Bacteria 20186
23 Ga0055528_1045598 3300003790 Bacteria 933
24 Ga0055530_10000855 3300003791 Bacteria 25129
25 Ga0055530_10059918 3300003791 Bacteria 852
26 Ga0055540_1000158 3300003792 Bacteria 67050
27 Ga0055540_1041209 3300003792 Bacteria 996
28 Ga0055531_10000269 3300003794 Bacteria 53905
29 Ga0055531_10000706 3300003794 Bacteria 28426
30 Ga0055543_1000138 3300004625 Bacteria 60628
31 Ga0065712_10193382 3300005290 Bacteria 1138
32 Ga0065715_10165910 3300005293 Bacteria 1587
33 Ga0065715_10345555 3300005293 Bacteria 941
34 Ga0065715_10948487 3300005293 Bacteria 560
35 Ga0070658_10261130 3300005327 Bacteria 1471
36 Ga0070658_10624175 3300005327 Bacteria 935
37 Ga0070676_10009363 3300005328 Bacteria 5294
38 Ga0070676_10855049 3300005328 Bacteria 675
39 Ga0070690_100069063 3300005330 Bacteria 2293
40 Ga0070670_100011424 3300005331 Bacteria 7595
41 Ga0070670_100221908 3300005331 Bacteria 1644
42 Ga0070670_100370469 3300005331 Bacteria 1261
43 Ga0070670_100753439 3300005331 Bacteria 878
44 Ga0070677_10095080 3300005333 Bacteria 1303
45 Ga0070677_10389748 3300005333 Bacteria 732
46 Ga0068868_100003726 3300005338 Bacteria 10647
47 Ga0068868_101217294 3300005338 Bacteria 697
48 Ga0070689_100449231 3300005340 Bacteria 1097
49 Ga0070687_100463409 3300005343 Bacteria 846
50 Ga0070661_100733545 3300005344 Bacteria 807
51 Ga0070668_100263196 3300005347 Bacteria 1435
52 Ga0070669_100020027 3300005353 Bacteria 4778
53 Ga0070669_100080205 3300005353 Bacteria 2429
54 Ga0070669_100136378 3300005353 Bacteria 1888
55 Ga0070669_100460484 3300005353 Bacteria 1049
56 Ga0070675_100001741 3300005354 Bacteria 16063
57 Ga0070675_100013383 3300005354 Bacteria 6447
58 Ga0070675_100094101 3300005354 Bacteria 2514
59 Ga0070675_100146086 3300005354 Bacteria 2025
60 Ga0070671_100025245 3300005355 Bacteria 4875
61 Ga0070671_100027450 3300005355 Bacteria 4686
62 Ga0070671_100181732 3300005355 Bacteria 1781
63 Ga0070671_100706794 3300005355 Bacteria 875
64 Ga0070674_100003074 3300005356 Bacteria 9284
65 Ga0070674_100003896 3300005356 Bacteria 8447
66 Ga0070673_100007768 3300005364 Bacteria 7095
67 Ga0070673_100011475 3300005364 Bacteria 6047
68 Ga0070673_100019611 3300005364 Bacteria 4858
69 Ga0070673_100105344 3300005364 Bacteria 2329
70 Ga0070673_100251506 3300005364 Bacteria 1541
71 Ga0070688_100069962 3300005365 Bacteria 2243
72 Ga0070667_100023988 3300005367 Bacteria 5065
73 Ga0070667_100216492 3300005367 Bacteria 1704
74 Ga0070663_100774937 3300005455 Bacteria 821
75 Ga0070663_101222815 3300005455 Bacteria 661
76 Ga0070678_100000853 3300005456 Bacteria 15537
77 Ga0070678_100003769 3300005456 Bacteria 8499
78 Ga0070678_100877580 3300005456 Bacteria 819
79 Ga0070662_100030893 3300005457 Bacteria 3753
80 Ga0070662_101037342 3300005457 Bacteria 703
81 Ga0068867_100005373 3300005459 Bacteria 9058
82 Ga0068867_100018048 3300005459 Bacteria 5014
83 Ga0070699_101021812 3300005518 Bacteria 758
84 Ga0068853_100042089 3300005539 Bacteria 3904
85 Ga0068853_100572840 3300005539 Bacteria 1071
86 Ga0070672_100000184 3300005543 Bacteria 34323
87 Ga0070672_100035216 3300005543 Bacteria 3805
88 Ga0070672_100280411 3300005543 Bacteria 1409
89 Ga0070665_100204793 3300005548 Bacteria 1973
90 Ga0070664_100252820 3300005564 Bacteria 1584
91 Ga0070664_100328221 3300005564 Bacteria 1388
92 Ga0068854_100095256 3300005578 Bacteria 2222
93 Ga0068852_100790485 3300005616 Bacteria 963
94 Ga0068859_100069391 3300005617 Bacteria 3559
95 Ga0068864_100000687 3300005618 Bacteria 28347
96 Ga0068864_100036789 3300005618 Bacteria 4175
97 Ga0068861_101232370 3300005719 Bacteria 725
98 Ga0068861_101714187 3300005719 Bacteria 622
99 Ga0068851_10160730 3300005834 Bacteria 1234
100 Ga0068851_10325653 3300005834 Bacteria 889
101 Ga0068851_10608490 3300005834 Bacteria 666
102 Ga0068863_100005996 3300005841 Bacteria 11914
103 Ga0068863_100033980 3300005841 Bacteria 4857
104 Ga0068858_100039836 3300005842 Bacteria 4356
105 Ga0068860_101010696 3300005843 Bacteria 850
106 Ga0068862_100014317 3300005844 Bacteria 6580
107 Ga0068862_100318974 3300005844 Bacteria 1434
108 Ga0068862_100378024 3300005844 Bacteria 1320
109 Ga0081455_10130033 3300005937 Bacteria 1970
110 Ga0075432_10010468 3300006058 Bacteria 3147
111 Ga0075366_10000285 3300006195 Bacteria 22644
112 Ga0075366_10023648 3300006195 Bacteria 3580
113 Ga0075366_10061857 3300006195 Bacteria 2226
114 Ga0075366_10298333 3300006195 Bacteria 986
115 Ga0097621_100207318 3300006237 Bacteria 1704
116 Ga0097621_100293644 3300006237 Bacteria 1434
117 Ga0075370_10163758 3300006353 Bacteria 1306
118 Ga0068871_100305407 3300006358 Bacteria 1398
119 Ga0068871_100310277 3300006358 Bacteria 1387
120 Ga0068865_100029823 3300006881 Bacteria 3623
121 Ga0068865_101511813 3300006881 Bacteria 602
122 Ga0097620_100069391 3300006931 Bacteria 3559
123 Ga0079104_1072049 3300006946 Bacteria 724
124 Ga0111539_11519295 3300009094 Bacteria 777
125 Ga0105243_10097623 3300009148 Bacteria 2432
126 Ga0105243_11015327 3300009148 Bacteria 833
127 Ga0105242_10011998 3300009176 Bacteria 6672
128 Ga0105249_10220653 3300009553 Bacteria 1865
129 Ga0157326_1002048 3300012513 Bacteria 2183
130 Ga0157370_10353694 3300013104 Bacteria 1354
131 Ga0157374_10149207 3300013296 Bacteria 2272
132 Ga0157374_10920410 3300013296 Bacteria 892
133 Ga0157378_11105985 3300013297 Bacteria 830
134 Ga0163162_10053590 3300013306 Bacteria 4055
135 Ga0163162_11064672 3300013306 Bacteria 916
136 Ga0163162_11233520 3300013306 Bacteria 849
137 Ga0157375_10042185 3300013308 Bacteria 4414
138 Ga0157375_11074748 3300013308 Bacteria 941
139 Ga0163163_10084536 3300014325 Bacteria 3180
140 Ga0157380_10776134 3300014326 Bacteria 973
141 Ga0182008_10001417 3300014497 Bacteria 16085
142 Ga0182008_10762781 3300014497 Bacteria 558
143 Ga0157379_10031152 3300014968 Bacteria 4751
144 Ga0157376_10089191 3300014969 Bacteria 2666
145 Ga0163161_10272782 3300017792 Bacteria 1324
146 Ga0163161_10347788 3300017792 Bacteria 1178
147 Ga0213872_10000011 3300021361 Bacteria 194139
148 Ga0213872_10004635 3300021361 Bacteria 7241
149 Ga0209435_100014 3300025206 Bacteria 322129
150 Ga0207425_1001085 3300025245 Bacteria 12369
151 Ga0207425_1009464 3300025245 Bacteria 2420
152 Ga0209646_1000001 3300025246 Bacteria 3092932
153 Ga0209026_1000073 3300025250 Bacteria 205399
154 Ga0209759_1000013 3300025256 Bacteria 399300
155 Ga0209129_1014797 3300025258 Bacteria 1641
156 Ga0209565_1000028 3300025263 Bacteria 348536
157 Ga0209565_1000688 3300025263 Bacteria 21013
158 Ga0209673_1000035 3300025273 Bacteria 328411
159 Ga0209673_1011325 3300025273 Bacteria 3684
160 Ga0209673_1015773 3300025273 Bacteria 2853
161 Ga0209673_1033856 3300025273 Bacteria 1551
162 Ga0209130_1000052 3300025284 Bacteria 216971
163 Ga0209130_1000941 3300025284 Bacteria 23186
164 Ga0209675_1000313 3300025291 Bacteria 43444
165 Ga0209675_1001630 3300025291 Bacteria 12570
166 Ga0209675_1026325 3300025291 Bacteria 1449
167 Ga0209676_1000069 3300025292 Bacteria 312462
168 Ga0209676_1022752 3300025292 Bacteria 2068
169 Ga0209025_1003176 3300025294 Bacteria 15970
170 Ga0209025_1005138 3300025294 Bacteria 10856
171 Ga0209025_1014698 3300025294 Bacteria 4789
172 Ga0209564_1000097 3300025295 Bacteria 231436
173 Ga0209564_1001511 3300025295 Bacteria 23274
174 Ga0209564_1002784 3300025295 Bacteria 13066
175 Ga0209564_1019341 3300025295 Bacteria 2550
176 Ga0209050_1000023 3300025298 Bacteria 537172
177 Ga0209050_1004604 3300025298 Bacteria 9219
178 Ga0209050_1017709 3300025298 Bacteria 2818
179 Ga0209256_1000003 3300025299 Bacteria 1661127
180 Ga0209256_1047571 3300025299 Bacteria 1055
181 Ga0207426_1000306 3300025302 Bacteria 96112
182 Ga0207426_1004313 3300025302 Bacteria 7009
183 Ga0209051_1000017 3300025303 Bacteria 537172
184 Ga0209051_1000136 3300025303 Bacteria 138015
185 Ga0209257_1000041 3300025304 Bacteria 537172
186 Ga0209257_1000055 3300025304 Bacteria 415534
187 Ga0207697_10120340 3300025315 Bacteria 1129
188 Ga0207656_10119909 3300025321 Bacteria 1224
189 Ga0207656_10251967 3300025321 Bacteria 865
190 Ga0207682_10000292 3300025893 Bacteria 22772
191 Ga0207682_10061994 3300025893 Bacteria 1567
192 Ga0207642_10180565 3300025899 Bacteria 1150
193 Ga0207642_10458750 3300025899 Bacteria 773
194 Ga0207688_10233370 3300025901 Bacteria 1111
195 Ga0207688_10376729 3300025901 Bacteria 877
196 Ga0207680_10028141 3300025903 Bacteria 3140
197 Ga0207645_10001011 3300025907 Bacteria 23250
198 Ga0207645_10118877 3300025907 Bacteria 1714
199 Ga0207645_10332743 3300025907 Bacteria 1014
200 Ga0207645_10536065 3300025907 Bacteria 794
201 Ga0207645_10573754 3300025907 Bacteria 766
202 Ga0207643_10806887 3300025908 Bacteria 608
203 Ga0207705_10953278 3300025909 Bacteria 664
204 Ga0207684_10135315 3300025910 Bacteria 2116
205 Ga0207684_10836331 3300025910 Bacteria 777
206 Ga0207662_10525501 3300025918 Bacteria 817
207 Ga0207657_10634671 3300025919 Bacteria 832
208 Ga0207649_10097619 3300025920 Bacteria 1938
209 Ga0207649_11193038 3300025920 Bacteria 601
210 Ga0207646_11438568 3300025922 Bacteria 598
211 Ga0207681_10023953 3300025923 Bacteria 3911
212 Ga0207681_10027219 3300025923 Bacteria 3695
213 Ga0207681_10557520 3300025923 Bacteria 943
214 Ga0207650_10001680 3300025925 Bacteria 15723
215 Ga0207650_10022691 3300025925 Bacteria 4446
216 Ga0207650_10142101 3300025925 Bacteria 1888
217 Ga0207650_10243685 3300025925 Bacteria 1453
218 Ga0207650_10700622 3300025925 Bacteria 855
219 Ga0207659_10006971 3300025926 Bacteria 6942
220 Ga0207659_10009807 3300025926 Bacteria 5994
221 Ga0207659_10063402 3300025926 Bacteria 2672
222 Ga0207659_10521231 3300025926 Bacteria 1008
223 Ga0207659_10718900 3300025926 Bacteria 856
224 Ga0207687_10513285 3300025927 Bacteria 1002
225 Ga0207644_10005146 3300025931 Bacteria 8546
226 Ga0207644_10007087 3300025931 Bacteria 7309
227 Ga0207644_10051340 3300025931 Bacteria 2960
228 Ga0207706_10029516 3300025933 Bacteria 4895
229 Ga0207706_10236529 3300025933 Bacteria 1597
230 Ga0207686_10010471 3300025934 Bacteria 5051
231 Ga0207709_10178296 3300025935 Bacteria 1498
232 Ga0207709_10660536 3300025935 Bacteria 833
233 Ga0207669_10152765 3300025937 Bacteria 1619
234 Ga0207669_10906884 3300025937 Bacteria 736
235 Ga0207691_10001624 3300025940 Bacteria 22323
236 Ga0207691_10027762 3300025940 Bacteria 5305
237 Ga0207691_10033430 3300025940 Bacteria 4788
238 Ga0207691_10734028 3300025940 Bacteria 832
239 Ga0207711_10787994 3300025941 Bacteria 885
240 Ga0207711_10884329 3300025941 Bacteria 831
241 Ga0207689_10070417 3300025942 Bacteria 2873
242 Ga0207689_10121598 3300025942 Bacteria 2147
243 Ga0207689_10760999 3300025942 Bacteria 817
244 Ga0207679_10121925 3300025945 Bacteria 2077
245 Ga0207679_10414075 3300025945 Bacteria 1188
246 Ga0207651_10029801 3300025960 Bacteria 3464
247 Ga0207651_10063887 3300025960 Bacteria 2573
248 Ga0207651_10077996 3300025960 Bacteria 2374
249 Ga0207651_10268650 3300025960 Bacteria 1404
250 Ga0207651_10448165 3300025960 Bacteria 1107
251 Ga0207651_10532232 3300025960 Bacteria 1020
252 Ga0207712_10280189 3300025961 Bacteria 1360
253 Ga0207668_10052825 3300025972 Bacteria 2813
254 Ga0207668_10488318 3300025972 Bacteria 1057
255 Ga0207640_10251934 3300025981 Bacteria 1371
256 Ga0207640_11163716 3300025981 Bacteria 684
257 Ga0207658_10325585 3300025986 Bacteria 1331
258 Ga0207658_10354625 3300025986 Bacteria 1278
259 Ga0207677_10037114 3300026023 Bacteria 3182
260 Ga0207677_10039339 3300026023 Bacteria 3109
261 Ga0207678_10180026 3300026067 Bacteria 1805
262 Ga0207678_10588192 3300026067 Bacteria 975
263 Ga0207702_10141198 3300026078 Bacteria 2180
264 Ga0207641_10046279 3300026088 Bacteria 3666
265 Ga0207648_10005934 3300026089 Bacteria 12215
266 Ga0207648_10234442 3300026089 Bacteria 1633
267 Ga0207648_11383118 3300026089 Bacteria 661
268 Ga0207676_10008343 3300026095 Bacteria 7364
269 Ga0207676_10093950 3300026095 Bacteria 2470
270 Ga0207674_10190331 3300026116 Bacteria 2001
271 Ga0207675_101254236 3300026118 Bacteria 762
272 Ga0207683_10006828 3300026121 Bacteria 9771
273 Ga0207683_10006922 3300026121 Bacteria 9709
274 Ga0207683_10263099 3300026121 Bacteria 1575
275 Ga0207683_10769364 3300026121 Bacteria 893
276 Ga0207683_11664817 3300026121 Bacteria 587
277 Ga0207698_10060828 3300026142 Bacteria 2939
278 Ga0207698_10256421 3300026142 Bacteria 1604
279 Ga0209281_1044912 3300027111 Bacteria 726
280 Ga0209981_1024332 3300027378 Bacteria 874
281 Ga0209996_1003529 3300027395 Bacteria 1971
282 Ga0209995_1002346 3300027471 Bacteria 2990
283 Ga0209968_1002098 3300027526 Bacteria 3029
284 Ga0209966_1000005 3300027695 Bacteria 103734
285 Ga0209974_10018109 3300027876 Bacteria 2336
286 Ga0209974_10152118 3300027876 Bacteria 836
287 Ga0268266_10566128 3300028379 Bacteria 1090
288 Ga0268266_11076002 3300028379 Bacteria 778
289 Ga0268265_10037737 3300028380 Bacteria 3548
290 Ga0268265_10103333 3300028380 Bacteria 2307
291 Ga0268265_11304841 3300028380 Bacteria 726
292 Ga0307517_10216193 3300028786 Bacteria 1172
293 Ga0307517_10254157 3300028786 Bacteria 1027
294 Ga0307515_10034073 3300028794 Bacteria 8356
295 Ga0307515_10140490 3300028794 Bacteria 2593
296 Ga0307513_10000975 3300031456 Bacteria 41400
297 Ga0307513_10030593 3300031456 Bacteria 6113
298 Ga0307513_10540064 3300031456 Bacteria 879
299 Ga0307408_100000150 3300031548 Bacteria 77682
300 Ga0307408_100578883 3300031548 Bacteria 994
301 Ga0307405_10636940 3300031731 Bacteria 875
302 Ga0307405_11252822 3300031731 Bacteria 643
303 Ga0307413_11398096 3300031824 Bacteria 615
304 Ga0307413_12148554 3300031824 Bacteria 505
305 Ga0307410_10321400 3300031852 Bacteria 1228
306 Ga0307410_10747230 3300031852 Bacteria 828
307 Ga0307406_10728620 3300031901 Bacteria 830
308 Ga0307406_10805303 3300031901 Bacteria 793
309 Ga0307407_10242287 3300031903 Bacteria 1231
310 Ga0307412_10368560 3300031911 Bacteria 1159
311 Ga0307412_12004782 3300031911 Bacteria 536
312 Ga0307409_100616571 3300031995 Bacteria 1074
313 Ga0307409_100760643 3300031995 Bacteria 973
314 Ga0307416_100103779 3300032002 Bacteria 2483
315 Ga0307416_100430239 3300032002 Bacteria 1367
316 Ga0307416_100958875 3300032002 Bacteria 957
317 Ga0307414_10474521 3300032004 Bacteria 1102
318 Ga0307411_11435712 3300032005 Bacteria 632
319 Ga0307415_100752671 3300032126 Bacteria 885
320 Ga0373947_0259676 3300035725 Bacteria 1151
321 Ga0373937_0183554 3300036401 Bacteria 1965
322 Ga0373937_0304283 3300036401 Bacteria 1507
323 Ga0373925_0390575 3300037068 Bacteria 1134
324 Ga0395900_0082188 3300037418 Bacteria 3310
325 Ga0395898_0375685 3300037466 Bacteria 1355
326 Ga0395905_0545567 3300037471 Bacteria 1060
327 Ga0395901_0225029 3300038443 Bacteria 1960
328 Ga0436361_1178073 3300039447 Bacteria 19092
329 Ga0436363_1386105 3300039450 Bacteria 1744
330 Ga0439439_0038878 3300041406 Bacteria 1229
331 Ga0451787_193011 3300041441 Bacteria 624
332 Ga0451802_0519616 3300041460 Bacteria 823
333 Ga0451807_2315473 3300041486 Bacteria 1002
334 Ga0451845_0128709 3300041501 Bacteria 692
335 Ga0439450_043099 3300042008 Bacteria 1053
336 Ga0450919_000205 3300042121 Bacteria 6546
337 Ga0450920_018102 3300042122 Bacteria 1348
338 Ga0439464_0000491 3300042439 Bacteria 7998
339 Ga0439460_0019069 3300042461 Bacteria 1854
340 Ga0450918_000001 3300042531 Bacteria 65425
341 Ga0451577_0000068 3300042876 Bacteria 241923
342 Ga0453684_0000126 3300044712 Bacteria 336395
343 Ga0453684_0007963 3300044712 Bacteria 19212
344 Ga0453684_0199547 3300044712 Bacteria 2333
345 Ga0451576_0003785 3300045051 Bacteria 20411
346 Ga0451576_1545341 3300045051 Bacteria 689
347 Ga0495610_0032227 3300046512 Bacteria 2726
348 Ga0495631_0255801 3300046518 Bacteria 746
349 Ga0495632_0006154 3300046519 Bacteria 7774
350 Ga0495642_0078548 3300046528 Bacteria 1387
351 Ga0495642_0095166 3300046528 Bacteria 1264
352 Ga0495598_0032442 3300046537 Bacteria 1476
353 Ga0495598_0329568 3300046537 Bacteria 583
354 Ga0495621_0023619 3300046539 Bacteria 2046
355 Ga0495621_0044814 3300046539 Bacteria 1564
356 Ga0495656_0198953 3300046615 Bacteria 993
357 Ga0495625_0356914 3300046660 Bacteria 922
358 Ga0495588_0245478 3300046674 Bacteria 944
359 Ga0495647_0177427 3300046681 Bacteria 925
360 Ga0495658_0401553 3300046683 Bacteria 874
361 Ga0495669_0197893 3300046684 Bacteria 960
362 Ga0495649_0025643 3300046694 Bacteria 3283
363 Ga0495660_0053001 3300046810 Bacteria 2203
364 Ga0495660_0155406 3300046810 Bacteria 1126
365 Ga0495636_0397007 3300047318 Bacteria 656
366 Ga0495686_0335500 3300047472 Bacteria 825
367 Ga0495615_0037015 3300048090 Bacteria 1200
368 Ga0495626_0162722 3300048091 Bacteria 935
369 Ga0496100_1462518 3300048903 Bacteria 540
370 Ga0496104_0538767 3300048907 Bacteria 1078
371 Ga0496104_0686197 3300048907 Bacteria 932
372 Ga0496105_0098358 3300048908 Bacteria 2416
373 Ga0496108_0672513 3300048911 Bacteria 899
374 Ga0496109_1227721 3300048912 Bacteria 686
375 Ga0496110_0010648 3300048913 Bacteria 7486
376 Ga0496110_0536536 3300048913 Bacteria 1064
377 Ga0496113_0297117 3300048916 Bacteria 1293
378 Ga0496122_0000320 3300048925 Bacteria 105489
379 Ga0496123_0000258 3300048926 Bacteria 107501
380 Ga0496124_0007078 3300048927 Bacteria 12019
381 Ga0496125_0155342 3300048928 Bacteria 1564
382 Ga0501308_045179 3300049128 Bacteria 631
383 Ga0501031_0001165 3300049568 Bacteria 15996
384 Ga0501034_0908221 3300049571 Bacteria 768
385 Ga0501043_0000075 3300049579 Bacteria 86156
386 Ga0501046_0000195 3300049580 Bacteria 62300
387 Ga0501047_0000145 3300049581 Bacteria 86319
388 Ga0501048_0000999 3300049582 Bacteria 21090
389 Ga0501048_0896606 3300049582 Bacteria 638
390 Ga0501035_0504106 3300049822 Bacteria 996
391 Ga0501045_0000705 3300049824 Bacteria 21244
392 nmdc:mga03n38_525076_c1 3300050490 Bacteria 667
393 nmdc:mga00v17_277070_c1 3300050491 Bacteria 1089
394 nmdc:mga07m45_296533_c1 3300050496 Bacteria 940
395 nmdc:mga0qj67_526396_c1 3300050509 Bacteria 949
396 Ga0500644_0058838 3300053088 Bacteria 1346
397 Ga0500644_0127452 3300053088 Bacteria 998
398 Ga0500646_0115432 3300053090 Bacteria 858
399 Ga0500566_0080322 3300053094 Bacteria 1816
400 Ga0500641_0135010 3300053096 Bacteria 1065
401 Ga0500593_013624 3300053117 Bacteria 3473
402 Ga0500594_0201043 3300053118 Bacteria 655
403 Ga0500618_060881 3300053125 Bacteria 849
404 Ga0500658_0007842 3300053134 Bacteria 3946
405 Ga0500658_0088067 3300053134 Bacteria 1338
406 Ga0500559_0000695 3300053136 Bacteria 22137
407 Ga0500573_0018205 3300053140 Bacteria 4004
408 Ga0500567_128627 3300053723 Bacteria 995
409 Ga0500570_172226 3300053724 Bacteria 718
410 Ga0500645_000317 3300053730 Bacteria 34309
411 Ga0500645_124360 3300053730 Bacteria 718
412 Ga0500587_000438 3300053739 Bacteria 4901
413 Ga0500661_007487 3300055283 Bacteria 2016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585428057 2587730998 146
2 iso_pu_bacteria 2585428058 2587733143 146
3 iso_pu_bacteria 2643221592 2643968943 146
4 iso_pu_bacteria 2643221625 2644144074 146
5 iso_pu_bacteria 2643221648 2644273194 146
6 3300025910 Ga0207684_10135315 Ga0207684_101353151 147
7 iso_pu_bacteria 2585428062 2587755935 147
8 iso_pu_bacteria 2643221639 2644221302 147
9 iso_pu_bacteria 2643221646 2644257940 147
10 iso_pu_bacteria 2928115317 2928115378 147
11 3300025926 Ga0207659_10006971 Ga0207659_100069715 148
12 3300041441 Ga0451787_193011 Ga0451787_193011_27_482 148
13 3300021361 Ga0213872_10004635 Ga0213872_100046352 149
14 3300031852 Ga0307410_10747230 Ga0307410_107472302 149
15 3300031995 Ga0307409_100760643 Ga0307409_1007606431 149
16 3300039447 Ga0436361_1178073 Ga0436361_1178073_5640_6089 149
17 3300048090 Ga0495615_0037015 Ga0495615_0037015_54_503 149
18 3300048916 Ga0496113_0297117 Ga0496113_0297117_662_1111 149
19 3300003781 Ga0055536_1013155 Ga0055536_10131551 150
20 3300005290 Ga0065712_10193382 Ga0065712_101933822 150
21 3300005293 Ga0065715_10165910 Ga0065715_101659102 150
22 3300005327 Ga0070658_10624175 Ga0070658_106241752 150
23 3300005328 Ga0070676_10009363 Ga0070676_100093634 150
24 3300005331 Ga0070670_100011424 Ga0070670_1000114241 150
25 3300005331 Ga0070670_100370469 Ga0070670_1003704692 150
26 3300005333 Ga0070677_10095080 Ga0070677_100950802 150
27 3300005338 Ga0068868_101217294 Ga0068868_1012172941 150
28 3300005347 Ga0070668_100263196 Ga0070668_1002631962 150
29 3300005353 Ga0070669_100020027 Ga0070669_1000200273 150
30 3300005353 Ga0070669_100136378 Ga0070669_1001363781 150
31 3300005354 Ga0070675_100013383 Ga0070675_1000133833 150
32 3300005354 Ga0070675_100094101 Ga0070675_1000941013 150
33 3300005354 Ga0070675_100146086 Ga0070675_1001460863 150
34 3300005355 Ga0070671_100025245 Ga0070671_1000252452 150
35 3300005355 Ga0070671_100027450 Ga0070671_1000274503 150
36 3300005356 Ga0070674_100003074 Ga0070674_1000030743 150
37 3300005356 Ga0070674_100003896 Ga0070674_1000038962 150
38 3300005364 Ga0070673_100007768 Ga0070673_1000077687 150
39 3300005364 Ga0070673_100019611 Ga0070673_1000196114 150
40 3300005364 Ga0070673_100251506 Ga0070673_1002515062 150
41 3300005367 Ga0070667_100216492 Ga0070667_1002164922 150
42 3300005455 Ga0070663_100774937 Ga0070663_1007749372 150
43 3300005456 Ga0070678_100000853 Ga0070678_1000008538 150
44 3300005456 Ga0070678_100877580 Ga0070678_1008775801 150
45 3300005457 Ga0070662_101037342 Ga0070662_1010373421 150
46 3300005459 Ga0068867_100005373 Ga0068867_1000053735 150
47 3300005539 Ga0068853_100572840 Ga0068853_1005728402 150
48 3300005543 Ga0070672_100000184 Ga0070672_10000018410 150
49 3300005543 Ga0070672_100035216 Ga0070672_1000352162 150
50 3300005548 Ga0070665_100204793 Ga0070665_1002047932 150
51 3300005564 Ga0070664_100328221 Ga0070664_1003282212 150
52 3300005578 Ga0068854_100095256 Ga0068854_1000952562 150
53 3300005618 Ga0068864_100036789 Ga0068864_1000367894 150
54 3300005719 Ga0068861_101232370 Ga0068861_1012323702 150
55 3300005834 Ga0068851_10160730 Ga0068851_101607302 150
56 3300005844 Ga0068862_100318974 Ga0068862_1003189742 150
57 3300006237 Ga0097621_100207318 Ga0097621_1002073182 150
58 3300006358 Ga0068871_100305407 Ga0068871_1003054072 150
59 3300009094 Ga0111539_11519295 Ga0111539_115192951 150
60 3300009176 Ga0105242_10011998 Ga0105242_100119982 150
61 3300013296 Ga0157374_10920410 Ga0157374_109204102 150
62 3300013306 Ga0163162_10053590 Ga0163162_100535904 150
63 3300013306 Ga0163162_11233520 Ga0163162_112335201 150
64 3300013308 Ga0157375_10042185 Ga0157375_100421852 150
65 3300013308 Ga0157375_11074748 Ga0157375_110747482 150
66 3300025273 Ga0209673_1011325 Ga0209673_10113255 150
67 3300025295 Ga0209564_1000097 Ga0209564_100009741 150
68 3300025315 Ga0207697_10120340 Ga0207697_101203402 150
69 3300025321 Ga0207656_10119909 Ga0207656_101199092 150
70 3300025893 Ga0207682_10000292 Ga0207682_1000029213 150
71 3300025893 Ga0207682_10061994 Ga0207682_100619942 150
72 3300025899 Ga0207642_10458750 Ga0207642_104587501 150
73 3300025901 Ga0207688_10233370 Ga0207688_102333702 150
74 3300025907 Ga0207645_10001011 Ga0207645_1000101115 150
75 3300025907 Ga0207645_10118877 Ga0207645_101188772 150
76 3300025907 Ga0207645_10332743 Ga0207645_103327431 150
77 3300025907 Ga0207645_10536065 Ga0207645_105360652 150
78 3300025908 Ga0207643_10806887 Ga0207643_108068871 150
79 3300025909 Ga0207705_10953278 Ga0207705_109532781 150
80 3300025918 Ga0207662_10525501 Ga0207662_105255012 150
81 3300025919 Ga0207657_10634671 Ga0207657_106346712 150
82 3300025923 Ga0207681_10023953 Ga0207681_100239533 150
83 3300025923 Ga0207681_10557520 Ga0207681_105575202 150
84 3300025925 Ga0207650_10001680 Ga0207650_100016807 150
85 3300025925 Ga0207650_10142101 Ga0207650_101421013 150
86 3300025925 Ga0207650_10243685 Ga0207650_102436852 150
87 3300025926 Ga0207659_10009807 Ga0207659_100098073 150
88 3300025926 Ga0207659_10063402 Ga0207659_100634023 150
89 3300025927 Ga0207687_10513285 Ga0207687_105132852 150
90 3300025931 Ga0207644_10005146 Ga0207644_100051467 150
91 3300025931 Ga0207644_10051340 Ga0207644_100513402 150
92 3300025933 Ga0207706_10236529 Ga0207706_102365292 150
93 3300025934 Ga0207686_10010471 Ga0207686_100104715 150
94 3300025937 Ga0207669_10152765 Ga0207669_101527652 150
95 3300025940 Ga0207691_10001624 Ga0207691_1000162413 150
96 3300025940 Ga0207691_10033430 Ga0207691_100334302 150
97 3300025942 Ga0207689_10070417 Ga0207689_100704172 150
98 3300025942 Ga0207689_10760999 Ga0207689_107609991 150
99 3300025945 Ga0207679_10121925 Ga0207679_101219252 150
100 3300025960 Ga0207651_10029801 Ga0207651_100298013 150
101 3300025960 Ga0207651_10268650 Ga0207651_102686502 150
102 3300025960 Ga0207651_10448165 Ga0207651_104481652 150
103 3300025960 Ga0207651_10532232 Ga0207651_105322322 150
104 3300025972 Ga0207668_10052825 Ga0207668_100528252 150
105 3300025972 Ga0207668_10488318 Ga0207668_104883182 150
106 3300025981 Ga0207640_10251934 Ga0207640_102519342 150
107 3300026023 Ga0207677_10039339 Ga0207677_100393393 150
108 3300026067 Ga0207678_10180026 Ga0207678_101800262 150
109 3300026067 Ga0207678_10588192 Ga0207678_105881921 150
110 3300026089 Ga0207648_10005934 Ga0207648_100059345 150
111 3300026095 Ga0207676_10093950 Ga0207676_100939503 150
112 3300026116 Ga0207674_10190331 Ga0207674_101903312 150
113 3300026118 Ga0207675_101254236 Ga0207675_1012542362 150
114 3300026121 Ga0207683_10006828 Ga0207683_100068282 150
115 3300026121 Ga0207683_10263099 Ga0207683_102630992 150
116 3300026121 Ga0207683_10769364 Ga0207683_107693642 150
117 3300026142 Ga0207698_10060828 Ga0207698_100608282 150
118 3300027378 Ga0209981_1024332 Ga0209981_10243322 150
119 3300027395 Ga0209996_1003529 Ga0209996_10035292 150
120 3300027471 Ga0209995_1002346 Ga0209995_10023463 150
121 3300027526 Ga0209968_1002098 Ga0209968_10020983 150
122 3300027695 Ga0209966_1000005 Ga0209966_100000557 150
123 3300027876 Ga0209974_10152118 Ga0209974_101521181 150
124 3300028379 Ga0268266_11076002 Ga0268266_110760022 150
125 3300028380 Ga0268265_11304841 Ga0268265_113048412 150
126 3300031731 Ga0307405_10636940 Ga0307405_106369402 150
127 3300031824 Ga0307413_11398096 Ga0307413_113980961 150
128 3300031852 Ga0307410_10321400 Ga0307410_103214002 150
129 3300031901 Ga0307406_10728620 Ga0307406_107286202 150
130 3300031903 Ga0307407_10242287 Ga0307407_102422872 150
131 3300031911 Ga0307412_10368560 Ga0307412_103685602 150
132 3300031995 Ga0307409_100616571 Ga0307409_1006165711 150
133 3300032002 Ga0307416_100958875 Ga0307416_1009588752 150
134 3300032004 Ga0307414_10474521 Ga0307414_104745212 150
135 3300032126 Ga0307415_100752671 Ga0307415_1007526711 150
136 3300036401 Ga0373937_0304283 Ga0373937_0304283_978_1439 150
137 3300041406 Ga0439439_0038878 Ga0439439_0038878_265_726 150
138 3300046539 Ga0495621_0023619 Ga0495621_0023619_1258_1722 150
139 3300046539 Ga0495621_0044814 Ga0495621_0044814_325_789 150
140 3300049568 Ga0501031_0001165 Ga0501031_0001165_9757_10218 150
141 3300049822 Ga0501035_0504106 Ga0501035_0504106_166_627 150
142 3300053118 Ga0500594_0201043 Ga0500594_0201043_49_501 150
143 3300002705 JGI25156J39149_1000071 JGI25156J39149_100007178 151
144 3300002738 JGI25154J39366_1000093 JGI25154J39366_100009378 151
145 3300002741 JGI25157J39369_1000088 JGI25157J39369_100008878 151
146 3300002774 JGI25150J39212_1011399 JGI25150J39212_10113992 151
147 3300002987 JGI25159J45721_1000214 JGI25159J45721_100021414 151
148 3300002987 JGI25159J45721_1003648 JGI25159J45721_10036482 151
149 3300002987 JGI25159J45721_1009610 JGI25159J45721_10096102 151
150 3300003187 JGI25151J46595_10015945 JGI25151J46595_100159453 151
151 3300003187 JGI25151J46595_10023613 JGI25151J46595_100236132 151
152 3300003187 JGI25151J46595_10032419 JGI25151J46595_100324191 151
153 3300003354 JGI25160J50197_1000059 JGI25160J50197_100005975 151
154 3300003374 JGI25161J50226_1000008 JGI25161J50226_100000821 151
155 3300003771 Ga0055526_1002443 Ga0055526_10024439 151
156 3300003771 Ga0055526_1011635 Ga0055526_10116354 151
157 3300003773 Ga0055537_1000245 Ga0055537_100024526 151
158 3300003773 Ga0055537_1000249 Ga0055537_100024925 151
159 3300003773 Ga0055537_1011323 Ga0055537_10113231 151
160 3300003775 Ga0055524_1000057 Ga0055524_100005726 151
161 3300003781 Ga0055536_1024864 Ga0055536_10248642 151
162 3300003784 Ga0055534_1001259 Ga0055534_10012591 151
163 3300003790 Ga0055528_1000888 Ga0055528_100088824 151
164 3300003790 Ga0055528_1045598 Ga0055528_10455981 151
165 3300003791 Ga0055530_10000855 Ga0055530_1000085510 151
166 3300003791 Ga0055530_10059918 Ga0055530_100599182 151
167 3300003792 Ga0055540_1000158 Ga0055540_100015810 151
168 3300003792 Ga0055540_1041209 Ga0055540_10412091 151
169 3300003794 Ga0055531_10000269 Ga0055531_1000026910 151
170 3300003794 Ga0055531_10000706 Ga0055531_1000070630 151
171 3300004625 Ga0055543_1000138 Ga0055543_100013822 151
172 3300005293 Ga0065715_10345555 Ga0065715_103455552 151
173 3300005293 Ga0065715_10948487 Ga0065715_109484871 151
174 3300005327 Ga0070658_10261130 Ga0070658_102611302 151
175 3300005328 Ga0070676_10855049 Ga0070676_108550491 151
176 3300005330 Ga0070690_100069063 Ga0070690_1000690632 151
177 3300005331 Ga0070670_100221908 Ga0070670_1002219082 151
178 3300005331 Ga0070670_100753439 Ga0070670_1007534391 151
179 3300005333 Ga0070677_10389748 Ga0070677_103897481 151
180 3300005338 Ga0068868_100003726 Ga0068868_1000037264 151
181 3300005340 Ga0070689_100449231 Ga0070689_1004492312 151
182 3300005343 Ga0070687_100463409 Ga0070687_1004634091 151
183 3300005344 Ga0070661_100733545 Ga0070661_1007335452 151
184 3300005353 Ga0070669_100080205 Ga0070669_1000802052 151
185 3300005353 Ga0070669_100460484 Ga0070669_1004604842 151
186 3300005354 Ga0070675_100001741 Ga0070675_1000017415 151
187 3300005355 Ga0070671_100181732 Ga0070671_1001817321 151
188 3300005355 Ga0070671_100706794 Ga0070671_1007067941 151
189 3300005364 Ga0070673_100011475 Ga0070673_1000114755 151
190 3300005364 Ga0070673_100105344 Ga0070673_1001053441 151
191 3300005365 Ga0070688_100069962 Ga0070688_1000699623 151
192 3300005367 Ga0070667_100023988 Ga0070667_1000239882 151
193 3300005455 Ga0070663_101222815 Ga0070663_1012228151 151
194 3300005456 Ga0070678_100003769 Ga0070678_1000037696 151
195 3300005457 Ga0070662_100030893 Ga0070662_1000308931 151
196 3300005459 Ga0068867_100018048 Ga0068867_1000180485 151
197 3300005518 Ga0070699_101021812 Ga0070699_1010218121 151
198 3300005539 Ga0068853_100042089 Ga0068853_1000420893 151
199 3300005543 Ga0070672_100280411 Ga0070672_1002804112 151
200 3300005564 Ga0070664_100252820 Ga0070664_1002528202 151
201 3300005616 Ga0068852_100790485 Ga0068852_1007904852 151
202 3300005617 Ga0068859_100069391 Ga0068859_1000693914 151
203 3300005618 Ga0068864_100000687 Ga0068864_1000006875 151
204 3300005719 Ga0068861_101714187 Ga0068861_1017141871 151
205 3300005834 Ga0068851_10325653 Ga0068851_103256532 151
206 3300005834 Ga0068851_10608490 Ga0068851_106084901 151
207 3300005841 Ga0068863_100005996 Ga0068863_1000059962 151
208 3300005841 Ga0068863_100033980 Ga0068863_1000339805 151
209 3300005842 Ga0068858_100039836 Ga0068858_1000398365 151
210 3300005843 Ga0068860_101010696 Ga0068860_1010106961 151
211 3300005844 Ga0068862_100014317 Ga0068862_1000143171 151
212 3300005844 Ga0068862_100378024 Ga0068862_1003780242 151
213 3300005937 Ga0081455_10130033 Ga0081455_101300332 151
214 3300006058 Ga0075432_10010468 Ga0075432_100104682 151
215 3300006195 Ga0075366_10000285 Ga0075366_100002858 151
216 3300006195 Ga0075366_10023648 Ga0075366_100236482 151
217 3300006195 Ga0075366_10061857 Ga0075366_100618572 151
218 3300006195 Ga0075366_10298333 Ga0075366_102983332 151
219 3300006237 Ga0097621_100293644 Ga0097621_1002936442 151
220 3300006353 Ga0075370_10163758 Ga0075370_101637582 151
221 3300006358 Ga0068871_100310277 Ga0068871_1003102772 151
222 3300006881 Ga0068865_100029823 Ga0068865_1000298232 151
223 3300006881 Ga0068865_101511813 Ga0068865_1015118131 151
224 3300006931 Ga0097620_100069391 Ga0097620_1000693914 151
225 3300006946 Ga0079104_1072049 Ga0079104_10720492 151
226 3300009148 Ga0105243_10097623 Ga0105243_100976232 151
227 3300009148 Ga0105243_11015327 Ga0105243_110153272 151
228 3300009553 Ga0105249_10220653 Ga0105249_102206532 151
229 3300012513 Ga0157326_1002048 Ga0157326_10020482 151
230 3300013104 Ga0157370_10353694 Ga0157370_103536942 151
231 3300013296 Ga0157374_10149207 Ga0157374_101492072 151
232 3300013297 Ga0157378_11105985 Ga0157378_111059852 151
233 3300013306 Ga0163162_11064672 Ga0163162_110646721 151
234 3300014325 Ga0163163_10084536 Ga0163163_100845362 151
235 3300014326 Ga0157380_10776134 Ga0157380_107761342 151
236 3300014497 Ga0182008_10001417 Ga0182008_100014172 151
237 3300014497 Ga0182008_10762781 Ga0182008_107627811 151
238 3300014968 Ga0157379_10031152 Ga0157379_100311525 151
239 3300014969 Ga0157376_10089191 Ga0157376_100891913 151
240 3300017792 Ga0163161_10272782 Ga0163161_102727822 151
241 3300017792 Ga0163161_10347788 Ga0163161_103477882 151
242 3300021361 Ga0213872_10000011 Ga0213872_10000011157 151
243 3300025206 Ga0209435_100014 Ga0209435_100014190 151
244 3300025245 Ga0207425_1001085 Ga0207425_100108514 151
245 3300025245 Ga0207425_1009464 Ga0207425_10094642 151
246 3300025246 Ga0209646_1000001 Ga0209646_1000001190 151
247 3300025250 Ga0209026_1000073 Ga0209026_1000073190 151
248 3300025256 Ga0209759_1000013 Ga0209759_1000013190 151
249 3300025258 Ga0209129_1014797 Ga0209129_10147972 151
250 3300025263 Ga0209565_1000028 Ga0209565_1000028121 151
251 3300025263 Ga0209565_1000688 Ga0209565_100068821 151
252 3300025273 Ga0209673_1000035 Ga0209673_1000035214 151
253 3300025273 Ga0209673_1015773 Ga0209673_10157732 151
254 3300025273 Ga0209673_1033856 Ga0209673_10338562 151
255 3300025284 Ga0209130_1000052 Ga0209130_1000052129 151
256 3300025284 Ga0209130_1000941 Ga0209130_100094120 151
257 3300025291 Ga0209675_1000313 Ga0209675_100031322 151
258 3300025291 Ga0209675_1001630 Ga0209675_10016306 151
259 3300025291 Ga0209675_1026325 Ga0209675_10263252 151
260 3300025292 Ga0209676_1000069 Ga0209676_1000069306 151
261 3300025292 Ga0209676_1022752 Ga0209676_10227522 151
262 3300025294 Ga0209025_1003176 Ga0209025_100317610 151
263 3300025294 Ga0209025_1005138 Ga0209025_10051383 151
264 3300025294 Ga0209025_1014698 Ga0209025_10146982 151
265 3300025295 Ga0209564_1001511 Ga0209564_10015117 151
266 3300025295 Ga0209564_1002784 Ga0209564_10027844 151
267 3300025295 Ga0209564_1019341 Ga0209564_10193412 151
268 3300025298 Ga0209050_1000023 Ga0209050_1000023481 151
269 3300025298 Ga0209050_1004604 Ga0209050_10046045 151
270 3300025298 Ga0209050_1017709 Ga0209050_10177092 151
271 3300025299 Ga0209256_1000003 Ga0209256_10000031231 151
272 3300025299 Ga0209256_1047571 Ga0209256_10475712 151
273 3300025302 Ga0207426_1000306 Ga0207426_100030622 151
274 3300025302 Ga0207426_1004313 Ga0207426_10043132 151
275 3300025303 Ga0209051_1000017 Ga0209051_1000017481 151
276 3300025303 Ga0209051_1000136 Ga0209051_100013621 151
277 3300025304 Ga0209257_1000041 Ga0209257_1000041481 151
278 3300025304 Ga0209257_1000055 Ga0209257_1000055204 151
279 3300025321 Ga0207656_10251967 Ga0207656_102519672 151
280 3300025899 Ga0207642_10180565 Ga0207642_101805651 151
281 3300025901 Ga0207688_10376729 Ga0207688_103767292 151
282 3300025903 Ga0207680_10028141 Ga0207680_100281413 151
283 3300025907 Ga0207645_10573754 Ga0207645_105737542 151
284 3300025910 Ga0207684_10836331 Ga0207684_108363312 151
285 3300025920 Ga0207649_10097619 Ga0207649_100976191 151
286 3300025920 Ga0207649_11193038 Ga0207649_111930381 151
287 3300025922 Ga0207646_11438568 Ga0207646_114385681 151
288 3300025923 Ga0207681_10027219 Ga0207681_100272193 151
289 3300025925 Ga0207650_10022691 Ga0207650_100226913 151
290 3300025925 Ga0207650_10700622 Ga0207650_107006222 151
291 3300025926 Ga0207659_10521231 Ga0207659_105212312 151
292 3300025926 Ga0207659_10718900 Ga0207659_107189002 151
293 3300025931 Ga0207644_10007087 Ga0207644_100070872 151
294 3300025933 Ga0207706_10029516 Ga0207706_100295162 151
295 3300025935 Ga0207709_10178296 Ga0207709_101782962 151
296 3300025935 Ga0207709_10660536 Ga0207709_106605361 151
297 3300025937 Ga0207669_10906884 Ga0207669_109068841 151
298 3300025940 Ga0207691_10027762 Ga0207691_100277622 151
299 3300025940 Ga0207691_10734028 Ga0207691_107340282 151
300 3300025941 Ga0207711_10787994 Ga0207711_107879942 151
301 3300025941 Ga0207711_10884329 Ga0207711_108843292 151
302 3300025942 Ga0207689_10121598 Ga0207689_101215983 151
303 3300025945 Ga0207679_10414075 Ga0207679_104140752 151
304 3300025960 Ga0207651_10063887 Ga0207651_100638873 151
305 3300025960 Ga0207651_10077996 Ga0207651_100779963 151
306 3300025961 Ga0207712_10280189 Ga0207712_102801891 151
307 3300025981 Ga0207640_11163716 Ga0207640_111637161 151
308 3300025986 Ga0207658_10325585 Ga0207658_103255851 151
309 3300025986 Ga0207658_10354625 Ga0207658_103546252 151
310 3300026023 Ga0207677_10037114 Ga0207677_100371143 151
311 3300026078 Ga0207702_10141198 Ga0207702_101411981 151
312 3300026088 Ga0207641_10046279 Ga0207641_100462794 151
313 3300026089 Ga0207648_10234442 Ga0207648_102344422 151
314 3300026089 Ga0207648_11383118 Ga0207648_113831181 151
315 3300026095 Ga0207676_10008343 Ga0207676_100083435 151
316 3300026121 Ga0207683_10006922 Ga0207683_100069226 151
317 3300026121 Ga0207683_11664817 Ga0207683_116648172 151
318 3300026142 Ga0207698_10256421 Ga0207698_102564212 151
319 3300027111 Ga0209281_1044912 Ga0209281_10449122 151
320 3300027876 Ga0209974_10018109 Ga0209974_100181093 151
321 3300028379 Ga0268266_10566128 Ga0268266_105661282 151
322 3300028380 Ga0268265_10037737 Ga0268265_100377373 151
323 3300028380 Ga0268265_10103333 Ga0268265_101033333 151
324 3300028786 Ga0307517_10216193 Ga0307517_102161931 151
325 3300028786 Ga0307517_10254157 Ga0307517_102541571 151
326 3300028794 Ga0307515_10034073 Ga0307515_100340734 151
327 3300028794 Ga0307515_10140490 Ga0307515_101404902 151
328 3300031456 Ga0307513_10000975 Ga0307513_100009757 151
329 3300031456 Ga0307513_10030593 Ga0307513_100305936 151
330 3300031456 Ga0307513_10540064 Ga0307513_105400641 151
331 3300031548 Ga0307408_100000150 Ga0307408_10000015068 151
332 3300031548 Ga0307408_100578883 Ga0307408_1005788832 151
333 3300031731 Ga0307405_11252822 Ga0307405_112528221 151
334 3300031824 Ga0307413_12148554 Ga0307413_121485541 151
335 3300031901 Ga0307406_10805303 Ga0307406_108053031 151
336 3300031911 Ga0307412_12004782 Ga0307412_120047821 151
337 3300032002 Ga0307416_100103779 Ga0307416_1001037792 151
338 3300032002 Ga0307416_100430239 Ga0307416_1004302392 151
339 3300032005 Ga0307411_11435712 Ga0307411_114357121 151
340 3300035725 Ga0373947_0259676 Ga0373947_0259676_109_582 151
341 3300036401 Ga0373937_0183554 Ga0373937_0183554_82_555 151
342 3300037068 Ga0373925_0390575 Ga0373925_0390575_458_931 151
343 3300037418 Ga0395900_0082188 Ga0395900_0082188_991_1455 151
344 3300037466 Ga0395898_0375685 Ga0395898_0375685_513_977 151
345 3300037471 Ga0395905_0545567 Ga0395905_0545567_385_849 151
346 3300038443 Ga0395901_0225029 Ga0395901_0225029_841_1305 151
347 3300039450 Ga0436363_1386105 Ga0436363_1386105_20_490 151
348 3300041460 Ga0451802_0519616 Ga0451802_0519616_105_560 151
349 3300041486 Ga0451807_2315473 Ga0451807_2315473_373_831 151
350 3300041501 Ga0451845_0128709 Ga0451845_0128709_110_574 151
351 3300042008 Ga0439450_043099 Ga0439450_043099_11_484 151
352 3300042121 Ga0450919_000205 Ga0450919_000205_6019_6486 151
353 3300042122 Ga0450920_018102 Ga0450920_018102_563_1030 151
354 3300042439 Ga0439464_0000491 Ga0439464_0000491_5950_6423 151
355 3300042461 Ga0439460_0019069 Ga0439460_0019069_960_1496 151
356 3300042531 Ga0450918_000001 Ga0450918_000001_28511_28978 151
357 3300042876 Ga0451577_0000068 Ga0451577_0000068_200645_201118 151
358 3300044712 Ga0453684_0000126 Ga0453684_0000126_110596_111069 151
359 3300044712 Ga0453684_0007963 Ga0453684_0007963_15905_16369 151
360 3300044712 Ga0453684_0199547 Ga0453684_0199547_1128_1595 151
361 3300045051 Ga0451576_0003785 Ga0451576_0003785_16072_16545 151
362 3300045051 Ga0451576_1545341 Ga0451576_1545341_191_655 151
363 3300046512 Ga0495610_0032227 Ga0495610_0032227_1577_2041 151
364 3300046518 Ga0495631_0255801 Ga0495631_0255801_183_647 151
365 3300046519 Ga0495632_0006154 Ga0495632_0006154_5952_6416 151
366 3300046528 Ga0495642_0078548 Ga0495642_0078548_248_712 151
367 3300046528 Ga0495642_0095166 Ga0495642_0095166_269_733 151
368 3300046537 Ga0495598_0032442 Ga0495598_0032442_631_1104 151
369 3300046537 Ga0495598_0329568 Ga0495598_0329568_40_510 151
370 3300046615 Ga0495656_0198953 Ga0495656_0198953_473_937 151
371 3300046660 Ga0495625_0356914 Ga0495625_0356914_96_560 151
372 3300046674 Ga0495588_0245478 Ga0495588_0245478_247_711 151
373 3300046681 Ga0495647_0177427 Ga0495647_0177427_428_901 151
374 3300046683 Ga0495658_0401553 Ga0495658_0401553_101_574 151
375 3300046684 Ga0495669_0197893 Ga0495669_0197893_304_768 151
376 3300046694 Ga0495649_0025643 Ga0495649_0025643_2587_3051 151
377 3300046810 Ga0495660_0053001 Ga0495660_0053001_304_768 151
378 3300046810 Ga0495660_0155406 Ga0495660_0155406_166_639 151
379 3300047318 Ga0495636_0397007 Ga0495636_0397007_126_590 151
380 3300047472 Ga0495686_0335500 Ga0495686_0335500_308_772 151
381 3300048091 Ga0495626_0162722 Ga0495626_0162722_313_777 151
382 3300048903 Ga0496100_1462518 Ga0496100_1462518_41_505 151
383 3300048907 Ga0496104_0538767 Ga0496104_0538767_253_726 151
384 3300048907 Ga0496104_0686197 Ga0496104_0686197_363_836 151
385 3300048908 Ga0496105_0098358 Ga0496105_0098358_1515_1988 151
386 3300048911 Ga0496108_0672513 Ga0496108_0672513_155_622 151
387 3300048912 Ga0496109_1227721 Ga0496109_1227721_161_628 151
388 3300048913 Ga0496110_0010648 Ga0496110_0010648_3504_3971 151
389 3300048913 Ga0496110_0536536 Ga0496110_0536536_276_749 151
390 3300048925 Ga0496122_0000320 Ga0496122_0000320_18108_18563 151
391 3300048926 Ga0496123_0000258 Ga0496123_0000258_93251_93706 151
392 3300048927 Ga0496124_0007078 Ga0496124_0007078_5368_5823 151
393 3300048928 Ga0496125_0155342 Ga0496125_0155342_1077_1535 151
394 3300049128 Ga0501308_045179 Ga0501308_045179_130_594 151
395 3300049571 Ga0501034_0908221 Ga0501034_0908221_216_671 151
396 3300049579 Ga0501043_0000075 Ga0501043_0000075_41560_42030 151
397 3300049580 Ga0501046_0000195 Ga0501046_0000195_44192_44662 151
398 3300049581 Ga0501047_0000145 Ga0501047_0000145_41560_42030 151
399 3300049582 Ga0501048_0000999 Ga0501048_0000999_14869_15339 151
400 3300049582 Ga0501048_0896606 Ga0501048_0896606_52_519 151
401 3300049824 Ga0501045_0000705 Ga0501045_0000705_210_680 151
402 3300050490 nmdc:mga03n38_525076_c1 nmdc:mga03n38_525076_c1_123_590 151
403 3300050491 nmdc:mga00v17_277070_c1 nmdc:mga00v17_277070_c1_85_540 151
404 3300050496 nmdc:mga07m45_296533_c1 nmdc:mga07m45_296533_c1_455_910 151
405 3300050509 nmdc:mga0qj67_526396_c1 nmdc:mga0qj67_526396_c1_130_597 151
406 3300053088 Ga0500644_0058838 Ga0500644_0058838_621_1085 151
407 3300053088 Ga0500644_0127452 Ga0500644_0127452_176_631 151
408 3300053090 Ga0500646_0115432 Ga0500646_0115432_149_604 151
409 3300053094 Ga0500566_0080322 Ga0500566_0080322_1192_1647 151
410 3300053096 Ga0500641_0135010 Ga0500641_0135010_486_941 151
411 3300053117 Ga0500593_013624 Ga0500593_013624_1605_2060 151
412 3300053125 Ga0500618_060881 Ga0500618_060881_292_747 151
413 3300053134 Ga0500658_0007842 Ga0500658_0007842_2737_3201 151
414 3300053134 Ga0500658_0088067 Ga0500658_0088067_137_601 151
415 3300053136 Ga0500559_0000695 Ga0500559_0000695_21344_21799 151
416 3300053140 Ga0500573_0018205 Ga0500573_0018205_3079_3534 151
417 3300053723 Ga0500567_128627 Ga0500567_128627_248_703 151
418 3300053724 Ga0500570_172226 Ga0500570_172226_43_498 151
419 3300053730 Ga0500645_000317 Ga0500645_000317_14795_15250 151
420 3300053730 Ga0500645_124360 Ga0500645_124360_20_475 151
421 3300053739 Ga0500587_000438 Ga0500587_000438_543_1007 151
422 3300055283 Ga0500661_007487 Ga0500661_007487_302_757 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

29

87

0.91

PF00571

CBS

CBS domain

97

152

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9376 2 125
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9357 1 123
3fhm-assembly2.cif.gz_C crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9308 2 123
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9277 1 125
3fhm-assembly1.cif.gz_D crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9266 2 123
ID Description Score Start End Superfamily
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9573 1 141 3.10.580.10
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9508 1 141 3.10.580.10
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9376 2 125 3.10.580.10
af_K7KHU5_50_204_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9299 1 140 3.10.580.10
3oi8B01 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9285 83 120 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A257QAV6-F1-model_v4 CBS domain-containing protein 0.9869 1 120
AF-A0A2R7T2X5-F1-model_v4 CBS domain-containing protein 0.9848 1 150
AF-A0A536ZN54-F1-model_v4 CBS domain-containing protein 0.9818 1 139
AF-A0A0L6TDR2-F1-model_v4 CBS domain-containing protein 0.9766 1 151
AF-A0A519FFM2-F1-model_v4 CBS domain-containing protein 0.9762 1 138

Feature Viewer

pLDDT pTM Quality
89.02 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map