F440294
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 422 | 213 | 844 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300025939|Ga0207665_10027447|Ga0207665_100274471 |
| Length | 296 |
| Sequence | VTAGFVQIAGSSTARAASSGSCTGMPDAVRAIAARCAFFWSLATYRTRAFGSPTTTVRQLRQFRVVFPEGFTRAQMVARVQTVAKIAEQESHRKVKLSGTAYAAATAKRRTFPGFGPEKLPLEGFLFPDTYDFDRKSTSAQLVDDQLAEFDSEWSRLNLYARSKNLTPYDVLTIASMVEGEAQVPSERPLVAAVIYNRLHARMPLGIDATLRYGLHVPPTESLTQSDLQNPTPYNTRLHDGLPPTPINNPGMAALEAAAHPAHVDYLYFVRKPDHRHHYFTANYQDFLQHEAQYGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 107 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 112 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 113 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 122 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 123 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 126 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 127 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 128 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 129 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 130 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 131 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 132 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 133 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 13.27 |
| Rhizosphere | 86.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207665_10027447 | 3300025939 | Bacteria | 3762 |
| 2 | rootH2_10002619 | 3300003320 | Bacteria | 1914 |
| 3 | Ga0070658_10058099 | 3300005327 | Bacteria | 3147 |
| 4 | Ga0070683_100092821 | 3300005329 | Bacteria | 2835 |
| 5 | Ga0070690_100063794 | 3300005330 | Bacteria | 2378 |
| 6 | Ga0070680_100074347 | 3300005336 | Bacteria | 2796 |
| 7 | Ga0070680_100079913 | 3300005336 | Bacteria | 2696 |
| 8 | Ga0070682_100238640 | 3300005337 | Bacteria | 1304 |
| 9 | Ga0070660_100125699 | 3300005339 | Bacteria | 2049 |
| 10 | Ga0070691_10090806 | 3300005341 | Bacteria | 1505 |
| 11 | Ga0070661_100017193 | 3300005344 | Bacteria | 5127 |
| 12 | Ga0070692_10024902 | 3300005345 | Bacteria | 2945 |
| 13 | Ga0070671_100183284 | 3300005355 | Bacteria | 1773 |
| 14 | Ga0070659_100039140 | 3300005366 | Bacteria | 3700 |
| 15 | Ga0070709_10298768 | 3300005434 | Bacteria | 1175 |
| 16 | Ga0070714_100034451 | 3300005435 | Bacteria | 4240 |
| 17 | Ga0070714_100055274 | 3300005435 | Bacteria | 3392 |
| 18 | Ga0070714_100179200 | 3300005435 | Bacteria | 1927 |
| 19 | Ga0070714_100410554 | 3300005435 | Bacteria | 1281 |
| 20 | Ga0070713_100041335 | 3300005436 | Bacteria | 3756 |
| 21 | Ga0070713_100137901 | 3300005436 | Bacteria | 2157 |
| 22 | Ga0070713_100579032 | 3300005436 | Unclassified | 1065 |
| 23 | Ga0070711_100077703 | 3300005439 | Bacteria | 2356 |
| 24 | Ga0070700_100028676 | 3300005441 | Bacteria | 3313 |
| 25 | Ga0070694_100102647 | 3300005444 | Bacteria | 2025 |
| 26 | Ga0070708_100128736 | 3300005445 | Bacteria | 2342 |
| 27 | Ga0070663_100229809 | 3300005455 | Bacteria | 1460 |
| 28 | Ga0068867_100103695 | 3300005459 | Bacteria | 2175 |
| 29 | Ga0070707_100001273 | 3300005468 | Bacteria | 24807 |
| 30 | Ga0070679_100223764 | 3300005530 | Bacteria | 1842 |
| 31 | Ga0070679_100257226 | 3300005530 | Bacteria | 1701 |
| 32 | Ga0070684_100159066 | 3300005535 | Bacteria | 2049 |
| 33 | Ga0068853_100230672 | 3300005539 | Bacteria | 1694 |
| 34 | Ga0070686_100024493 | 3300005544 | Bacteria | 3618 |
| 35 | Ga0070695_100000023 | 3300005545 | Bacteria | 60293 |
| 36 | Ga0070696_100037181 | 3300005546 | Bacteria | 3357 |
| 37 | Ga0070704_100119001 | 3300005549 | Bacteria | 2025 |
| 38 | Ga0068857_100479817 | 3300005577 | Bacteria | 1165 |
| 39 | Ga0068854_100055808 | 3300005578 | Bacteria | 2845 |
| 40 | Ga0068856_100068626 | 3300005614 | Bacteria | 3505 |
| 41 | Ga0068856_100250734 | 3300005614 | Bacteria | 1785 |
| 42 | Ga0070702_100012665 | 3300005615 | Bacteria | 4235 |
| 43 | Ga0070702_100174825 | 3300005615 | Bacteria | 1400 |
| 44 | Ga0068852_100136315 | 3300005616 | Bacteria | 2267 |
| 45 | Ga0068866_10038763 | 3300005718 | Bacteria | 2349 |
| 46 | Ga0068860_100408958 | 3300005843 | Bacteria | 1343 |
| 47 | Ga0070717_10064835 | 3300006028 | Bacteria | 3035 |
| 48 | Ga0070717_10068031 | 3300006028 | Bacteria | 2964 |
| 49 | Ga0070717_10088244 | 3300006028 | Bacteria | 2613 |
| 50 | Ga0070715_10001412 | 3300006163 | Bacteria | 6955 |
| 51 | Ga0070716_100008206 | 3300006173 | Bacteria | 5174 |
| 52 | Ga0070712_100259533 | 3300006175 | Bacteria | 1392 |
| 53 | Ga0070712_100317097 | 3300006175 | Bacteria | 1267 |
| 54 | Ga0070712_100318769 | 3300006175 | Bacteria | 1263 |
| 55 | Ga0075433_10154539 | 3300006852 | Unclassified | 2041 |
| 56 | Ga0075434_100000658 | 3300006871 | Bacteria | 26789 |
| 57 | Ga0068865_100076856 | 3300006881 | Bacteria | 2384 |
| 58 | Ga0075436_100209962 | 3300006914 | Unclassified | 1380 |
| 59 | Ga0105240_10045268 | 3300009093 | Bacteria | 5584 |
| 60 | Ga0111539_10622896 | 3300009094 | Unclassified | 1256 |
| 61 | Ga0105245_10158544 | 3300009098 | Bacteria | 2146 |
| 62 | Ga0105245_10449326 | 3300009098 | Bacteria | 1297 |
| 63 | Ga0105245_10493637 | 3300009098 | Bacteria | 1239 |
| 64 | Ga0105243_10118046 | 3300009148 | Bacteria | 2231 |
| 65 | Ga0105242_10050771 | 3300009176 | Bacteria | 3378 |
| 66 | Ga0105242_10071510 | 3300009176 | Bacteria | 2879 |
| 67 | Ga0105248_10091316 | 3300009177 | Bacteria | 3430 |
| 68 | Ga0105248_10235571 | 3300009177 | Bacteria | 2061 |
| 69 | Ga0105238_10201435 | 3300009551 | Bacteria | 1966 |
| 70 | Ga0157374_10077705 | 3300013296 | Bacteria | 3142 |
| 71 | Ga0163162_10264906 | 3300013306 | Bacteria | 1850 |
| 72 | Ga0157372_10214990 | 3300013307 | Bacteria | 2228 |
| 73 | Ga0157375_10413009 | 3300013308 | Bacteria | 1516 |
| 74 | Ga0157380_10101016 | 3300014326 | Bacteria | 2402 |
| 75 | Ga0157377_10260167 | 3300014745 | Bacteria | 1129 |
| 76 | Ga0182007_10032324 | 3300015262 | Bacteria | 1777 |
| 77 | Ga0206356_10924052 | 3300020070 | Bacteria | 1300 |
| 78 | Ga0224712_10147637 | 3300022467 | Bacteria | 1040 |
| 79 | Ga0207692_10002750 | 3300025898 | Bacteria | 6778 |
| 80 | Ga0207642_10051944 | 3300025899 | Bacteria | 1857 |
| 81 | Ga0207680_10148306 | 3300025903 | Bacteria | 1562 |
| 82 | Ga0207685_10006220 | 3300025905 | Bacteria | 3232 |
| 83 | Ga0207699_10023919 | 3300025906 | Bacteria | 3332 |
| 84 | Ga0207699_10142745 | 3300025906 | Bacteria | 1575 |
| 85 | Ga0207699_10356722 | 3300025906 | Bacteria | 1033 |
| 86 | Ga0207705_10222743 | 3300025909 | Bacteria | 1433 |
| 87 | Ga0207707_10059662 | 3300025912 | Bacteria | 3319 |
| 88 | Ga0207707_10408385 | 3300025912 | Bacteria | 1165 |
| 89 | Ga0207693_10000198 | 3300025915 | Bacteria | 54576 |
| 90 | Ga0207693_10002750 | 3300025915 | Bacteria | 15234 |
| 91 | Ga0207693_10201662 | 3300025915 | Bacteria | 1564 |
| 92 | Ga0207693_10229663 | 3300025915 | Unclassified | 1457 |
| 93 | Ga0207663_10012568 | 3300025916 | Bacteria | 4581 |
| 94 | Ga0207660_10092387 | 3300025917 | Bacteria | 2246 |
| 95 | Ga0207657_10090975 | 3300025919 | Bacteria | 2546 |
| 96 | Ga0207657_10100047 | 3300025919 | Bacteria | 2408 |
| 97 | Ga0207652_10189191 | 3300025921 | Bacteria | 1851 |
| 98 | Ga0207652_10189529 | 3300025921 | Bacteria | 1850 |
| 99 | Ga0207652_10267078 | 3300025921 | Bacteria | 1543 |
| 100 | Ga0207652_10306816 | 3300025921 | Bacteria | 1433 |
| 101 | Ga0207646_10004655 | 3300025922 | Bacteria | 14797 |
| 102 | Ga0207694_10138436 | 3300025924 | Bacteria | 1956 |
| 103 | Ga0207687_10156559 | 3300025927 | Bacteria | 1744 |
| 104 | Ga0207700_10251063 | 3300025928 | Bacteria | 1511 |
| 105 | Ga0207700_10542943 | 3300025928 | Unclassified | 1031 |
| 106 | Ga0207664_10005271 | 3300025929 | Bacteria | 8832 |
| 107 | Ga0207664_10019721 | 3300025929 | Bacteria | 4989 |
| 108 | Ga0207664_10062624 | 3300025929 | Bacteria | 2971 |
| 109 | Ga0207664_10184350 | 3300025929 | Bacteria | 1793 |
| 110 | Ga0207644_10306861 | 3300025931 | Bacteria | 1280 |
| 111 | Ga0207706_10011285 | 3300025933 | Bacteria | 8142 |
| 112 | Ga0207686_10139006 | 3300025934 | Bacteria | 1676 |
| 113 | Ga0207686_10258693 | 3300025934 | Bacteria | 1275 |
| 114 | Ga0207709_10078658 | 3300025935 | Bacteria | 2118 |
| 115 | Ga0207704_10355403 | 3300025938 | Bacteria | 1142 |
| 116 | Ga0207665_10000197 | 3300025939 | Bacteria | 40246 |
| 117 | Ga0207661_10053811 | 3300025944 | Bacteria | 3223 |
| 118 | Ga0207661_10057121 | 3300025944 | Bacteria | 3137 |
| 119 | Ga0207661_10591583 | 3300025944 | Bacteria | 1018 |
| 120 | Ga0207667_10184611 | 3300025949 | Bacteria | 2141 |
| 121 | Ga0207640_10067583 | 3300025981 | Bacteria | 2392 |
| 122 | Ga0207677_10161246 | 3300026023 | Bacteria | 1742 |
| 123 | Ga0207677_10307271 | 3300026023 | Bacteria | 1312 |
| 124 | Ga0207639_10556947 | 3300026041 | Bacteria | 1053 |
| 125 | Ga0207708_10009298 | 3300026075 | Bacteria | 7276 |
| 126 | Ga0207702_10134650 | 3300026078 | Unclassified | 2228 |
| 127 | Ga0207702_10175004 | 3300026078 | Bacteria | 1971 |
| 128 | Ga0207676_10069295 | 3300026095 | Bacteria | 2824 |
| 129 | Ga0207675_100031924 | 3300026118 | Bacteria | 4907 |
| 130 | Ga0207698_10138311 | 3300026142 | Bacteria | 2093 |
| 131 | Ga0207698_10417109 | 3300026142 | Bacteria | 1287 |
| 132 | Ga0207428_10343976 | 3300027907 | Bacteria | 1098 |
| 133 | Ga0268265_10131489 | 3300028380 | Bacteria | 2081 |
| 134 | Ga0268264_10054982 | 3300028381 | Bacteria | 3326 |
| 135 | Ga0265318_10028732 | 3300028577 | Bacteria | 2173 |
| 136 | Ga0265336_10007899 | 3300028666 | Bacteria | 3758 |
| 137 | Ga0265338_10015845 | 3300028800 | Bacteria | 8252 |
| 138 | Ga0265338_10059001 | 3300028800 | Bacteria | 3382 |
| 139 | Ga0265338_10060618 | 3300028800 | Bacteria | 3323 |
| 140 | Ga0265338_10148475 | 3300028800 | Bacteria | 1825 |
| 141 | Ga0265325_10147291 | 3300031241 | Archaea | 1116 |
| 142 | Ga0265339_10004983 | 3300031249 | Bacteria | 8940 |
| 143 | Ga0265327_10014374 | 3300031251 | Bacteria | 5183 |
| 144 | Ga0265327_10036784 | 3300031251 | Bacteria | 2687 |
| 145 | Ga0265313_10025024 | 3300031595 | Bacteria | 3174 |
| 146 | Ga0265314_10005893 | 3300031711 | Bacteria | 10961 |
| 147 | Ga0265342_10116591 | 3300031712 | Bacteria | 1507 |
| 148 | Ga0373926_0022931 | 3300035083 | Bacteria | 2166 |
| 149 | Ga0373944_0000745 | 3300035089 | Bacteria | 7920 |
| 150 | Ga0373945_0022073 | 3300035116 | Bacteria | 2190 |
| 151 | Ga0373943_0003173 | 3300035170 | Bacteria | 7463 |
| 152 | Ga0373943_0008965 | 3300035170 | Bacteria | 4484 |
| 153 | Ga0373946_0009349 | 3300035171 | Bacteria | 3609 |
| 154 | Ga0373924_0081138 | 3300035410 | Bacteria | 1380 |
| 155 | Ga0373927_0180868 | 3300035695 | Bacteria | 1383 |
| 156 | Ga0373947_0001279 | 3300035725 | Bacteria | 15509 |
| 157 | Ga0373947_0006134 | 3300035725 | Bacteria | 6992 |
| 158 | Ga0373937_0006653 | 3300036401 | Bacteria | 9974 |
| 159 | Ga0373925_0001456 | 3300037068 | Bacteria | 20442 |
| 160 | Ga0373925_0031307 | 3300037068 | Bacteria | 3908 |
| 161 | Ga0395899_0004144 | 3300037312 | Bacteria | 11391 |
| 162 | Ga0395900_0002083 | 3300037418 | Bacteria | 22427 |
| 163 | Ga0395900_0153060 | 3300037418 | Bacteria | 2356 |
| 164 | Ga0395898_0007988 | 3300037466 | Bacteria | 11225 |
| 165 | Ga0395898_0010279 | 3300037466 | Bacteria | 9794 |
| 166 | Ga0395898_0017353 | 3300037466 | Bacteria | 7353 |
| 167 | Ga0395898_0060783 | 3300037466 | Bacteria | 3671 |
| 168 | Ga0395905_0006934 | 3300037471 | Bacteria | 11329 |
| 169 | Ga0395901_0000793 | 3300038443 | Bacteria | 35158 |
| 170 | Ga0395901_0550241 | 3300038443 | Bacteria | 1169 |
| 171 | Ga0436360_0893357 | 3300039438 | Bacteria | 2166 |
| 172 | Ga0466969_0001820 | 3300044656 | Bacteria | 11388 |
| 173 | Ga0466969_0118409 | 3300044656 | Bacteria | 1235 |
| 174 | Ga0466969_0188085 | 3300044656 | Bacteria | 944 |
| 175 | Ga0466965_0011872 | 3300044683 | Bacteria | 4090 |
| 176 | Ga0466965_0048549 | 3300044683 | Bacteria | 2103 |
| 177 | Ga0466966_0032230 | 3300044684 | Bacteria | 3398 |
| 178 | Ga0466966_0034581 | 3300044684 | Bacteria | 3267 |
| 179 | Ga0466966_0076416 | 3300044684 | Bacteria | 2091 |
| 180 | Ga0466966_0091299 | 3300044684 | Bacteria | 1890 |
| 181 | Ga0466961_0006902 | 3300044693 | Bacteria | 7223 |
| 182 | Ga0466961_0107592 | 3300044693 | Bacteria | 1755 |
| 183 | Ga0466961_0142307 | 3300044693 | Bacteria | 1501 |
| 184 | Ga0466961_0210161 | 3300044693 | Bacteria | 1201 |
| 185 | Ga0466963_0000518 | 3300044694 | Bacteria | 18034 |
| 186 | Ga0466963_0003671 | 3300044694 | Bacteria | 8831 |
| 187 | Ga0466963_0007134 | 3300044694 | Bacteria | 6659 |
| 188 | Ga0466963_0009767 | 3300044694 | Bacteria | 5788 |
| 189 | Ga0466963_0010487 | 3300044694 | Bacteria | 5610 |
| 190 | Ga0466963_0032715 | 3300044694 | Bacteria | 3369 |
| 191 | Ga0466963_0042630 | 3300044694 | Bacteria | 2980 |
| 192 | Ga0466963_0043332 | 3300044694 | Bacteria | 2958 |
| 193 | Ga0466963_0053273 | 3300044694 | Bacteria | 2686 |
| 194 | Ga0466963_0154148 | 3300044694 | Bacteria | 1596 |
| 195 | Ga0466964_0001506 | 3300044706 | Bacteria | 8002 |
| 196 | Ga0466964_0003774 | 3300044706 | Bacteria | 5556 |
| 197 | Ga0466964_0006409 | 3300044706 | Bacteria | 4385 |
| 198 | Ga0466964_0019584 | 3300044706 | Bacteria | 2602 |
| 199 | Ga0466964_0052725 | 3300044706 | Bacteria | 1672 |
| 200 | Ga0466971_0004434 | 3300044719 | Bacteria | 6058 |
| 201 | Ga0466971_0046625 | 3300044719 | Bacteria | 1948 |
| 202 | Ga0466971_0058221 | 3300044719 | Bacteria | 1744 |
| 203 | Ga0466971_0099862 | 3300044719 | Bacteria | 1333 |
| 204 | Ga0466968_0011483 | 3300044735 | Bacteria | 3451 |
| 205 | Ga0466968_0012530 | 3300044735 | Bacteria | 3322 |
| 206 | Ga0466968_0030579 | 3300044735 | Bacteria | 2231 |
| 207 | Ga0466968_0032179 | 3300044735 | Bacteria | 2180 |
| 208 | Ga0466968_0036551 | 3300044735 | Bacteria | 2058 |
| 209 | Ga0466970_0005115 | 3300044765 | Bacteria | 6477 |
| 210 | Ga0466970_0131420 | 3300044765 | Bacteria | 1375 |
| 211 | Ga0466957_0005617 | 3300044842 | Bacteria | 7050 |
| 212 | Ga0466957_0093703 | 3300044842 | Bacteria | 1885 |
| 213 | Ga0466957_0187506 | 3300044842 | Bacteria | 1353 |
| 214 | Ga0466957_0601925 | 3300044842 | Bacteria | 769 |
| 215 | Ga0466959_0009634 | 3300045049 | Bacteria | 6873 |
| 216 | Ga0466959_0013448 | 3300045049 | Bacteria | 5931 |
| 217 | Ga0466959_0018185 | 3300045049 | Bacteria | 5159 |
| 218 | Ga0466959_0032823 | 3300045049 | Bacteria | 3842 |
| 219 | Ga0466959_0082043 | 3300045049 | Bacteria | 2323 |
| 220 | Ga0466959_0204948 | 3300045049 | Bacteria | 1372 |
| 221 | Ga0466958_0001119 | 3300045836 | Bacteria | 12370 |
| 222 | Ga0466958_0005138 | 3300045836 | Bacteria | 6995 |
| 223 | Ga0466958_0016400 | 3300045836 | Bacteria | 4265 |
| 224 | Ga0466958_0020512 | 3300045836 | Bacteria | 3855 |
| 225 | Ga0466958_0026055 | 3300045836 | Bacteria | 3453 |
| 226 | Ga0466958_0108674 | 3300045836 | Bacteria | 1730 |
| 227 | Ga0466958_0224978 | 3300045836 | Bacteria | 1197 |
| 228 | Ga0466967_0002011 | 3300045976 | Bacteria | 12384 |
| 229 | Ga0466967_0002633 | 3300045976 | Bacteria | 11303 |
| 230 | Ga0466967_0003534 | 3300045976 | Bacteria | 10229 |
| 231 | Ga0466967_0012538 | 3300045976 | Bacteria | 6490 |
| 232 | Ga0466967_0021821 | 3300045976 | Bacteria | 5210 |
| 233 | Ga0466967_0041075 | 3300045976 | Bacteria | 3985 |
| 234 | Ga0466967_0048323 | 3300045976 | Bacteria | 3714 |
| 235 | Ga0466967_0131348 | 3300045976 | Bacteria | 2325 |
| 236 | Ga0466967_0135298 | 3300045976 | Bacteria | 2291 |
| 237 | Ga0466967_0173359 | 3300045976 | Bacteria | 2031 |
| 238 | Ga0466967_0356466 | 3300045976 | Bacteria | 1416 |
| 239 | Ga0466967_0485727 | 3300045976 | Bacteria | 1210 |
| 240 | Ga0466967_0583096 | 3300045976 | Bacteria | 1102 |
| 241 | Ga0495592_0000597 | 3300046454 | Bacteria | 25448 |
| 242 | Ga0495592_0005696 | 3300046454 | Bacteria | 9216 |
| 243 | Ga0495592_0106460 | 3300046454 | Bacteria | 1990 |
| 244 | Ga0495603_0000450 | 3300046455 | Bacteria | 22609 |
| 245 | Ga0495603_0013278 | 3300046455 | Bacteria | 4980 |
| 246 | Ga0495629_0007112 | 3300046459 | Bacteria | 8244 |
| 247 | Ga0495629_0265586 | 3300046459 | Bacteria | 1179 |
| 248 | Ga0495641_0001513 | 3300046461 | Bacteria | 19794 |
| 249 | Ga0495641_0005148 | 3300046461 | Bacteria | 8947 |
| 250 | Ga0495641_0158417 | 3300046461 | Bacteria | 1012 |
| 251 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 252 | Ga0495651_0022741 | 3300046462 | Bacteria | 4873 |
| 253 | Ga0495653_0000725 | 3300046463 | Bacteria | 25130 |
| 254 | Ga0495653_0018297 | 3300046463 | Bacteria | 5693 |
| 255 | Ga0495580_0006863 | 3300046472 | Bacteria | 9209 |
| 256 | Ga0495580_0210642 | 3300046472 | Bacteria | 1337 |
| 257 | Ga0495582_0000711 | 3300046473 | Bacteria | 18383 |
| 258 | Ga0495582_0006254 | 3300046473 | Bacteria | 6636 |
| 259 | Ga0495582_0010487 | 3300046473 | Bacteria | 5097 |
| 260 | Ga0495639_0000520 | 3300046475 | Bacteria | 18060 |
| 261 | Ga0495662_0006328 | 3300046476 | Bacteria | 5918 |
| 262 | Ga0495662_0101936 | 3300046476 | Bacteria | 1404 |
| 263 | Ga0495664_0002367 | 3300046477 | Bacteria | 10105 |
| 264 | Ga0495664_0117524 | 3300046477 | Bacteria | 1607 |
| 265 | Ga0495584_0031793 | 3300046491 | Bacteria | 2671 |
| 266 | Ga0495594_0001436 | 3300046499 | Bacteria | 12355 |
| 267 | Ga0495594_0019684 | 3300046499 | Bacteria | 3590 |
| 268 | Ga0495607_0074846 | 3300046501 | Bacteria | 1878 |
| 269 | Ga0495608_0000957 | 3300046511 | Bacteria | 20357 |
| 270 | Ga0495608_0021667 | 3300046511 | Bacteria | 4411 |
| 271 | Ga0495608_0214018 | 3300046511 | Bacteria | 1211 |
| 272 | Ga0495618_0002854 | 3300046514 | Bacteria | 10943 |
| 273 | Ga0495618_0088297 | 3300046514 | Bacteria | 1983 |
| 274 | Ga0495628_0000105 | 3300046516 | Bacteria | 68159 |
| 275 | Ga0495628_0030882 | 3300046516 | Bacteria | 4335 |
| 276 | Ga0495628_0266475 | 3300046516 | Bacteria | 1275 |
| 277 | Ga0495630_0001692 | 3300046517 | Bacteria | 15385 |
| 278 | Ga0495630_0105121 | 3300046517 | Bacteria | 2137 |
| 279 | Ga0495630_0411189 | 3300046517 | Bacteria | 1037 |
| 280 | Ga0495644_0003055 | 3300046523 | Bacteria | 6626 |
| 281 | Ga0495663_0011608 | 3300046525 | Bacteria | 2451 |
| 282 | Ga0495666_0000272 | 3300046526 | Bacteria | 22361 |
| 283 | Ga0495666_0015797 | 3300046526 | Bacteria | 3761 |
| 284 | Ga0495652_0001221 | 3300046529 | Bacteria | 28813 |
| 285 | Ga0495652_0052130 | 3300046529 | Bacteria | 3491 |
| 286 | Ga0495652_0178785 | 3300046529 | Bacteria | 1630 |
| 287 | Ga0495665_0001436 | 3300046531 | Bacteria | 12777 |
| 288 | Ga0495640_0019015 | 3300046533 | Bacteria | 5079 |
| 289 | Ga0495640_0023975 | 3300046533 | Bacteria | 4439 |
| 290 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 291 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 292 | Ga0495645_0049780 | 3300046543 | Bacteria | 3051 |
| 293 | Ga0495645_0068402 | 3300046543 | Unclassified | 2564 |
| 294 | Ga0495645_0131449 | 3300046543 | Bacteria | 1753 |
| 295 | Ga0495656_0072590 | 3300046615 | Bacteria | 1532 |
| 296 | Ga0495634_0014004 | 3300046642 | Bacteria | 5790 |
| 297 | Ga0495635_0012512 | 3300046663 | Bacteria | 5944 |
| 298 | Ga0495635_0017299 | 3300046663 | Bacteria | 5036 |
| 299 | Ga0495635_0033068 | 3300046663 | Bacteria | 3588 |
| 300 | Ga0495635_0158161 | 3300046663 | Bacteria | 1542 |
| 301 | Ga0495661_0069750 | 3300046665 | Bacteria | 2059 |
| 302 | Ga0495588_0000857 | 3300046674 | Bacteria | 13453 |
| 303 | Ga0495657_0089314 | 3300046675 | Bacteria | 1980 |
| 304 | Ga0495657_0109638 | 3300046675 | Bacteria | 1750 |
| 305 | Ga0495599_0000110 | 3300046678 | Bacteria | 55240 |
| 306 | Ga0495599_0003982 | 3300046678 | Bacteria | 8700 |
| 307 | Ga0495599_0104400 | 3300046678 | Bacteria | 1765 |
| 308 | Ga0495623_0000379 | 3300046679 | Bacteria | 29118 |
| 309 | Ga0495623_0052484 | 3300046679 | Bacteria | 2576 |
| 310 | Ga0495646_0002891 | 3300046680 | Bacteria | 10637 |
| 311 | Ga0495646_0021855 | 3300046680 | Bacteria | 4041 |
| 312 | Ga0495646_0055229 | 3300046680 | Unclassified | 2386 |
| 313 | Ga0495646_0134063 | 3300046680 | Unclassified | 1392 |
| 314 | Ga0495647_0000245 | 3300046681 | Bacteria | 14888 |
| 315 | Ga0495658_0000675 | 3300046683 | Bacteria | 18488 |
| 316 | Ga0495658_0005244 | 3300046683 | Bacteria | 6380 |
| 317 | Ga0495658_0173671 | 3300046683 | Bacteria | 1335 |
| 318 | Ga0495658_0334604 | 3300046683 | Bacteria | 961 |
| 319 | Ga0495613_0006283 | 3300046689 | Bacteria | 8885 |
| 320 | Ga0495613_0061151 | 3300046689 | Bacteria | 2758 |
| 321 | Ga0495624_0008345 | 3300046690 | Bacteria | 7232 |
| 322 | Ga0495670_0084327 | 3300046691 | Bacteria | 1621 |
| 323 | Ga0495589_0231088 | 3300046794 | Bacteria | 867 |
| 324 | Ga0495600_0115302 | 3300046809 | Bacteria | 1749 |
| 325 | Ga0495600_0127944 | 3300046809 | Bacteria | 1651 |
| 326 | Ga0495581_0002214 | 3300047315 | Bacteria | 10948 |
| 327 | Ga0495604_0000687 | 3300047317 | Bacteria | 28670 |
| 328 | Ga0495604_0110332 | 3300047317 | Bacteria | 2007 |
| 329 | Ga0495636_0123016 | 3300047318 | Bacteria | 1149 |
| 330 | Ga0495674_0019362 | 3300047319 | Bacteria | 6316 |
| 331 | Ga0495674_0752078 | 3300047319 | Bacteria | 761 |
| 332 | Ga0495676_0000602 | 3300047321 | Bacteria | 29783 |
| 333 | Ga0495676_0019704 | 3300047321 | Bacteria | 5930 |
| 334 | Ga0495676_0173647 | 3300047321 | Bacteria | 1515 |
| 335 | Ga0495676_0308307 | 3300047321 | Bacteria | 1066 |
| 336 | Ga0495680_0016904 | 3300047322 | Bacteria | 6247 |
| 337 | Ga0495680_0054513 | 3300047322 | Bacteria | 3104 |
| 338 | Ga0495680_0080700 | 3300047322 | Bacteria | 2458 |
| 339 | Ga0495680_0268779 | 3300047322 | Bacteria | 1204 |
| 340 | Ga0495675_0000419 | 3300047444 | Bacteria | 28791 |
| 341 | Ga0495675_0159486 | 3300047444 | Bacteria | 1389 |
| 342 | Ga0495684_0033445 | 3300047471 | Bacteria | 3942 |
| 343 | Ga0495593_0000863 | 3300047673 | Bacteria | 17564 |
| 344 | Ga0495602_0001409 | 3300048088 | Bacteria | 23791 |
| 345 | Ga0495602_0107451 | 3300048088 | Bacteria | 2274 |
| 346 | Ga0495602_0158333 | 3300048088 | Bacteria | 1771 |
| 347 | Ga0495602_0244323 | 3300048088 | Bacteria | 1341 |
| 348 | Ga0495614_0000132 | 3300048089 | Bacteria | 26286 |
| 349 | Ga0496100_0015416 | 3300048903 | Bacteria | 4463 |
| 350 | Ga0496100_0178555 | 3300048903 | Bacteria | 1534 |
| 351 | Ga0496101_0023909 | 3300048904 | Bacteria | 4224 |
| 352 | Ga0496101_0060651 | 3300048904 | Bacteria | 2745 |
| 353 | Ga0496101_0076021 | 3300048904 | Bacteria | 2473 |
| 354 | Ga0496101_0105705 | 3300048904 | Unclassified | 2113 |
| 355 | Ga0496102_0005223 | 3300048905 | Bacteria | 11027 |
| 356 | Ga0496102_0031913 | 3300048905 | Bacteria | 4729 |
| 357 | Ga0496102_0393602 | 3300048905 | Bacteria | 1303 |
| 358 | Ga0496102_0707407 | 3300048905 | Unclassified | 930 |
| 359 | Ga0496103_0011456 | 3300048906 | Bacteria | 5256 |
| 360 | Ga0496103_0082527 | 3300048906 | Bacteria | 2023 |
| 361 | Ga0496104_0000977 | 3300048907 | Bacteria | 24462 |
| 362 | Ga0496104_0183359 | 3300048907 | Bacteria | 2003 |
| 363 | Ga0496104_0199570 | 3300048907 | Unclassified | 1912 |
| 364 | Ga0496104_0214751 | 3300048907 | Unclassified | 1835 |
| 365 | Ga0496104_0450847 | 3300048907 | Bacteria | 1198 |
| 366 | Ga0496105_0000926 | 3300048908 | Bacteria | 19982 |
| 367 | Ga0496105_0002654 | 3300048908 | Bacteria | 13026 |
| 368 | Ga0496105_0006724 | 3300048908 | Bacteria | 8845 |
| 369 | Ga0496105_0044751 | 3300048908 | Bacteria | 3651 |
| 370 | Ga0496105_0250294 | 3300048908 | Bacteria | 1436 |
| 371 | Ga0496106_0015040 | 3300048909 | Bacteria | 5726 |
| 372 | Ga0496106_0021116 | 3300048909 | Bacteria | 4834 |
| 373 | Ga0496107_0002059 | 3300048910 | Bacteria | 12861 |
| 374 | Ga0496107_0054403 | 3300048910 | Bacteria | 2888 |
| 375 | Ga0496107_0155304 | 3300048910 | Bacteria | 1694 |
| 376 | Ga0496108_0000272 | 3300048911 | Bacteria | 44414 |
| 377 | Ga0496108_0009090 | 3300048911 | Bacteria | 8046 |
| 378 | Ga0496108_0026913 | 3300048911 | Bacteria | 4746 |
| 379 | Ga0496109_0000857 | 3300048912 | Bacteria | 25402 |
| 380 | Ga0496109_0001789 | 3300048912 | Bacteria | 17869 |
| 381 | Ga0496109_0033432 | 3300048912 | Bacteria | 4626 |
| 382 | Ga0496109_0101175 | 3300048912 | Bacteria | 2674 |
| 383 | Ga0496109_0164918 | 3300048912 | Bacteria | 2077 |
| 384 | Ga0496109_0350589 | 3300048912 | Bacteria | 1394 |
| 385 | Ga0496110_0001545 | 3300048913 | Bacteria | 16749 |
| 386 | Ga0496110_0043887 | 3300048913 | Bacteria | 3904 |
| 387 | Ga0496110_0136621 | 3300048913 | Unclassified | 2216 |
| 388 | Ga0496111_0001182 | 3300048914 | Bacteria | 14531 |
| 389 | Ga0496111_0036168 | 3300048914 | Bacteria | 3530 |
| 390 | Ga0496112_0104556 | 3300048915 | Bacteria | 2801 |
| 391 | Ga0496112_0446193 | 3300048915 | Bacteria | 1232 |
| 392 | Ga0496113_0000040 | 3300048916 | Bacteria | 55517 |
| 393 | Ga0496113_0024226 | 3300048916 | Bacteria | 4310 |
| 394 | Ga0496113_0087826 | 3300048916 | Bacteria | 2391 |
| 395 | Ga0496114_0005892 | 3300048917 | Bacteria | 9631 |
| 396 | Ga0496114_0007326 | 3300048917 | Bacteria | 8714 |
| 397 | Ga0496114_0018200 | 3300048917 | Bacteria | 5677 |
| 398 | Ga0496114_0045607 | 3300048917 | Bacteria | 3642 |
| 399 | Ga0496114_0162039 | 3300048917 | Bacteria | 1945 |
| 400 | Ga0496115_0003551 | 3300048918 | Bacteria | 11223 |
| 401 | Ga0496115_0010558 | 3300048918 | Bacteria | 6905 |
| 402 | Ga0496115_0068569 | 3300048918 | Bacteria | 2872 |
| 403 | Ga0496115_0177084 | 3300048918 | Bacteria | 1763 |
| 404 | Ga0496115_0341672 | 3300048918 | Bacteria | 1222 |
| 405 | Ga0501067_0043622 | 3300049583 | Bacteria | 2491 |
| 406 | Ga0501069_0030406 | 3300049585 | Bacteria | 2965 |
| 407 | Ga0501069_0086386 | 3300049585 | Unclassified | 1771 |
| 408 | Ga0501070_0001183 | 3300049586 | Bacteria | 23311 |
| 409 | nmdc:mga0n895_7957_c1 | 3300050512 | Bacteria | 9142 |
| 410 | nmdc:mga0a205_190057_c1 | 3300050515 | Unclassified | 1946 |
| 411 | Ga0495601_0000340 | 3300053077 | Bacteria | 24567 |
| 412 | Ga0495601_0021067 | 3300053077 | Bacteria | 3988 |
| 413 | Ga0495612_0010731 | 3300053078 | Bacteria | 3699 |
| 414 | Ga0495612_0014591 | 3300053078 | Bacteria | 3158 |
| 415 | Ga0495612_0026566 | 3300053078 | Unclassified | 2326 |
| 416 | Ga0495595_0008985 | 3300053084 | Bacteria | 4123 |
| 417 | Ga0495619_0001752 | 3300053085 | Bacteria | 14426 |
| 418 | Ga0495619_0009906 | 3300053085 | Bacteria | 6004 |
| 419 | Ga0466962_0003363 | 3300061719 | Bacteria | 7608 |
| 420 | Ga0466962_0007664 | 3300061719 | Bacteria | 5172 |
| 421 | Ga0466962_0041062 | 3300061719 | Bacteria | 2214 |
| 422 | Ga0466962_0081444 | 3300061719 | Bacteria | 1548 |
| 423 | Ga0207665_10027447 | |||
| 424 | rootH2_10002619 | |||
| 425 | Ga0070658_10058099 | |||
| 426 | Ga0070683_100092821 | |||
| 427 | Ga0070690_100063794 | |||
| 428 | Ga0070680_100074347 | |||
| 429 | Ga0070680_100079913 | |||
| 430 | Ga0070682_100238640 | |||
| 431 | Ga0070660_100125699 | |||
| 432 | Ga0070691_10090806 | |||
| 433 | Ga0070661_100017193 | |||
| 434 | Ga0070692_10024902 | |||
| 435 | Ga0070671_100183284 | |||
| 436 | Ga0070659_100039140 | |||
| 437 | Ga0070709_10298768 | |||
| 438 | Ga0070714_100034451 | |||
| 439 | Ga0070714_100055274 | |||
| 440 | Ga0070714_100179200 | |||
| 441 | Ga0070714_100410554 | |||
| 442 | Ga0070713_100041335 | |||
| 443 | Ga0070713_100137901 | |||
| 444 | Ga0070713_100579032 | |||
| 445 | Ga0070711_100077703 | |||
| 446 | Ga0070700_100028676 | |||
| 447 | Ga0070694_100102647 | |||
| 448 | Ga0070708_100128736 | |||
| 449 | Ga0070663_100229809 | |||
| 450 | Ga0068867_100103695 | |||
| 451 | Ga0070707_100001273 | |||
| 452 | Ga0070679_100223764 | |||
| 453 | Ga0070679_100257226 | |||
| 454 | Ga0070684_100159066 | |||
| 455 | Ga0068853_100230672 | |||
| 456 | Ga0070686_100024493 | |||
| 457 | Ga0070695_100000023 | |||
| 458 | Ga0070696_100037181 | |||
| 459 | Ga0070704_100119001 | |||
| 460 | Ga0068857_100479817 | |||
| 461 | Ga0068854_100055808 | |||
| 462 | Ga0068856_100068626 | |||
| 463 | Ga0068856_100250734 | |||
| 464 | Ga0070702_100012665 | |||
| 465 | Ga0070702_100174825 | |||
| 466 | Ga0068852_100136315 | |||
| 467 | Ga0068866_10038763 | |||
| 468 | Ga0068860_100408958 | |||
| 469 | Ga0070717_10064835 | |||
| 470 | Ga0070717_10068031 | |||
| 471 | Ga0070717_10088244 | |||
| 472 | Ga0070715_10001412 | |||
| 473 | Ga0070716_100008206 | |||
| 474 | Ga0070712_100259533 | |||
| 475 | Ga0070712_100317097 | |||
| 476 | Ga0070712_100318769 | |||
| 477 | Ga0075433_10154539 | |||
| 478 | Ga0075434_100000658 | |||
| 479 | Ga0068865_100076856 | |||
| 480 | Ga0075436_100209962 | |||
| 481 | Ga0105240_10045268 | |||
| 482 | Ga0111539_10622896 | |||
| 483 | Ga0105245_10158544 | |||
| 484 | Ga0105245_10449326 | |||
| 485 | Ga0105245_10493637 | |||
| 486 | Ga0105243_10118046 | |||
| 487 | Ga0105242_10050771 | |||
| 488 | Ga0105242_10071510 | |||
| 489 | Ga0105248_10091316 | |||
| 490 | Ga0105248_10235571 | |||
| 491 | Ga0105238_10201435 | |||
| 492 | Ga0157374_10077705 | |||
| 493 | Ga0163162_10264906 | |||
| 494 | Ga0157372_10214990 | |||
| 495 | Ga0157375_10413009 | |||
| 496 | Ga0157380_10101016 | |||
| 497 | Ga0157377_10260167 | |||
| 498 | Ga0182007_10032324 | |||
| 499 | Ga0206356_10924052 | |||
| 500 | Ga0224712_10147637 | |||
| 501 | Ga0207692_10002750 | |||
| 502 | Ga0207642_10051944 | |||
| 503 | Ga0207680_10148306 | |||
| 504 | Ga0207685_10006220 | |||
| 505 | Ga0207699_10023919 | |||
| 506 | Ga0207699_10142745 | |||
| 507 | Ga0207699_10356722 | |||
| 508 | Ga0207705_10222743 | |||
| 509 | Ga0207707_10059662 | |||
| 510 | Ga0207707_10408385 | |||
| 511 | Ga0207693_10000198 | |||
| 512 | Ga0207693_10002750 | |||
| 513 | Ga0207693_10201662 | |||
| 514 | Ga0207693_10229663 | |||
| 515 | Ga0207663_10012568 | |||
| 516 | Ga0207660_10092387 | |||
| 517 | Ga0207657_10090975 | |||
| 518 | Ga0207657_10100047 | |||
| 519 | Ga0207652_10189191 | |||
| 520 | Ga0207652_10189529 | |||
| 521 | Ga0207652_10267078 | |||
| 522 | Ga0207652_10306816 | |||
| 523 | Ga0207646_10004655 | |||
| 524 | Ga0207694_10138436 | |||
| 525 | Ga0207687_10156559 | |||
| 526 | Ga0207700_10251063 | |||
| 527 | Ga0207700_10542943 | |||
| 528 | Ga0207664_10005271 | |||
| 529 | Ga0207664_10019721 | |||
| 530 | Ga0207664_10062624 | |||
| 531 | Ga0207664_10184350 | |||
| 532 | Ga0207644_10306861 | |||
| 533 | Ga0207706_10011285 | |||
| 534 | Ga0207686_10139006 | |||
| 535 | Ga0207686_10258693 | |||
| 536 | Ga0207709_10078658 | |||
| 537 | Ga0207704_10355403 | |||
| 538 | Ga0207665_10000197 | |||
| 539 | Ga0207661_10053811 | |||
| 540 | Ga0207661_10057121 | |||
| 541 | Ga0207661_10591583 | |||
| 542 | Ga0207667_10184611 | |||
| 543 | Ga0207640_10067583 | |||
| 544 | Ga0207677_10161246 | |||
| 545 | Ga0207677_10307271 | |||
| 546 | Ga0207639_10556947 | |||
| 547 | Ga0207708_10009298 | |||
| 548 | Ga0207702_10134650 | |||
| 549 | Ga0207702_10175004 | |||
| 550 | Ga0207676_10069295 | |||
| 551 | Ga0207675_100031924 | |||
| 552 | Ga0207698_10138311 | |||
| 553 | Ga0207698_10417109 | |||
| 554 | Ga0207428_10343976 | |||
| 555 | Ga0268265_10131489 | |||
| 556 | Ga0268264_10054982 | |||
| 557 | Ga0265318_10028732 | |||
| 558 | Ga0265336_10007899 | |||
| 559 | Ga0265338_10015845 | |||
| 560 | Ga0265338_10059001 | |||
| 561 | Ga0265338_10060618 | |||
| 562 | Ga0265338_10148475 | |||
| 563 | Ga0265325_10147291 | |||
| 564 | Ga0265339_10004983 | |||
| 565 | Ga0265327_10014374 | |||
| 566 | Ga0265327_10036784 | |||
| 567 | Ga0265313_10025024 | |||
| 568 | Ga0265314_10005893 | |||
| 569 | Ga0265342_10116591 | |||
| 570 | Ga0373926_0022931 | |||
| 571 | Ga0373944_0000745 | |||
| 572 | Ga0373945_0022073 | |||
| 573 | Ga0373943_0003173 | |||
| 574 | Ga0373943_0008965 | |||
| 575 | Ga0373946_0009349 | |||
| 576 | Ga0373924_0081138 | |||
| 577 | Ga0373927_0180868 | |||
| 578 | Ga0373947_0001279 | |||
| 579 | Ga0373947_0006134 | |||
| 580 | Ga0373937_0006653 | |||
| 581 | Ga0373925_0001456 | |||
| 582 | Ga0373925_0031307 | |||
| 583 | Ga0395899_0004144 | |||
| 584 | Ga0395900_0002083 | |||
| 585 | Ga0395900_0153060 | |||
| 586 | Ga0395898_0007988 | |||
| 587 | Ga0395898_0010279 | |||
| 588 | Ga0395898_0017353 | |||
| 589 | Ga0395898_0060783 | |||
| 590 | Ga0395905_0006934 | |||
| 591 | Ga0395901_0000793 | |||
| 592 | Ga0395901_0550241 | |||
| 593 | Ga0436360_0893357 | |||
| 594 | Ga0466969_0001820 | |||
| 595 | Ga0466969_0118409 | |||
| 596 | Ga0466969_0188085 | |||
| 597 | Ga0466965_0011872 | |||
| 598 | Ga0466965_0048549 | |||
| 599 | Ga0466966_0032230 | |||
| 600 | Ga0466966_0034581 | |||
| 601 | Ga0466966_0076416 | |||
| 602 | Ga0466966_0091299 | |||
| 603 | Ga0466961_0006902 | |||
| 604 | Ga0466961_0107592 | |||
| 605 | Ga0466961_0142307 | |||
| 606 | Ga0466961_0210161 | |||
| 607 | Ga0466963_0000518 | |||
| 608 | Ga0466963_0003671 | |||
| 609 | Ga0466963_0007134 | |||
| 610 | Ga0466963_0009767 | |||
| 611 | Ga0466963_0010487 | |||
| 612 | Ga0466963_0032715 | |||
| 613 | Ga0466963_0042630 | |||
| 614 | Ga0466963_0043332 | |||
| 615 | Ga0466963_0053273 | |||
| 616 | Ga0466963_0154148 | |||
| 617 | Ga0466964_0001506 | |||
| 618 | Ga0466964_0003774 | |||
| 619 | Ga0466964_0006409 | |||
| 620 | Ga0466964_0019584 | |||
| 621 | Ga0466964_0052725 | |||
| 622 | Ga0466971_0004434 | |||
| 623 | Ga0466971_0046625 | |||
| 624 | Ga0466971_0058221 | |||
| 625 | Ga0466971_0099862 | |||
| 626 | Ga0466968_0011483 | |||
| 627 | Ga0466968_0012530 | |||
| 628 | Ga0466968_0030579 | |||
| 629 | Ga0466968_0032179 | |||
| 630 | Ga0466968_0036551 | |||
| 631 | Ga0466970_0005115 | |||
| 632 | Ga0466970_0131420 | |||
| 633 | Ga0466957_0005617 | |||
| 634 | Ga0466957_0093703 | |||
| 635 | Ga0466957_0187506 | |||
| 636 | Ga0466957_0601925 | |||
| 637 | Ga0466959_0009634 | |||
| 638 | Ga0466959_0013448 | |||
| 639 | Ga0466959_0018185 | |||
| 640 | Ga0466959_0032823 | |||
| 641 | Ga0466959_0082043 | |||
| 642 | Ga0466959_0204948 | |||
| 643 | Ga0466958_0001119 | |||
| 644 | Ga0466958_0005138 | |||
| 645 | Ga0466958_0016400 | |||
| 646 | Ga0466958_0020512 | |||
| 647 | Ga0466958_0026055 | |||
| 648 | Ga0466958_0108674 | |||
| 649 | Ga0466958_0224978 | |||
| 650 | Ga0466967_0002011 | |||
| 651 | Ga0466967_0002633 | |||
| 652 | Ga0466967_0003534 | |||
| 653 | Ga0466967_0012538 | |||
| 654 | Ga0466967_0021821 | |||
| 655 | Ga0466967_0041075 | |||
| 656 | Ga0466967_0048323 | |||
| 657 | Ga0466967_0131348 | |||
| 658 | Ga0466967_0135298 | |||
| 659 | Ga0466967_0173359 | |||
| 660 | Ga0466967_0356466 | |||
| 661 | Ga0466967_0485727 | |||
| 662 | Ga0466967_0583096 | |||
| 663 | Ga0495592_0000597 | |||
| 664 | Ga0495592_0005696 | |||
| 665 | Ga0495592_0106460 | |||
| 666 | Ga0495603_0000450 | |||
| 667 | Ga0495603_0013278 | |||
| 668 | Ga0495629_0007112 | |||
| 669 | Ga0495629_0265586 | |||
| 670 | Ga0495641_0001513 | |||
| 671 | Ga0495641_0005148 | |||
| 672 | Ga0495641_0158417 | |||
| 673 | Ga0495651_0000008 | |||
| 674 | Ga0495651_0022741 | |||
| 675 | Ga0495653_0000725 | |||
| 676 | Ga0495653_0018297 | |||
| 677 | Ga0495580_0006863 | |||
| 678 | Ga0495580_0210642 | |||
| 679 | Ga0495582_0000711 | |||
| 680 | Ga0495582_0006254 | |||
| 681 | Ga0495582_0010487 | |||
| 682 | Ga0495639_0000520 | |||
| 683 | Ga0495662_0006328 | |||
| 684 | Ga0495662_0101936 | |||
| 685 | Ga0495664_0002367 | |||
| 686 | Ga0495664_0117524 | |||
| 687 | Ga0495584_0031793 | |||
| 688 | Ga0495594_0001436 | |||
| 689 | Ga0495594_0019684 | |||
| 690 | Ga0495607_0074846 | |||
| 691 | Ga0495608_0000957 | |||
| 692 | Ga0495608_0021667 | |||
| 693 | Ga0495608_0214018 | |||
| 694 | Ga0495618_0002854 | |||
| 695 | Ga0495618_0088297 | |||
| 696 | Ga0495628_0000105 | |||
| 697 | Ga0495628_0030882 | |||
| 698 | Ga0495628_0266475 | |||
| 699 | Ga0495630_0001692 | |||
| 700 | Ga0495630_0105121 | |||
| 701 | Ga0495630_0411189 | |||
| 702 | Ga0495644_0003055 | |||
| 703 | Ga0495663_0011608 | |||
| 704 | Ga0495666_0000272 | |||
| 705 | Ga0495666_0015797 | |||
| 706 | Ga0495652_0001221 | |||
| 707 | Ga0495652_0052130 | |||
| 708 | Ga0495652_0178785 | |||
| 709 | Ga0495665_0001436 | |||
| 710 | Ga0495640_0019015 | |||
| 711 | Ga0495640_0023975 | |||
| 712 | Ga0495587_0000048 | |||
| 713 | Ga0495645_0000029 | |||
| 714 | Ga0495645_0049780 | |||
| 715 | Ga0495645_0068402 | |||
| 716 | Ga0495645_0131449 | |||
| 717 | Ga0495656_0072590 | |||
| 718 | Ga0495634_0014004 | |||
| 719 | Ga0495635_0012512 | |||
| 720 | Ga0495635_0017299 | |||
| 721 | Ga0495635_0033068 | |||
| 722 | Ga0495635_0158161 | |||
| 723 | Ga0495661_0069750 | |||
| 724 | Ga0495588_0000857 | |||
| 725 | Ga0495657_0089314 | |||
| 726 | Ga0495657_0109638 | |||
| 727 | Ga0495599_0000110 | |||
| 728 | Ga0495599_0003982 | |||
| 729 | Ga0495599_0104400 | |||
| 730 | Ga0495623_0000379 | |||
| 731 | Ga0495623_0052484 | |||
| 732 | Ga0495646_0002891 | |||
| 733 | Ga0495646_0021855 | |||
| 734 | Ga0495646_0055229 | |||
| 735 | Ga0495646_0134063 | |||
| 736 | Ga0495647_0000245 | |||
| 737 | Ga0495658_0000675 | |||
| 738 | Ga0495658_0005244 | |||
| 739 | Ga0495658_0173671 | |||
| 740 | Ga0495658_0334604 | |||
| 741 | Ga0495613_0006283 | |||
| 742 | Ga0495613_0061151 | |||
| 743 | Ga0495624_0008345 | |||
| 744 | Ga0495670_0084327 | |||
| 745 | Ga0495589_0231088 | |||
| 746 | Ga0495600_0115302 | |||
| 747 | Ga0495600_0127944 | |||
| 748 | Ga0495581_0002214 | |||
| 749 | Ga0495604_0000687 | |||
| 750 | Ga0495604_0110332 | |||
| 751 | Ga0495636_0123016 | |||
| 752 | Ga0495674_0019362 | |||
| 753 | Ga0495674_0752078 | |||
| 754 | Ga0495676_0000602 | |||
| 755 | Ga0495676_0019704 | |||
| 756 | Ga0495676_0173647 | |||
| 757 | Ga0495676_0308307 | |||
| 758 | Ga0495680_0016904 | |||
| 759 | Ga0495680_0054513 | |||
| 760 | Ga0495680_0080700 | |||
| 761 | Ga0495680_0268779 | |||
| 762 | Ga0495675_0000419 | |||
| 763 | Ga0495675_0159486 | |||
| 764 | Ga0495684_0033445 | |||
| 765 | Ga0495593_0000863 | |||
| 766 | Ga0495602_0001409 | |||
| 767 | Ga0495602_0107451 | |||
| 768 | Ga0495602_0158333 | |||
| 769 | Ga0495602_0244323 | |||
| 770 | Ga0495614_0000132 | |||
| 771 | Ga0496100_0015416 | |||
| 772 | Ga0496100_0178555 | |||
| 773 | Ga0496101_0023909 | |||
| 774 | Ga0496101_0060651 | |||
| 775 | Ga0496101_0076021 | |||
| 776 | Ga0496101_0105705 | |||
| 777 | Ga0496102_0005223 | |||
| 778 | Ga0496102_0031913 | |||
| 779 | Ga0496102_0393602 | |||
| 780 | Ga0496102_0707407 | |||
| 781 | Ga0496103_0011456 | |||
| 782 | Ga0496103_0082527 | |||
| 783 | Ga0496104_0000977 | |||
| 784 | Ga0496104_0183359 | |||
| 785 | Ga0496104_0199570 | |||
| 786 | Ga0496104_0214751 | |||
| 787 | Ga0496104_0450847 | |||
| 788 | Ga0496105_0000926 | |||
| 789 | Ga0496105_0002654 | |||
| 790 | Ga0496105_0006724 | |||
| 791 | Ga0496105_0044751 | |||
| 792 | Ga0496105_0250294 | |||
| 793 | Ga0496106_0015040 | |||
| 794 | Ga0496106_0021116 | |||
| 795 | Ga0496107_0002059 | |||
| 796 | Ga0496107_0054403 | |||
| 797 | Ga0496107_0155304 | |||
| 798 | Ga0496108_0000272 | |||
| 799 | Ga0496108_0009090 | |||
| 800 | Ga0496108_0026913 | |||
| 801 | Ga0496109_0000857 | |||
| 802 | Ga0496109_0001789 | |||
| 803 | Ga0496109_0033432 | |||
| 804 | Ga0496109_0101175 | |||
| 805 | Ga0496109_0164918 | |||
| 806 | Ga0496109_0350589 | |||
| 807 | Ga0496110_0001545 | |||
| 808 | Ga0496110_0043887 | |||
| 809 | Ga0496110_0136621 | |||
| 810 | Ga0496111_0001182 | |||
| 811 | Ga0496111_0036168 | |||
| 812 | Ga0496112_0104556 | |||
| 813 | Ga0496112_0446193 | |||
| 814 | Ga0496113_0000040 | |||
| 815 | Ga0496113_0024226 | |||
| 816 | Ga0496113_0087826 | |||
| 817 | Ga0496114_0005892 | |||
| 818 | Ga0496114_0007326 | |||
| 819 | Ga0496114_0018200 | |||
| 820 | Ga0496114_0045607 | |||
| 821 | Ga0496114_0162039 | |||
| 822 | Ga0496115_0003551 | |||
| 823 | Ga0496115_0010558 | |||
| 824 | Ga0496115_0068569 | |||
| 825 | Ga0496115_0177084 | |||
| 826 | Ga0496115_0341672 | |||
| 827 | Ga0501067_0043622 | |||
| 828 | Ga0501069_0030406 | |||
| 829 | Ga0501069_0086386 | |||
| 830 | Ga0501070_0001183 | |||
| 831 | nmdc:mga0n895_7957_c1 | |||
| 832 | nmdc:mga0a205_190057_c1 | |||
| 833 | Ga0495601_0000340 | |||
| 834 | Ga0495601_0021067 | |||
| 835 | Ga0495612_0010731 | |||
| 836 | Ga0495612_0014591 | |||
| 837 | Ga0495612_0026566 | |||
| 838 | Ga0495595_0008985 | |||
| 839 | Ga0495619_0001752 | |||
| 840 | Ga0495619_0009906 | |||
| 841 | Ga0466962_0003363 | |||
| 842 | Ga0466962_0007664 | |||
| 843 | Ga0466962_0041062 | |||
| 844 | Ga0466962_0081444 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r1f-assembly1.cif.gz_A | crystal structure of predicted aminodeoxychorismate lyase from escherichia coli | 0.8094 | 7 | 243 |
| 4iiw-assembly1.cif.gz_B | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.8059 | 10 | 238 |
| 4iiw-assembly1.cif.gz_A-5 | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.7997 | 10 | 236 |
| 4iiw-assembly1.cif.gz_B | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.7557 | 10 | 238 |
| 2r1f-assembly1.cif.gz_A | crystal structure of predicted aminodeoxychorismate lyase from escherichia coli | 0.7473 | 7 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4iiwB01 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Endolytic murein transglycosylase | 0.7018 | 5 | 95 | 3.30.1490.480 |
| 4iiwB01 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Endolytic murein transglycosylase | 0.6494 | 5 | 95 | 3.30.1490.480 |
| 3op6B00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.4833 | 6 | 41 | 3.90.960.10 |
| af_Q6JDV7_338_444_3.30.1490.100 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain | 0.3617 | 1 | 99 | 3.30.1490.100 |
| af_Q6JDV7_338_444_3.30.1490.100 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain | 0.2955 | 1 | 99 | 3.30.1490.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538GVF3-F1-model_v4 | Endolytic transglycosylase MltG | 0.9926 | 120 | 242 |
GO:0005886
GO:0016829 GO:0071555 |
| AF-A0A537WED6-F1-model_v4 | Endolytic murein transglycosylase (EC 4.2.2.29) (Peptidoglycan lytic transglycosylase) (Peptidoglycan polymerization terminase) | 0.9748 | 7 | 244 |
GO:0005886
GO:0008932 GO:0009252 GO:0071555 |
| AF-A0A538A2G2-F1-model_v4 | Endolytic transglycosylase MltG | 0.9742 | 90 | 244 |
GO:0005886
GO:0016829 GO:0071555 |
| AF-A0A7V9SUW7-F1-model_v4 | Endolytic murein transglycosylase (EC 4.2.2.29) (Peptidoglycan lytic transglycosylase) (Peptidoglycan polymerization terminase) | 0.972 | 2 | 236 |
GO:0005886
GO:0008932 GO:0009252 GO:0071555 |
| AF-A0A538CJ54-F1-model_v4 | Endolytic transglycosylase MltG | 0.9718 | 57 | 244 |
GO:0005886
GO:0016829 GO:0071555 |