F440301

General Info

Members Datasets Scaffolds Average Seq Length
422 219 419 178

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10276137|Ga0207683_102761371
Length 215
Sequence LRIADLSTEAIAKVDRVKRILCIFQHYRISIFSNFHIVIMGLILVGIIMGSDSDLEVMKPAADFLHSVGISYELTVVSAHRTPLRMVDYSTTARERGLKVIIAGAGGAAHLPGMVASLTSLPVIGVPVKSSNSIDGWDSILSILQMPNGVPVATVALNAAKNAGILAAQIIGSADPELGKRLDQYKKDMESEVSRKIEKLRFEGWSNSFDESEKE

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
3 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
189 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
193 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
194 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
195 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
196 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
197 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
198 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
204 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
205 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0.24
Rhizoplane 0.95
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10057952 3300003320 Bacteria 1412
2 rootH2_10141666 3300003320 Bacteria 2159
3 rootL2_10115235 3300003322 Bacteria 26947
4 rootH1_10020954 3300003323 Bacteria 5592
5 rootH1_10113739 3300003323 Bacteria 5956
6 JGI25160J50197_1002252 3300003354 Bacteria 9049
7 Ga0065715_10241090 3300005293 Bacteria 1199
8 Ga0065715_10614095 3300005293 Bacteria 699
9 Ga0065707_10358848 3300005295 Bacteria 907
10 Ga0070683_100509900 3300005329 Bacteria 1149
11 Ga0070670_100058602 3300005331 Bacteria 3306
12 Ga0070670_100326913 3300005331 Bacteria 1344
13 Ga0070670_100727948 3300005331 Bacteria 893
14 Ga0070677_10011981 3300005333 Bacteria 3001
15 Ga0070666_10017636 3300005335 Bacteria 4580
16 Ga0070666_10155978 3300005335 Bacteria 1594
17 Ga0070660_100013493 3300005339 Bacteria 5862
18 Ga0070661_100097734 3300005344 Bacteria 2180
19 Ga0070675_100025261 3300005354 Bacteria 4763
20 Ga0070671_100016107 3300005355 Bacteria 6044
21 Ga0070671_100303272 3300005355 Unclassified 1360
22 Ga0070674_100127782 3300005356 Unclassified 1891
23 Ga0070674_100360246 3300005356 Bacteria 1177
24 Ga0070673_100046183 3300005364 Bacteria 3382
25 Ga0070673_101217173 3300005364 Bacteria 706
26 Ga0070688_100337224 3300005365 Bacteria 1100
27 Ga0070659_100055452 3300005366 Bacteria 3123
28 Ga0070659_100125476 3300005366 Bacteria 2082
29 Ga0070667_100001632 3300005367 Bacteria 20064
30 Ga0070667_100002669 3300005367 Bacteria 15447
31 Ga0070667_100435789 3300005367 Bacteria 1196
32 Ga0070694_100965522 3300005444 Bacteria 706
33 Ga0070663_100001762 3300005455 Bacteria 12041
34 Ga0070663_100009380 3300005455 Bacteria 6058
35 Ga0070678_100168128 3300005456 Bacteria 1783
36 Ga0070678_101576547 3300005456 Unclassified 616
37 Ga0070662_100570865 3300005457 Unclassified 949
38 Ga0070681_10827639 3300005458 Bacteria 843
39 Ga0068867_100218495 3300005459 Bacteria 1535
40 Ga0068867_100753123 3300005459 Bacteria 864
41 Ga0070685_10091510 3300005466 Bacteria 1842
42 Ga0070679_100757957 3300005530 Bacteria 914
43 Ga0070684_100022962 3300005535 Bacteria 5210
44 Ga0070684_100023020 3300005535 Bacteria 5203
45 Ga0070684_100213314 3300005535 Bacteria 1760
46 Ga0068853_100004660 3300005539 Bacteria 10630
47 Ga0070672_100074480 3300005543 Bacteria 2708
48 Ga0070672_100122009 3300005543 Bacteria 2134
49 Ga0070672_100214802 3300005543 Bacteria 1612
50 Ga0070672_100862746 3300005543 Bacteria 798
51 Ga0070665_100000074 3300005548 Bacteria 192944
52 Ga0068855_100001023 3300005563 Bacteria 34865
53 Ga0068855_100850083 3300005563 Bacteria 967
54 Ga0068855_101163730 3300005563 Bacteria 803
55 Ga0070664_100339898 3300005564 Bacteria 1363
56 Ga0070664_100361919 3300005564 Bacteria 1321
57 Ga0070664_100403242 3300005564 Bacteria 1251
58 Ga0070664_101467623 3300005564 Bacteria 645
59 Ga0068857_100003175 3300005577 Bacteria 13626
60 Ga0068857_100203247 3300005577 Bacteria 1806
61 Ga0068857_100545442 3300005577 Bacteria 1092
62 Ga0068854_100022470 3300005578 Bacteria 4298
63 Ga0068856_100004728 3300005614 Bacteria 13521
64 Ga0068856_100027636 3300005614 Bacteria 5535
65 Ga0068856_100099605 3300005614 Bacteria 2897
66 Ga0068852_100037721 3300005616 Bacteria 4055
67 Ga0068852_100059243 3300005616 Bacteria 3320
68 Ga0068852_100107599 3300005616 Bacteria 2529
69 Ga0068852_100174042 3300005616 Bacteria 2020
70 Ga0068852_100290730 3300005616 Bacteria 1578
71 Ga0068852_100430987 3300005616 Bacteria 1302
72 Ga0068852_100967996 3300005616 Unclassified 869
73 Ga0068859_100154699 3300005617 Bacteria 2370
74 Ga0068864_100047771 3300005618 Bacteria 3678
75 Ga0068864_100103634 3300005618 Bacteria 2526
76 Ga0068864_100251470 3300005618 Unclassified 1641
77 Ga0068864_100791028 3300005618 Bacteria 932
78 Ga0068864_100791518 3300005618 Unclassified 931
79 Ga0068870_10574532 3300005840 Unclassified 762
80 Ga0068863_100047616 3300005841 Bacteria 4066
81 Ga0068858_100292383 3300005842 Unclassified 1553
82 Ga0068860_100002368 3300005843 Bacteria 19795
83 Ga0068860_100007493 3300005843 Bacteria 10915
84 Ga0068860_100391909 3300005843 Bacteria 1373
85 Ga0068860_100396191 3300005843 Unclassified 1365
86 Ga0068862_100037474 3300005844 Bacteria 4110
87 Ga0068862_100521536 3300005844 Bacteria 1131
88 Ga0081455_10287686 3300005937 Bacteria 1184
89 Ga0070717_10493645 3300006028 Bacteria 1106
90 Ga0070716_100322186 3300006173 Bacteria 1083
91 Ga0075366_10567093 3300006195 Unclassified 703
92 Ga0097621_100000695 3300006237 Bacteria 23615
93 Ga0097621_100177027 3300006237 Bacteria 1841
94 Ga0097621_101193605 3300006237 Bacteria 716
95 Ga0097621_101250309 3300006237 Bacteria 700
96 Ga0068871_100000091 3300006358 Bacteria 52582
97 Ga0068871_100115535 3300006358 Bacteria 2262
98 Ga0068871_100161570 3300006358 Bacteria 1916
99 Ga0068871_100260322 3300006358 Bacteria 1513
100 Ga0068871_100752350 3300006358 Bacteria 896
101 Ga0075431_100359935 3300006847 Bacteria 1462
102 Ga0075429_101064392 3300006880 Bacteria 707
103 Ga0075429_101414754 3300006880 Bacteria 606
104 Ga0068865_100126011 3300006881 Bacteria 1912
105 Ga0068865_100448297 3300006881 Unclassified 1066
106 Ga0097620_100154693 3300006931 Bacteria 2370
107 Ga0105251_10130814 3300009011 Bacteria 1137
108 Ga0105240_10000253 3300009093 Bacteria 106101
109 Ga0105240_10000448 3300009093 Bacteria 75837
110 Ga0105240_10944466 3300009093 Bacteria 925
111 Ga0111539_10111742 3300009094 Bacteria 3206
112 Ga0111539_10364521 3300009094 Bacteria 1682
113 Ga0105247_10262910 3300009101 Bacteria 1184
114 Ga0114129_11568316 3300009147 Bacteria 807
115 Ga0105241_10000728 3300009174 Bacteria 24950
116 Ga0105241_10309991 3300009174 Bacteria 1357
117 Ga0105241_10373449 3300009174 Bacteria 1244
118 Ga0105241_11174328 3300009174 Bacteria 726
119 Ga0105242_10010900 3300009176 Bacteria 6981
120 Ga0105248_10093258 3300009177 Bacteria 3391
121 Ga0105237_10000826 3300009545 Bacteria 42381
122 Ga0105237_10008622 3300009545 Bacteria 11022
123 Ga0105237_10026832 3300009545 Bacteria 5887
124 Ga0105237_10050502 3300009545 Bacteria 4179
125 Ga0105237_10053797 3300009545 Bacteria 4037
126 Ga0105237_10090314 3300009545 Bacteria 3053
127 Ga0105237_10147152 3300009545 Bacteria 2351
128 Ga0105237_10489413 3300009545 Bacteria 1236
129 Ga0105238_10001192 3300009551 Bacteria 26201
130 Ga0105249_10760026 3300009553 Bacteria 1032
131 Ga0105239_10000079 3300010375 Bacteria 135513
132 Ga0105239_10005705 3300010375 Bacteria 14536
133 Ga0105239_10008502 3300010375 Bacteria 11670
134 Ga0105239_10037344 3300010375 Bacteria 5326
135 Ga0105239_10043947 3300010375 Bacteria 4899
136 Ga0105239_10601867 3300010375 Bacteria 1254
137 Ga0157373_10032477 3300013100 Bacteria 3757
138 Ga0157373_10161489 3300013100 Bacteria 1576
139 Ga0157373_10178997 3300013100 Bacteria 1492
140 Ga0157371_10000869 3300013102 Bacteria 34259
141 Ga0157371_10009458 3300013102 Bacteria 7668
142 Ga0157371_10043864 3300013102 Bacteria 3185
143 Ga0157371_10191136 3300013102 Bacteria 1466
144 Ga0157371_10191773 3300013102 Bacteria 1463
145 Ga0157371_10192404 3300013102 Bacteria 1461
146 Ga0157370_10007602 3300013104 Bacteria 11769
147 Ga0157370_10028527 3300013104 Bacteria 5488
148 Ga0157370_10077019 3300013104 Bacteria 3142
149 Ga0157370_10182761 3300013104 Bacteria 1948
150 Ga0157370_10203532 3300013104 Bacteria 1836
151 Ga0157370_10627774 3300013104 Bacteria 983
152 Ga0157370_10669801 3300013104 Bacteria 948
153 Ga0157370_10921387 3300013104 Bacteria 793
154 Ga0157370_11722417 3300013104 Bacteria 563
155 Ga0157369_10051177 3300013105 Bacteria 4470
156 Ga0157369_10061874 3300013105 Bacteria 4034
157 Ga0157369_10151140 3300013105 Bacteria 2454
158 Ga0157369_10200458 3300013105 Bacteria 2095
159 Ga0157374_10002018 3300013296 Bacteria 17033
160 Ga0157378_10031598 3300013297 Bacteria 4676
161 Ga0157378_10055876 3300013297 Bacteria 3517
162 Ga0157378_10091078 3300013297 Bacteria 2772
163 Ga0163162_10000434 3300013306 Bacteria 38574
164 Ga0163162_10001089 3300013306 Bacteria 25177
165 Ga0163162_10986767 3300013306 Unclassified 952
166 Ga0163162_11142681 3300013306 Bacteria 883
167 Ga0163162_11751479 3300013306 Bacteria 710
168 Ga0157372_10000016 3300013307 Bacteria 220177
169 Ga0157372_10000813 3300013307 Bacteria 33849
170 Ga0157372_10001688 3300013307 Bacteria 23868
171 Ga0157372_10015826 3300013307 Bacteria 8092
172 Ga0157372_10017754 3300013307 Bacteria 7637
173 Ga0157372_10051351 3300013307 Bacteria 4589
174 Ga0157372_10122542 3300013307 Bacteria 2988
175 Ga0157372_10167272 3300013307 Bacteria 2543
176 Ga0157372_10187070 3300013307 Bacteria 2398
177 Ga0157372_10261747 3300013307 Bacteria 2009
178 Ga0157372_10325710 3300013307 Bacteria 1789
179 Ga0157372_10357892 3300013307 Bacteria 1701
180 Ga0157372_10491009 3300013307 Bacteria 1432
181 Ga0157372_10591889 3300013307 Bacteria 1293
182 Ga0157375_10000118 3300013308 Bacteria 77255
183 Ga0157375_10186117 3300013308 Unclassified 2230
184 Ga0157375_10364297 3300013308 Bacteria 1612
185 Ga0157375_10761941 3300013308 Bacteria 1119
186 Ga0157375_11579180 3300013308 Bacteria 775
187 Ga0163163_10000694 3300014325 Bacteria 28641
188 Ga0163163_10383883 3300014325 Bacteria 1462
189 Ga0163163_10786861 3300014325 Bacteria 1015
190 Ga0163163_10979353 3300014325 Bacteria 909
191 Ga0163163_11505973 3300014325 Bacteria 734
192 Ga0157380_10006309 3300014326 Bacteria 8331
193 Ga0157380_10008939 3300014326 Bacteria 7157
194 Ga0157380_10039899 3300014326 Unclassified 3653
195 Ga0157380_10161380 3300014326 Bacteria 1949
196 Ga0157380_10765690 3300014326 Bacteria 978
197 Ga0157377_10071714 3300014745 Bacteria 2004
198 Ga0157379_10048877 3300014968 Bacteria 3776
199 Ga0157379_10130070 3300014968 Bacteria 2265
200 Ga0157379_10213179 3300014968 Bacteria 1749
201 Ga0157379_10514060 3300014968 Bacteria 1111
202 Ga0157379_11472196 3300014968 Bacteria 662
203 Ga0157376_10001630 3300014969 Bacteria 14867
204 Ga0157376_10023493 3300014969 Bacteria 4825
205 Ga0157376_11346866 3300014969 Bacteria 744
206 Ga0163161_10002543 3300017792 Bacteria 13022
207 Ga0163161_10004308 3300017792 Bacteria 9913
208 Ga0163161_10100731 3300017792 Unclassified 2150
209 Ga0163161_11190265 3300017792 Bacteria 658
210 Ga0207426_1000009 3300025302 Bacteria 797229
211 Ga0207697_10072470 3300025315 Bacteria 1444
212 Ga0207682_10097543 3300025893 Bacteria 1281
213 Ga0207682_10228281 3300025893 Unclassified 863
214 Ga0207680_10106878 3300025903 Bacteria 1808
215 Ga0207680_10207824 3300025903 Bacteria 1337
216 Ga0207680_10264694 3300025903 Bacteria 1191
217 Ga0207647_10000390 3300025904 Bacteria 35888
218 Ga0207647_10173538 3300025904 Bacteria 1255
219 Ga0207707_10617875 3300025912 Bacteria 916
220 Ga0207695_10071819 3300025913 Bacteria 3534
221 Ga0207671_10003345 3300025914 Bacteria 16091
222 Ga0207671_10004609 3300025914 Bacteria 13085
223 Ga0207671_10196777 3300025914 Bacteria 1573
224 Ga0207671_10205574 3300025914 Bacteria 1539
225 Ga0207657_10008321 3300025919 Bacteria 10555
226 Ga0207649_10164810 3300025920 Bacteria 1539
227 Ga0207652_10642515 3300025921 Bacteria 949
228 Ga0207650_10142372 3300025925 Bacteria 1886
229 Ga0207659_10011757 3300025926 Bacteria 5541
230 Ga0207659_10028428 3300025926 Bacteria 3800
231 Ga0207659_10335760 3300025926 Bacteria 1250
232 Ga0207644_10120675 3300025931 Bacteria 1995
233 Ga0207644_10955613 3300025931 Bacteria 719
234 Ga0207690_10050001 3300025932 Bacteria 2789
235 Ga0207690_10287578 3300025932 Bacteria 1282
236 Ga0207706_10035158 3300025933 Bacteria 4456
237 Ga0207706_11322472 3300025933 Bacteria 595
238 Ga0207670_10467446 3300025936 Bacteria 1019
239 Ga0207670_10517539 3300025936 Bacteria 971
240 Ga0207669_10370074 3300025937 Bacteria 1113
241 Ga0207704_10003550 3300025938 Bacteria 7089
242 Ga0207704_10112713 3300025938 Unclassified 1843
243 Ga0207704_10770394 3300025938 Bacteria 802
244 Ga0207691_10005245 3300025940 Bacteria 12509
245 Ga0207691_10066079 3300025940 Bacteria 3272
246 Ga0207661_10164920 3300025944 Bacteria 1924
247 Ga0207661_10291732 3300025944 Unclassified 1460
248 Ga0207661_10346229 3300025944 Bacteria 1340
249 Ga0207679_10183439 3300025945 Bacteria 1733
250 Ga0207679_10225136 3300025945 Bacteria 1580
251 Ga0207679_10303143 3300025945 Bacteria 1378
252 Ga0207667_10000641 3300025949 Bacteria 45311
253 Ga0207667_10000863 3300025949 Bacteria 39055
254 Ga0207667_10095238 3300025949 Bacteria 3074
255 Ga0207667_10212579 3300025949 Bacteria 1982
256 Ga0207651_10042478 3300025960 Bacteria 3026
257 Ga0207640_10152194 3300025981 Bacteria 1701
258 Ga0207640_10378612 3300025981 Bacteria 1146
259 Ga0207658_10085873 3300025986 Unclassified 2425
260 Ga0207677_10472354 3300026023 Bacteria 1079
261 Ga0207639_10009693 3300026041 Bacteria 6652
262 Ga0207639_10029461 3300026041 Bacteria 4019
263 Ga0207639_10464853 3300026041 Bacteria 1151
264 Ga0207678_10055038 3300026067 Bacteria 3427
265 Ga0207678_10110561 3300026067 Bacteria 2344
266 Ga0207708_10077209 3300026075 Bacteria 2556
267 Ga0207702_10217615 3300026078 Bacteria 1779
268 Ga0207641_10023182 3300026088 Bacteria 5115
269 Ga0207641_10469668 3300026088 Bacteria 1218
270 Ga0207648_10406806 3300026089 Bacteria 1234
271 Ga0207676_10036853 3300026095 Bacteria 3723
272 Ga0207676_10395643 3300026095 Bacteria 1290
273 Ga0207674_10001072 3300026116 Bacteria 35602
274 Ga0207674_10232786 3300026116 Bacteria 1790
275 Ga0207674_10250207 3300026116 Bacteria 1719
276 Ga0207674_10618185 3300026116 Bacteria 1046
277 Ga0207675_100468102 3300026118 Bacteria 1251
278 Ga0207683_10276137 3300026121 Bacteria 1535
279 Ga0207683_10290635 3300026121 Bacteria 1494
280 Ga0207683_11238841 3300026121 Unclassified 691
281 Ga0207698_10021368 3300026142 Bacteria 4474
282 Ga0207698_10321426 3300026142 Bacteria 1449
283 Ga0207698_10432953 3300026142 Bacteria 1265
284 Ga0209281_1000570 3300027111 Bacteria 44049
285 Ga0209995_1026542 3300027471 Bacteria 966
286 Ga0268265_10088188 3300028380 Bacteria 2471
287 Ga0268264_10002152 3300028381 Bacteria 17568
288 Ga0268264_10007535 3300028381 Bacteria 9080
289 Ga0268264_10459544 3300028381 Bacteria 1235
290 Ga0268264_10929615 3300028381 Bacteria 874
291 Ga0265326_10105856 3300028558 Bacteria 798
292 Ga0265336_10007193 3300028666 Bacteria 3972
293 Ga0307517_10001368 3300028786 Bacteria 40988
294 Ga0265338_10014611 3300028800 Bacteria 8714
295 Ga0265324_10023692 3300029957 Bacteria 2185
296 Ga0307511_10000748 3300030521 Bacteria 34687
297 Ga0265327_10122841 3300031251 Bacteria 1228
298 Ga0307513_10305383 3300031456 Bacteria 1356
299 Ga0307509_10177143 3300031507 Bacteria 2003
300 Ga0307516_10161177 3300031730 Bacteria 1993
301 Ga0307405_10536780 3300031731 Bacteria 944
302 Ga0307416_100000045 3300032002 Bacteria 126832
303 Ga0307416_101320583 3300032002 Bacteria 827
304 Ga0307414_10359015 3300032004 Bacteria 1253
305 Ga0307414_11118807 3300032004 Bacteria 728
306 Ga0307411_10012270 3300032005 Bacteria 4667
307 Ga0307415_100286781 3300032126 Unclassified 1357
308 Ga0307510_10000058 3300033180 Bacteria 85118
309 Ga0373935_0842224 3300035692 Bacteria 678
310 Ga0395899_0205516 3300037312 Bacteria 1371
311 Ga0395899_0559147 3300037312 Bacteria 734
312 Ga0395900_0050523 3300037418 Bacteria 4283
313 Ga0395900_0656627 3300037418 Bacteria 985
314 Ga0395898_0012252 3300037466 Bacteria 8866
315 Ga0395905_0007176 3300037471 Bacteria 11126
316 Ga0395905_0106561 3300037471 Bacteria 2632
317 Ga0395905_1077230 3300037471 Bacteria 707
318 Ga0395901_0050449 3300038443 Bacteria 4323
319 Ga0395901_0425295 3300038443 Bacteria 1361
320 Ga0436365_0262826 3300039437 Bacteria 23593
321 Ga0436365_1103287 3300039437 Bacteria 1602
322 Ga0439449_0001193 3300042007 Bacteria 10205
323 Ga0451577_0159545 3300042876 Bacteria 2031
324 Ga0466969_0015787 3300044656 Bacteria 3958
325 Ga0453683_0362092 3300044673 Bacteria 932
326 Ga0466966_0022298 3300044684 Bacteria 4155
327 Ga0466966_0198475 3300044684 Bacteria 1214
328 Ga0466961_0436722 3300044693 Bacteria 793
329 Ga0453684_0524937 3300044712 Bacteria 1307
330 Ga0453684_0536589 3300044712 Bacteria 1290
331 Ga0466970_0155379 3300044765 Bacteria 1264
332 Ga0466957_0001277 3300044842 Bacteria 13121
333 Ga0466959_0000034 3300045049 Bacteria 108946
334 Ga0466959_0005499 3300045049 Bacteria 8687
335 Ga0466959_0421012 3300045049 Bacteria 907
336 Ga0451576_0298108 3300045051 Bacteria 1686
337 Ga0466958_0017675 3300045836 Bacteria 4129
338 Ga0495638_0319565 3300046460 Bacteria 830
339 Ga0495606_0006879 3300046507 Bacteria 10365
340 Ga0495610_0056680 3300046512 Bacteria 1883
341 Ga0495618_0615694 3300046514 Bacteria 645
342 Ga0495643_0101369 3300046522 Bacteria 1475
343 Ga0495609_0000063 3300046538 Bacteria 135584
344 Ga0495625_0208650 3300046660 Bacteria 1285
345 Ga0496101_0016175 3300048904 Bacteria 5036
346 Ga0496102_0323400 3300048905 Bacteria 1453
347 Ga0496110_0424496 3300048913 Unclassified 1212
348 Ga0496115_0355537 3300048918 Bacteria 1194
349 Ga0496116_0134381 3300048919 Bacteria 1404
350 Ga0496123_0008215 3300048926 Bacteria 9625
351 Ga0501032_0008334 3300049569 Bacteria 7554
352 Ga0501032_0164880 3300049569 Bacteria 1454
353 Ga0501033_0667424 3300049570 Bacteria 709
354 Ga0501034_0010491 3300049571 Bacteria 9646
355 Ga0501034_0041802 3300049571 Bacteria 4638
356 Ga0501034_0051025 3300049571 Bacteria 4172
357 Ga0501034_0227885 3300049571 Bacteria 1813
358 Ga0501034_0258298 3300049571 Bacteria 1685
359 Ga0501036_0044956 3300049572 Bacteria 3741
360 Ga0501036_0202986 3300049572 Bacteria 1667
361 Ga0501037_0095014 3300049573 Bacteria 2155
362 Ga0501037_0101500 3300049573 Unclassified 2076
363 Ga0501037_0180208 3300049573 Bacteria 1499
364 Ga0501038_0019075 3300049574 Bacteria 6184
365 Ga0501038_0028657 3300049574 Unclassified 4946
366 Ga0501039_0027227 3300049575 Unclassified 4396
367 Ga0501039_0033352 3300049575 Bacteria 3970
368 Ga0501043_0030942 3300049579 Bacteria 4209
369 Ga0501043_0031351 3300049579 Unclassified 4179
370 Ga0501043_0034917 3300049579 Bacteria 3955
371 Ga0501046_0252687 3300049580 Bacteria 1297
372 Ga0501047_0169593 3300049581 Bacteria 2052
373 Ga0501047_0949965 3300049581 Bacteria 673
374 Ga0501068_0787411 3300049584 Bacteria 623
375 Ga0501069_0032180 3300049585 Bacteria 2887
376 Ga0501073_0563530 3300049589 Bacteria 787
377 Ga0501201_003835 3300049651 Bacteria 1387
378 Ga0501206_041463 3300049653 Bacteria 711
379 Ga0501217_000750 3300049661 Bacteria 5622
380 Ga0501223_000829 3300049663 Bacteria 7333
381 Ga0501236_035726 3300049670 Bacteria 805
382 Ga0501239_012839 3300049672 Bacteria 952
383 Ga0501243_005930 3300049675 Bacteria 1844
384 Ga0501247_016295 3300049677 Bacteria 934
385 Ga0501251_035794 3300049681 Bacteria 730
386 Ga0501253_004611 3300049683 Bacteria 1753
387 Ga0501253_034831 3300049683 Bacteria 982
388 Ga0501257_028381 3300049686 Bacteria 1342
389 Ga0501259_004710 3300049688 Bacteria 2163
390 Ga0501259_014085 3300049688 Bacteria 1351
391 Ga0501261_066417 3300049690 Bacteria 624
392 Ga0501080_0183799 3300049742 Bacteria 1923
393 Ga0501083_0575066 3300049744 Bacteria 733
394 Ga0501266_002843 3300049763 Bacteria 2163
395 Ga0501268_017698 3300049765 Bacteria 1191
396 Ga0501283_050306 3300049779 Bacteria 737
397 Ga0501035_0210558 3300049822 Bacteria 1663
398 Ga0501035_0295483 3300049822 Bacteria 1366
399 Ga0501044_0038452 3300049823 Bacteria 4997
400 Ga0501044_0099865 3300049823 Bacteria 2920
401 Ga0501044_0117025 3300049823 Bacteria 2670
402 Ga0501044_0192641 3300049823 Unclassified 2000
403 Ga0501044_0246740 3300049823 Bacteria 1728
404 Ga0501044_0248828 3300049823 Bacteria 1719
405 Ga0501044_0442164 3300049823 Bacteria 1208
406 nmdc:mga0k408_13297_c1 3300050493 Bacteria 4510
407 nmdc:mga0k408_44816_c1 3300050493 Bacteria 2551
408 nmdc:mga05p37_959069_c1 3300050507 Bacteria 914
409 nmdc:mga09592_203064_c1 3300050508 Bacteria 1716
410 nmdc:mga06r32_589738_c1 3300050510 Bacteria 1083
411 Ga0500646_0047850 3300053090 Bacteria 1224
412 Ga0500562_000089 3300053108 Bacteria 37493
413 Ga0500616_0006824 3300053153 Bacteria 7388
414 Ga0500622_0028649 3300053156 Bacteria 2931
415 Ga0500637_0032975 3300053178 Bacteria 2891
416 Ga0500611_000022 3300053727 Bacteria 102349
417 Ga0500611_017755 3300053727 Bacteria 1301
418 Ga0500645_056264 3300053730 Unclassified 1141
419 Ga0466962_0018189 3300061719 Bacteria 3381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0000063 Ga0495609_0000063_68529_69122 157
2 3300049571 Ga0501034_0051025 Ga0501034_0051025_3520_4143 158
3 3300005530 Ga0070679_100757957 Ga0070679_1007579571 162
4 3300005535 Ga0070684_100213314 Ga0070684_1002133142 162
5 3300005563 Ga0068855_101163730 Ga0068855_1011637302 162
6 3300005614 Ga0068856_100099605 Ga0068856_1000996053 162
7 3300009545 Ga0105237_10090314 Ga0105237_100903143 162
8 3300010375 Ga0105239_10043947 Ga0105239_100439473 162
9 3300013100 Ga0157373_10032477 Ga0157373_100324774 162
10 3300013102 Ga0157371_10191136 Ga0157371_101911362 162
11 3300013104 Ga0157370_10627774 Ga0157370_106277742 162
12 3300013104 Ga0157370_10669801 Ga0157370_106698011 162
13 3300013104 Ga0157370_10921387 Ga0157370_109213872 162
14 3300013307 Ga0157372_10591889 Ga0157372_105918893 162
15 3300013308 Ga0157375_10364297 Ga0157375_103642972 162
16 3300017792 Ga0163161_10004308 Ga0163161_100043087 162
17 3300025944 Ga0207661_10346229 Ga0207661_103462292 162
18 3300025949 Ga0207667_10095238 Ga0207667_100952382 162
19 3300026142 Ga0207698_10432953 Ga0207698_104329532 162
20 3300046512 Ga0495610_0056680 Ga0495610_0056680_1286_1804 162
21 3300048919 Ga0496116_0134381 Ga0496116_0134381_624_1142 162
22 3300032002 Ga0307416_100000045 Ga0307416_10000004580 164
23 iso_pu_bacteria 2939664404 2939665382 164
24 3300005293 Ga0065715_10614095 Ga0065715_106140951 165
25 3300005356 Ga0070674_100360246 Ga0070674_1003602462 165
26 3300005840 Ga0068870_10574532 Ga0068870_105745321 165
27 3300006880 Ga0075429_101414754 Ga0075429_1014147541 165
28 3300009011 Ga0105251_10130814 Ga0105251_101308142 165
29 3300009094 Ga0111539_10364521 Ga0111539_103645212 165
30 3300013306 Ga0163162_10986767 Ga0163162_109867671 165
31 3300013306 Ga0163162_11142681 Ga0163162_111426811 165
32 3300025933 Ga0207706_11322472 Ga0207706_113224721 165
33 3300025937 Ga0207669_10370074 Ga0207669_103700742 165
34 3300026118 Ga0207675_100468102 Ga0207675_1004681022 165
35 3300050508 nmdc:mga09592_203064_c1 nmdc:mga09592_203064_c1_336_869 165
36 3300027111 Ga0209281_1000570 Ga0209281_100057022 166
37 3300009174 Ga0105241_10373449 Ga0105241_103734492 167
38 3300003320 rootH2_10141666 rootH2_101416662 168
39 3300005293 Ga0065715_10241090 Ga0065715_102410902 168
40 3300005333 Ga0070677_10011981 Ga0070677_100119812 168
41 3300005364 Ga0070673_100046183 Ga0070673_1000461832 168
42 3300005459 Ga0068867_100753123 Ga0068867_1007531231 168
43 3300005543 Ga0070672_100862746 Ga0070672_1008627462 168
44 3300006358 Ga0068871_100260322 Ga0068871_1002603221 168
45 3300013102 Ga0157371_10009458 Ga0157371_100094582 168
46 3300013105 Ga0157369_10151140 Ga0157369_101511403 168
47 3300013307 Ga0157372_10017754 Ga0157372_100177542 168
48 3300025315 Ga0207697_10072470 Ga0207697_100724702 168
49 3300025893 Ga0207682_10097543 Ga0207682_100975432 168
50 3300025926 Ga0207659_10011757 Ga0207659_100117572 168
51 3300025940 Ga0207691_10005245 Ga0207691_100052457 168
52 3300025960 Ga0207651_10042478 Ga0207651_100424783 168
53 3300037466 Ga0395898_0012252 Ga0395898_0012252_1528_2091 168
54 3300038443 Ga0395901_0050449 Ga0395901_0050449_3068_3631 168
55 iso_pu_bacteria 2910245624 2910245840 168
56 3300005335 Ga0070666_10017636 Ga0070666_100176365 169
57 3300005548 Ga0070665_100000074 Ga0070665_10000007462 169
58 3300005616 Ga0068852_100430987 Ga0068852_1004309872 169
59 3300005844 Ga0068862_100521536 Ga0068862_1005215361 169
60 3300009093 Ga0105240_10000253 Ga0105240_1000025329 169
61 3300009094 Ga0111539_10111742 Ga0111539_101117422 169
62 3300009174 Ga0105241_10000728 Ga0105241_1000072826 169
63 3300009174 Ga0105241_10309991 Ga0105241_103099912 169
64 3300009545 Ga0105237_10008622 Ga0105237_100086223 169
65 3300009545 Ga0105237_10147152 Ga0105237_101471522 169
66 3300009551 Ga0105238_10001192 Ga0105238_1000119228 169
67 3300010375 Ga0105239_10005705 Ga0105239_1000570514 169
68 3300010375 Ga0105239_10008502 Ga0105239_1000850213 169
69 3300013306 Ga0163162_10001089 Ga0163162_1000108913 169
70 3300013307 Ga0157372_10015826 Ga0157372_100158263 169
71 3300025914 Ga0207671_10196777 Ga0207671_101967772 169
72 3300028381 Ga0268264_10007535 Ga0268264_100075354 169
73 3300028558 Ga0265326_10105856 Ga0265326_101058561 169
74 3300028800 Ga0265338_10014611 Ga0265338_100146112 169
75 3300030521 Ga0307511_10000748 Ga0307511_1000074815 169
76 3300048918 Ga0496115_0355537 Ga0496115_0355537_33_563 169
77 iso_pu_bacteria 2738541278 2738729349 169
78 3300003322 rootL2_10115235 rootL2_1011523515 170
79 3300003323 rootH1_10020954 rootH1_100209542 170
80 3300003323 rootH1_10113739 rootH1_101137392 170
81 3300005295 Ga0065707_10358848 Ga0065707_103588481 170
82 3300005331 Ga0070670_100326913 Ga0070670_1003269132 170
83 3300005354 Ga0070675_100025261 Ga0070675_1000252613 170
84 3300005355 Ga0070671_100303272 Ga0070671_1003032721 170
85 3300005365 Ga0070688_100337224 Ga0070688_1003372242 170
86 3300005466 Ga0070685_10091510 Ga0070685_100915102 170
87 3300005564 Ga0070664_100403242 Ga0070664_1004032422 170
88 3300005577 Ga0068857_100545442 Ga0068857_1005454422 170
89 3300005841 Ga0068863_100047616 Ga0068863_1000476164 170
90 3300005937 Ga0081455_10287686 Ga0081455_102876862 170
91 3300006028 Ga0070717_10493645 Ga0070717_104936452 170
92 3300006173 Ga0070716_100322186 Ga0070716_1003221862 170
93 3300006195 Ga0075366_10567093 Ga0075366_105670932 170
94 3300009093 Ga0105240_10944466 Ga0105240_109444662 170
95 3300009174 Ga0105241_11174328 Ga0105241_111743281 170
96 3300009553 Ga0105249_10760026 Ga0105249_107600262 170
97 3300013307 Ga0157372_10261747 Ga0157372_102617472 170
98 3300014325 Ga0163163_10979353 Ga0163163_109793531 170
99 3300014326 Ga0157380_10008939 Ga0157380_100089394 170
100 3300014969 Ga0157376_11346866 Ga0157376_113468662 170
101 3300026116 Ga0207674_10618185 Ga0207674_106181852 170
102 3300028380 Ga0268265_10088188 Ga0268265_100881882 170
103 3300028786 Ga0307517_10001368 Ga0307517_1000136816 170
104 3300031730 Ga0307516_10161177 Ga0307516_101611772 170
105 3300032004 Ga0307414_11118807 Ga0307414_111188071 170
106 3300032005 Ga0307411_10012270 Ga0307411_100122703 170
107 3300038443 Ga0395901_0425295 Ga0395901_0425295_496_1014 170
108 3300045049 Ga0466959_0421012 Ga0466959_0421012_93_611 170
109 3300045051 Ga0451576_0298108 Ga0451576_0298108_907_1425 170
110 3300046514 Ga0495618_0615694 Ga0495618_0615694_107_625 170
111 3300053178 Ga0500637_0032975 Ga0500637_0032975_1741_2259 170
112 3300003354 JGI25160J50197_1002252 JGI25160J50197_10022524 171
113 3300005331 Ga0070670_100727948 Ga0070670_1007279481 171
114 3300005344 Ga0070661_100097734 Ga0070661_1000977342 171
115 3300005366 Ga0070659_100055452 Ga0070659_1000554522 171
116 3300005367 Ga0070667_100001632 Ga0070667_10000163212 171
117 3300005444 Ga0070694_100965522 Ga0070694_1009655221 171
118 3300005455 Ga0070663_100001762 Ga0070663_1000017623 171
119 3300005456 Ga0070678_101576547 Ga0070678_1015765471 171
120 3300005535 Ga0070684_100022962 Ga0070684_1000229622 171
121 3300005543 Ga0070672_100214802 Ga0070672_1002148022 171
122 3300005563 Ga0068855_100001023 Ga0068855_10000102313 171
123 3300005577 Ga0068857_100203247 Ga0068857_1002032472 171
124 3300005616 Ga0068852_100037721 Ga0068852_1000377213 171
125 3300005616 Ga0068852_100059243 Ga0068852_1000592432 171
126 3300005616 Ga0068852_100290730 Ga0068852_1002907302 171
127 3300005617 Ga0068859_100154699 Ga0068859_1001546993 171
128 3300005618 Ga0068864_100791518 Ga0068864_1007915181 171
129 3300005843 Ga0068860_100007493 Ga0068860_1000074936 171
130 3300006358 Ga0068871_100752350 Ga0068871_1007523501 171
131 3300006881 Ga0068865_100448297 Ga0068865_1004482971 171
132 3300006931 Ga0097620_100154693 Ga0097620_1001546933 171
133 3300009093 Ga0105240_10000448 Ga0105240_100004484 171
134 3300009101 Ga0105247_10262910 Ga0105247_102629101 171
135 3300009545 Ga0105237_10026832 Ga0105237_100268325 171
136 3300009545 Ga0105237_10053797 Ga0105237_100537973 171
137 3300010375 Ga0105239_10000079 Ga0105239_100000795 171
138 3300010375 Ga0105239_10037344 Ga0105239_100373445 171
139 3300013100 Ga0157373_10161489 Ga0157373_101614891 171
140 3300013102 Ga0157371_10000869 Ga0157371_1000086936 171
141 3300013104 Ga0157370_10007602 Ga0157370_1000760212 171
142 3300013104 Ga0157370_10028527 Ga0157370_100285273 171
143 3300013104 Ga0157370_10203532 Ga0157370_102035322 171
144 3300013104 Ga0157370_11722417 Ga0157370_117224171 171
145 3300013105 Ga0157369_10051177 Ga0157369_100511773 171
146 3300013105 Ga0157369_10061874 Ga0157369_100618743 171
147 3300013297 Ga0157378_10055876 Ga0157378_100558763 171
148 3300013307 Ga0157372_10000016 Ga0157372_10000016169 171
149 3300013307 Ga0157372_10000813 Ga0157372_1000081317 171
150 3300013307 Ga0157372_10491009 Ga0157372_104910092 171
151 3300013308 Ga0157375_10186117 Ga0157375_101861172 171
152 3300014325 Ga0163163_10786861 Ga0163163_107868612 171
153 3300014326 Ga0157380_10039899 Ga0157380_100398993 171
154 3300014968 Ga0157379_10130070 Ga0157379_101300702 171
155 3300014969 Ga0157376_10001630 Ga0157376_100016302 171
156 3300025302 Ga0207426_1000009 Ga0207426_1000009450 171
157 3300025904 Ga0207647_10000390 Ga0207647_1000039021 171
158 3300025914 Ga0207671_10004609 Ga0207671_100046098 171
159 3300025920 Ga0207649_10164810 Ga0207649_101648102 171
160 3300025926 Ga0207659_10028428 Ga0207659_100284282 171
161 3300025932 Ga0207690_10287578 Ga0207690_102875782 171
162 3300025936 Ga0207670_10517539 Ga0207670_105175392 171
163 3300025944 Ga0207661_10291732 Ga0207661_102917322 171
164 3300025949 Ga0207667_10000641 Ga0207667_1000064120 171
165 3300025949 Ga0207667_10000863 Ga0207667_1000086310 171
166 3300026041 Ga0207639_10029461 Ga0207639_100294612 171
167 3300026041 Ga0207639_10464853 Ga0207639_104648532 171
168 3300026067 Ga0207678_10055038 Ga0207678_100550384 171
169 3300026075 Ga0207708_10077209 Ga0207708_100772093 171
170 3300026116 Ga0207674_10250207 Ga0207674_102502072 171
171 3300026121 Ga0207683_11238841 Ga0207683_112388411 171
172 3300026142 Ga0207698_10021368 Ga0207698_100213682 171
173 3300026142 Ga0207698_10321426 Ga0207698_103214262 171
174 3300027471 Ga0209995_1026542 Ga0209995_10265421 171
175 3300028666 Ga0265336_10007193 Ga0265336_100071932 171
176 3300031507 Ga0307509_10177143 Ga0307509_101771433 171
177 3300032126 Ga0307415_100286781 Ga0307415_1002867813 171
178 3300033180 Ga0307510_10000058 Ga0307510_1000005854 171
179 3300035692 Ga0373935_0842224 Ga0373935_0842224_124_660 171
180 3300044656 Ga0466969_0015787 Ga0466969_0015787_2351_2869 171
181 3300044673 Ga0453683_0362092 Ga0453683_0362092_88_609 171
182 3300044684 Ga0466966_0198475 Ga0466966_0198475_163_681 171
183 3300044712 Ga0453684_0524937 Ga0453684_0524937_211_732 171
184 3300044712 Ga0453684_0536589 Ga0453684_0536589_611_1135 171
185 3300044765 Ga0466970_0155379 Ga0466970_0155379_323_841 171
186 3300045049 Ga0466959_0005499 Ga0466959_0005499_4688_5206 171
187 3300045836 Ga0466958_0017675 Ga0466958_0017675_2190_2708 171
188 3300046507 Ga0495606_0006879 Ga0495606_0006879_1172_1690 171
189 3300046522 Ga0495643_0101369 Ga0495643_0101369_360_968 171
190 3300048926 Ga0496123_0008215 Ga0496123_0008215_8214_8807 171
191 3300049569 Ga0501032_0008334 Ga0501032_0008334_2630_3256 171
192 3300049570 Ga0501033_0667424 Ga0501033_0667424_11_529 171
193 3300049571 Ga0501034_0010491 Ga0501034_0010491_8840_9358 171
194 3300049571 Ga0501034_0041802 Ga0501034_0041802_856_1374 171
195 3300049571 Ga0501034_0258298 Ga0501034_0258298_997_1515 171
196 3300049572 Ga0501036_0202986 Ga0501036_0202986_145_663 171
197 3300049573 Ga0501037_0101500 Ga0501037_0101500_711_1229 171
198 3300049574 Ga0501038_0028657 Ga0501038_0028657_521_1039 171
199 3300049575 Ga0501039_0027227 Ga0501039_0027227_1598_2116 171
200 3300049579 Ga0501043_0030942 Ga0501043_0030942_2081_2599 171
201 3300049579 Ga0501043_0031351 Ga0501043_0031351_887_1405 171
202 3300049581 Ga0501047_0949965 Ga0501047_0949965_79_597 171
203 3300049822 Ga0501035_0295483 Ga0501035_0295483_776_1294 171
204 3300049823 Ga0501044_0099865 Ga0501044_0099865_2036_2554 171
205 3300049823 Ga0501044_0117025 Ga0501044_0117025_68_586 171
206 3300049823 Ga0501044_0192641 Ga0501044_0192641_1270_1788 171
207 3300049823 Ga0501044_0248828 Ga0501044_0248828_460_978 171
208 3300053108 Ga0500562_000089 Ga0500562_000089_640_1161 171
209 3300053153 Ga0500616_0006824 Ga0500616_0006824_4954_5475 171
210 3300053730 Ga0500645_056264 Ga0500645_056264_80_601 171
211 3300061719 Ga0466962_0018189 Ga0466962_0018189_705_1223 171
212 3300005335 Ga0070666_10155978 Ga0070666_101559782 172
213 3300005364 Ga0070673_101217173 Ga0070673_1012171731 172
214 3300005539 Ga0068853_100004660 Ga0068853_1000046604 172
215 3300005543 Ga0070672_100074480 Ga0070672_1000744801 172
216 3300005563 Ga0068855_100850083 Ga0068855_1008500832 172
217 3300005564 Ga0070664_101467623 Ga0070664_1014676231 172
218 3300005577 Ga0068857_100003175 Ga0068857_10000317513 172
219 3300005578 Ga0068854_100022470 Ga0068854_1000224702 172
220 3300005614 Ga0068856_100027636 Ga0068856_1000276366 172
221 3300005618 Ga0068864_100103634 Ga0068864_1001036343 172
222 3300005843 Ga0068860_100002368 Ga0068860_1000023684 172
223 3300006847 Ga0075431_100359935 Ga0075431_1003599354 172
224 3300006880 Ga0075429_101064392 Ga0075429_1010643922 172
225 3300009147 Ga0114129_11568316 Ga0114129_115683162 172
226 3300009545 Ga0105237_10000826 Ga0105237_100008265 172
227 3300009545 Ga0105237_10489413 Ga0105237_104894132 172
228 3300013102 Ga0157371_10191773 Ga0157371_101917732 172
229 3300013307 Ga0157372_10001688 Ga0157372_1000168825 172
230 3300013307 Ga0157372_10325710 Ga0157372_103257102 172
231 3300014968 Ga0157379_10514060 Ga0157379_105140602 172
232 3300014968 Ga0157379_11472196 Ga0157379_114721961 172
233 3300025903 Ga0207680_10264694 Ga0207680_102646942 172
234 3300025904 Ga0207647_10173538 Ga0207647_101735382 172
235 3300025913 Ga0207695_10071819 Ga0207695_100718193 172
236 3300025914 Ga0207671_10003345 Ga0207671_100033454 172
237 3300025914 Ga0207671_10205574 Ga0207671_102055742 172
238 3300025921 Ga0207652_10642515 Ga0207652_106425152 172
239 3300025931 Ga0207644_10955613 Ga0207644_109556131 172
240 3300025936 Ga0207670_10467446 Ga0207670_104674462 172
241 3300025981 Ga0207640_10378612 Ga0207640_103786122 172
242 3300026023 Ga0207677_10472354 Ga0207677_104723542 172
243 3300026041 Ga0207639_10009693 Ga0207639_100096934 172
244 3300026078 Ga0207702_10217615 Ga0207702_102176153 172
245 3300026095 Ga0207676_10395643 Ga0207676_103956432 172
246 3300026116 Ga0207674_10001072 Ga0207674_100010728 172
247 3300028381 Ga0268264_10002152 Ga0268264_100021526 172
248 3300029957 Ga0265324_10023692 Ga0265324_100236922 172
249 3300031251 Ga0265327_10122841 Ga0265327_101228411 172
250 3300037312 Ga0395899_0205516 Ga0395899_0205516_829_1353 172
251 3300037312 Ga0395899_0559147 Ga0395899_0559147_126_650 172
252 3300037418 Ga0395900_0050523 Ga0395900_0050523_1994_2518 172
253 3300037418 Ga0395900_0656627 Ga0395900_0656627_419_943 172
254 3300037471 Ga0395905_0007176 Ga0395905_0007176_1499_2023 172
255 3300039437 Ga0436365_1103287 Ga0436365_1103287_411_959 172
256 3300042007 Ga0439449_0001193 Ga0439449_0001193_6778_7299 172
257 3300049686 Ga0501257_028381 Ga0501257_028381_800_1321 172
258 3300050493 nmdc:mga0k408_13297_c1 nmdc:mga0k408_13297_c1_677_1210 172
259 3300050507 nmdc:mga05p37_959069_c1 nmdc:mga05p37_959069_c1_137_658 172
260 3300050510 nmdc:mga06r32_589738_c1 nmdc:mga06r32_589738_c1_546_1067 172
261 3300005331 Ga0070670_100058602 Ga0070670_1000586023 173
262 3300005356 Ga0070674_100127782 Ga0070674_1001277822 173
263 3300005455 Ga0070663_100009380 Ga0070663_1000093803 173
264 3300005535 Ga0070684_100023020 Ga0070684_1000230205 173
265 3300005564 Ga0070664_100339898 Ga0070664_1003398982 173
266 3300005616 Ga0068852_100967996 Ga0068852_1009679962 173
267 3300005844 Ga0068862_100037474 Ga0068862_1000374742 173
268 3300009176 Ga0105242_10010900 Ga0105242_100109005 173
269 3300009545 Ga0105237_10050502 Ga0105237_100505024 173
270 3300013307 Ga0157372_10167272 Ga0157372_101672722 173
271 3300013307 Ga0157372_10357892 Ga0157372_103578924 173
272 3300013308 Ga0157375_11579180 Ga0157375_115791801 173
273 3300014325 Ga0163163_11505973 Ga0163163_115059731 173
274 3300014326 Ga0157380_10006309 Ga0157380_100063094 173
275 3300014326 Ga0157380_10161380 Ga0157380_101613803 173
276 3300014326 Ga0157380_10765690 Ga0157380_107656902 173
277 3300014745 Ga0157377_10071714 Ga0157377_100717142 173
278 3300017792 Ga0163161_10100731 Ga0163161_101007312 173
279 3300017792 Ga0163161_11190265 Ga0163161_111902651 173
280 3300025893 Ga0207682_10228281 Ga0207682_102282812 173
281 3300025925 Ga0207650_10142372 Ga0207650_101423723 173
282 3300025938 Ga0207704_10003550 Ga0207704_100035502 173
283 3300025940 Ga0207691_10066079 Ga0207691_100660792 173
284 3300025944 Ga0207661_10164920 Ga0207661_101649203 173
285 3300025945 Ga0207679_10303143 Ga0207679_103031432 173
286 3300026067 Ga0207678_10110561 Ga0207678_101105611 173
287 3300026088 Ga0207641_10469668 Ga0207641_104696682 173
288 3300028381 Ga0268264_10459544 Ga0268264_104595442 173
289 3300031456 Ga0307513_10305383 Ga0307513_103053832 173
290 3300031731 Ga0307405_10536780 Ga0307405_105367801 173
291 3300032002 Ga0307416_101320583 Ga0307416_1013205831 173
292 3300037471 Ga0395905_0106561 Ga0395905_0106561_1960_2493 173
293 3300037471 Ga0395905_1077230 Ga0395905_1077230_108_653 173
294 3300039437 Ga0436365_0262826 Ga0436365_0262826_16093_16653 173
295 3300044684 Ga0466966_0022298 Ga0466966_0022298_1416_1961 173
296 3300044693 Ga0466961_0436722 Ga0466961_0436722_166_711 173
297 3300044842 Ga0466957_0001277 Ga0466957_0001277_5177_5722 173
298 3300045049 Ga0466959_0000034 Ga0466959_0000034_30153_30698 173
299 3300046460 Ga0495638_0319565 Ga0495638_0319565_69_611 173
300 3300049569 Ga0501032_0164880 Ga0501032_0164880_605_1147 173
301 3300049571 Ga0501034_0227885 Ga0501034_0227885_176_718 173
302 3300049572 Ga0501036_0044956 Ga0501036_0044956_3002_3544 173
303 3300049573 Ga0501037_0095014 Ga0501037_0095014_234_776 173
304 3300049573 Ga0501037_0180208 Ga0501037_0180208_549_1109 173
305 3300049574 Ga0501038_0019075 Ga0501038_0019075_2799_3341 173
306 3300049575 Ga0501039_0033352 Ga0501039_0033352_91_633 173
307 3300049579 Ga0501043_0034917 Ga0501043_0034917_2465_3007 173
308 3300049580 Ga0501046_0252687 Ga0501046_0252687_235_777 173
309 3300049581 Ga0501047_0169593 Ga0501047_0169593_1375_1917 173
310 3300049584 Ga0501068_0787411 Ga0501068_0787411_64_606 173
311 3300049585 Ga0501069_0032180 Ga0501069_0032180_2264_2824 173
312 3300049589 Ga0501073_0563530 Ga0501073_0563530_235_777 173
313 3300049661 Ga0501217_000750 Ga0501217_000750_846_1403 173
314 3300049663 Ga0501223_000829 Ga0501223_000829_2524_3081 173
315 3300049670 Ga0501236_035726 Ga0501236_035726_145_702 173
316 3300049675 Ga0501243_005930 Ga0501243_005930_367_924 173
317 3300049681 Ga0501251_035794 Ga0501251_035794_86_631 173
318 3300049683 Ga0501253_004611 Ga0501253_004611_1134_1691 173
319 3300049688 Ga0501259_004710 Ga0501259_004710_772_1329 173
320 3300049742 Ga0501080_0183799 Ga0501080_0183799_1050_1592 173
321 3300049744 Ga0501083_0575066 Ga0501083_0575066_113_655 173
322 3300049765 Ga0501268_017698 Ga0501268_017698_614_1171 173
323 3300049779 Ga0501283_050306 Ga0501283_050306_55_612 173
324 3300049822 Ga0501035_0210558 Ga0501035_0210558_72_614 173
325 3300049823 Ga0501044_0038452 Ga0501044_0038452_1311_1853 173
326 3300049823 Ga0501044_0246740 Ga0501044_0246740_319_879 173
327 3300049823 Ga0501044_0442164 Ga0501044_0442164_569_1108 173
328 3300050493 nmdc:mga0k408_44816_c1 nmdc:mga0k408_44816_c1_132_677 173
329 3300053090 Ga0500646_0047850 Ga0500646_0047850_95_652 173
330 3300053156 Ga0500622_0028649 Ga0500622_0028649_501_1046 173
331 3300053727 Ga0500611_000022 Ga0500611_000022_9813_10355 173
332 3300053727 Ga0500611_017755 Ga0500611_017755_328_885 173
333 3300003320 rootH2_10057952 rootH2_100579521 174
334 3300005329 Ga0070683_100509900 Ga0070683_1005099002 174
335 3300005339 Ga0070660_100013493 Ga0070660_1000134932 174
336 3300005355 Ga0070671_100016107 Ga0070671_1000161072 174
337 3300005366 Ga0070659_100125476 Ga0070659_1001254762 174
338 3300005367 Ga0070667_100002669 Ga0070667_10000266911 174
339 3300005367 Ga0070667_100435789 Ga0070667_1004357892 174
340 3300005456 Ga0070678_100168128 Ga0070678_1001681282 174
341 3300005457 Ga0070662_100570865 Ga0070662_1005708652 174
342 3300005458 Ga0070681_10827639 Ga0070681_108276391 174
343 3300005459 Ga0068867_100218495 Ga0068867_1002184951 174
344 3300005543 Ga0070672_100122009 Ga0070672_1001220092 174
345 3300005564 Ga0070664_100361919 Ga0070664_1003619191 174
346 3300005614 Ga0068856_100004728 Ga0068856_10000472812 174
347 3300005616 Ga0068852_100107599 Ga0068852_1001075992 174
348 3300005616 Ga0068852_100174042 Ga0068852_1001740422 174
349 3300005618 Ga0068864_100047771 Ga0068864_1000477712 174
350 3300005618 Ga0068864_100251470 Ga0068864_1002514702 174
351 3300005618 Ga0068864_100791028 Ga0068864_1007910282 174
352 3300005842 Ga0068858_100292383 Ga0068858_1002923832 174
353 3300005843 Ga0068860_100391909 Ga0068860_1003919092 174
354 3300005843 Ga0068860_100396191 Ga0068860_1003961912 174
355 3300006237 Ga0097621_100000695 Ga0097621_10000069514 174
356 3300006237 Ga0097621_100177027 Ga0097621_1001770273 174
357 3300006237 Ga0097621_101193605 Ga0097621_1011936052 174
358 3300006237 Ga0097621_101250309 Ga0097621_1012503092 174
359 3300006358 Ga0068871_100000091 Ga0068871_10000009133 174
360 3300006358 Ga0068871_100115535 Ga0068871_1001155352 174
361 3300006358 Ga0068871_100161570 Ga0068871_1001615703 174
362 3300006881 Ga0068865_100126011 Ga0068865_1001260112 174
363 3300009177 Ga0105248_10093258 Ga0105248_100932582 174
364 3300010375 Ga0105239_10601867 Ga0105239_106018672 174
365 3300013100 Ga0157373_10178997 Ga0157373_101789972 174
366 3300013102 Ga0157371_10043864 Ga0157371_100438642 174
367 3300013102 Ga0157371_10192404 Ga0157371_101924042 174
368 3300013104 Ga0157370_10077019 Ga0157370_100770193 174
369 3300013104 Ga0157370_10182761 Ga0157370_101827611 174
370 3300013105 Ga0157369_10200458 Ga0157369_102004583 174
371 3300013296 Ga0157374_10002018 Ga0157374_1000201818 174
372 3300013297 Ga0157378_10031598 Ga0157378_100315983 174
373 3300013297 Ga0157378_10091078 Ga0157378_100910783 174
374 3300013306 Ga0163162_10000434 Ga0163162_1000043413 174
375 3300013306 Ga0163162_11751479 Ga0163162_117514792 174
376 3300013307 Ga0157372_10051351 Ga0157372_100513511 174
377 3300013307 Ga0157372_10122542 Ga0157372_101225421 174
378 3300013307 Ga0157372_10187070 Ga0157372_101870702 174
379 3300013308 Ga0157375_10000118 Ga0157375_1000011870 174
380 3300013308 Ga0157375_10761941 Ga0157375_107619411 174
381 3300014325 Ga0163163_10000694 Ga0163163_1000069416 174
382 3300014325 Ga0163163_10383883 Ga0163163_103838831 174
383 3300014968 Ga0157379_10048877 Ga0157379_100488774 174
384 3300014968 Ga0157379_10213179 Ga0157379_102131792 174
385 3300014969 Ga0157376_10023493 Ga0157376_100234934 174
386 3300017792 Ga0163161_10002543 Ga0163161_100025439 174
387 3300025903 Ga0207680_10106878 Ga0207680_101068782 174
388 3300025903 Ga0207680_10207824 Ga0207680_102078242 174
389 3300025912 Ga0207707_10617875 Ga0207707_106178752 174
390 3300025919 Ga0207657_10008321 Ga0207657_100083212 174
391 3300025926 Ga0207659_10335760 Ga0207659_103357602 174
392 3300025931 Ga0207644_10120675 Ga0207644_101206752 174
393 3300025932 Ga0207690_10050001 Ga0207690_100500013 174
394 3300025933 Ga0207706_10035158 Ga0207706_100351584 174
395 3300025938 Ga0207704_10112713 Ga0207704_101127132 174
396 3300025938 Ga0207704_10770394 Ga0207704_107703941 174
397 3300025945 Ga0207679_10183439 Ga0207679_101834393 174
398 3300025945 Ga0207679_10225136 Ga0207679_102251362 174
399 3300025949 Ga0207667_10212579 Ga0207667_102125793 174
400 3300025981 Ga0207640_10152194 Ga0207640_101521944 174
401 3300025986 Ga0207658_10085873 Ga0207658_100858732 174
402 3300026088 Ga0207641_10023182 Ga0207641_100231823 174
403 3300026089 Ga0207648_10406806 Ga0207648_104068062 174
404 3300026095 Ga0207676_10036853 Ga0207676_100368533 174
405 3300026116 Ga0207674_10232786 Ga0207674_102327862 174
406 3300026121 Ga0207683_10276137 Ga0207683_102761371 174
407 3300026121 Ga0207683_10290635 Ga0207683_102906352 174
408 3300028381 Ga0268264_10929615 Ga0268264_109296151 174
409 3300032004 Ga0307414_10359015 Ga0307414_103590152 174
410 3300042876 Ga0451577_0159545 Ga0451577_0159545_1294_1881 174
411 3300046660 Ga0495625_0208650 Ga0495625_0208650_648_1196 174
412 3300048904 Ga0496101_0016175 Ga0496101_0016175_2578_3147 174
413 3300048905 Ga0496102_0323400 Ga0496102_0323400_11_580 174
414 3300048913 Ga0496110_0424496 Ga0496110_0424496_174_743 174
415 3300049651 Ga0501201_003835 Ga0501201_003835_355_903 174
416 3300049653 Ga0501206_041463 Ga0501206_041463_117_665 174
417 3300049672 Ga0501239_012839 Ga0501239_012839_314_862 174
418 3300049677 Ga0501247_016295 Ga0501247_016295_334_882 174
419 3300049683 Ga0501253_034831 Ga0501253_034831_389_937 174
420 3300049688 Ga0501259_014085 Ga0501259_014085_672_1220 174
421 3300049690 Ga0501261_066417 Ga0501261_066417_62_610 174
422 3300049763 Ga0501266_002843 Ga0501266_002843_1261_1809 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

44

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o4v-assembly1.cif.gz_A crystal structure of the catalytic subunit of a phosphoribosylaminoimidazole mutase (tm0446) from thermotoga maritima at 1.77 a resolution 0.9769 6 167
2fw9-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9759 6 154
4zjy-assembly1.cif.gz_B structure of acetobacter aceti pure-s57n 0.9758 4 154
4zmb-assembly1.cif.gz_B structure of acetobacter aceti pure-s57v,y154f 0.9754 4 154
2fwb-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9753 4 154
ID Description Score Start End Superfamily
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9776 2 168 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.968 8 164 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9668 12 168 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9656 4 154 3.40.50.1970
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9538 28 163 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A520DQL1-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase (EC 4.1.1.21, EC 5.4.99.18) 0.9932 8 134 GO:0004638
GO:0006189
GO:0034023
AF-A0A2D9J6R3-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase 0.9931 6 152 GO:0006189
GO:0016853
AF-A0A2H0GEF4-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase 0.9915 4 151 GO:0006189
GO:0016853
AF-A0A7V4HB36-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase (EC 4.1.1.21, EC 5.4.99.18) 0.9912 4 141 GO:0004638
GO:0006189
GO:0034023
AF-A0A7C5L6X7-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase (EC 4.1.1.21, EC 5.4.99.18) 0.9904 6 150 GO:0004638
GO:0006189
GO:0034023

Feature Viewer

pLDDT pTM Quality
93.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map