F440307

General Info

Members Datasets Scaffolds Average Seq Length
422 257 372 205

Family's Representative Sequence

Representative Sequence 3300030744|Ga0316181_1171432|Ga0316181_11714322
Length 204
Sequence MREGFGFVDELAPGIRWDSKYATWDNFTGKPVDGYLVNRIVGTRELCAALAKARDEAAALGFGILLWDGYRPQRAVDAFLRWAEGPAPDDDERKRVHYPSITRPEMFEKGYVATKSGHSRGSTVDLTLFSLATGALLDMGGDHDLMDEISHHGAAGVSEVAARNRAHLCSVMESCGFSRYDNEWWHYSLIAEPYPDTYFDFVVG

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
7 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
8 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
9 2687453737 Frankia sp. BMG5.36 Isolate Nodule
10 2738541305 Nocardioides sp. CF167 Isolate Unclassified
11 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
12 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
13 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
14 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
15 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
16 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
17 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
18 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
19 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
20 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
21 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
22 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
23 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
24 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
25 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
26 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
27 2867428634 Streptomyces sp. RP5T Isolate Unclassified
28 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
29 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
30 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
31 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
32 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
33 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
34 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
35 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
36 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
37 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
38 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
39 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
40 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
41 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
42 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
124 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
125 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
244 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
245 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
246 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
252 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
253 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
254 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
255 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
256 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
257 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.15
Metatranscriptomes 0
Isolates 11.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.35
Nodule 1.18
Rhizoplane 1.18
Rhizosphere 79.38
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10026938 3300003322 Bacteria 5857
2 rootL2_10329516 3300003322 Bacteria 1076
3 Ga0070658_10370863 3300005327 Bacteria 1227
4 Ga0070670_100778254 3300005331 Bacteria 863
5 Ga0068868_100600501 3300005338 Bacteria 975
6 Ga0070667_100066699 3300005367 Bacteria 3058
7 Ga0070667_100159620 3300005367 Bacteria 1985
8 Ga0070709_10120774 3300005434 Bacteria 1776
9 Ga0070714_100006311 3300005435 Bacteria 9138
10 Ga0070714_101145408 3300005435 Bacteria 758
11 Ga0070713_100086578 3300005436 Bacteria 2686
12 Ga0070713_100709411 3300005436 Bacteria 961
13 Ga0070710_10002048 3300005437 Bacteria 9547
14 Ga0070711_100280081 3300005439 Bacteria 1319
15 Ga0070711_100381534 3300005439 Bacteria 1140
16 Ga0070700_100497311 3300005441 Bacteria 937
17 Ga0070708_100103215 3300005445 Bacteria 2613
18 Ga0070663_100016273 3300005455 Bacteria 4824
19 Ga0070663_100151772 3300005455 Bacteria 1777
20 Ga0070681_10322631 3300005458 Bacteria 1454
21 Ga0070684_100125761 3300005535 Bacteria 2309
22 Ga0068853_100056923 3300005539 Bacteria 3372
23 Ga0068855_101031304 3300005563 Bacteria 863
24 Ga0068856_100014553 3300005614 Bacteria 7603
25 Ga0068856_100442094 3300005614 Bacteria 1321
26 Ga0068852_100036339 3300005616 Bacteria 4121
27 Ga0068852_100339298 3300005616 Bacteria 1464
28 Ga0068863_100626202 3300005841 Bacteria 1066
29 Ga0068858_100053628 3300005842 Bacteria 3729
30 Ga0068860_100000669 3300005843 Bacteria 39653
31 Ga0068860_100018186 3300005843 Bacteria 6841
32 Ga0081539_10135596 3300005985 Bacteria 1203
33 Ga0070717_10128178 3300006028 Bacteria 2180
34 Ga0075365_10014763 3300006038 Bacteria 4706
35 Ga0075365_10020990 3300006038 Bacteria 4064
36 Ga0075365_10053917 3300006038 Bacteria 2665
37 Ga0075365_10059959 3300006038 Bacteria 2538
38 Ga0075365_10142071 3300006038 Bacteria 1667
39 Ga0075365_10240067 3300006038 Bacteria 1273
40 Ga0075363_100059437 3300006048 Bacteria 2055
41 Ga0075364_10004072 3300006051 Bacteria 8389
42 Ga0075364_10059016 3300006051 Bacteria 2515
43 Ga0075364_10148642 3300006051 Bacteria 1578
44 Ga0075367_10163527 3300006178 Bacteria 1384
45 Ga0075370_10048716 3300006353 Bacteria 2401
46 Ga0075370_10050191 3300006353 Bacteria 2366
47 Ga0105240_10035555 3300009093 Bacteria 6418
48 Ga0105243_10036313 3300009148 Bacteria 3825
49 Ga0105238_10022761 3300009551 Bacteria 6386
50 Ga0105028_100117 3300009993 Bacteria 8244
51 Ga0105239_10278371 3300010375 Bacteria 1883
52 Ga0105239_10430015 3300010375 Bacteria 1496
53 Ga0157369_10162277 3300013105 Bacteria 2359
54 Ga0163162_10366598 3300013306 Bacteria 1574
55 Ga0157375_10164176 3300013308 Bacteria 2365
56 Ga0163163_10052820 3300014325 Bacteria 4011
57 Ga0157380_10871931 3300014326 Bacteria 924
58 Ga0157379_10000516 3300014968 Bacteria 31318
59 Ga0157379_10297843 3300014968 Bacteria 1470
60 Ga0163161_10040307 3300017792 Bacteria 3354
61 Ga0224572_1007101 3300024225 Bacteria 2042
62 Ga0224572_1053353 3300024225 Bacteria 752
63 Ga0207710_10221867 3300025900 Bacteria 939
64 Ga0207647_10010822 3300025904 Bacteria 6420
65 Ga0207685_10025760 3300025905 Bacteria 2035
66 Ga0207699_10106737 3300025906 Bacteria 1788
67 Ga0207695_10267502 3300025913 Bacteria 1606
68 Ga0207671_10223728 3300025914 Bacteria 1475
69 Ga0207657_10118805 3300025919 Bacteria 2176
70 Ga0207652_10698239 3300025921 Bacteria 905
71 Ga0207694_10000220 3300025924 Bacteria 55978
72 Ga0207700_10024024 3300025928 Bacteria 4214
73 Ga0207700_10362830 3300025928 Bacteria 1263
74 Ga0207664_10016642 3300025929 Bacteria 5370
75 Ga0207664_10019644 3300025929 Bacteria 4998
76 Ga0207644_10065541 3300025931 Bacteria 2642
77 Ga0207709_10002600 3300025935 Bacteria 11247
78 Ga0207711_10000170 3300025941 Bacteria 70147
79 Ga0207661_10462854 3300025944 Bacteria 1156
80 Ga0207667_10110291 3300025949 Bacteria 2839
81 Ga0207667_10146772 3300025949 Bacteria 2428
82 Ga0207667_10703032 3300025949 Bacteria 1013
83 Ga0207651_10429257 3300025960 Bacteria 1130
84 Ga0207640_10096237 3300025981 Bacteria 2063
85 Ga0207658_10007168 3300025986 Bacteria 7599
86 Ga0207658_10067156 3300025986 Bacteria 2700
87 Ga0207703_10020490 3300026035 Bacteria 5171
88 Ga0207678_10000793 3300026067 Bacteria 28952
89 Ga0207678_10062753 3300026067 Bacteria 3193
90 Ga0207702_10025866 3300026078 Bacteria 4872
91 Ga0207702_10154841 3300026078 Bacteria 2088
92 Ga0207702_10736556 3300026078 Bacteria 973
93 Ga0207641_10279786 3300026088 Bacteria 1569
94 Ga0207648_10539700 3300026089 Bacteria 1070
95 Ga0207674_10460150 3300026116 Bacteria 1229
96 Ga0207675_100433853 3300026118 Bacteria 1300
97 Ga0207698_10088585 3300026142 Bacteria 2525
98 Ga0268266_10456793 3300028379 Bacteria 1215
99 Ga0268264_10000510 3300028381 Bacteria 50047
100 Ga0268264_10112569 3300028381 Bacteria 2386
101 Ga0265337_1000242 3300028556 Bacteria 29618
102 Ga0265326_10002177 3300028558 Bacteria 6650
103 Ga0265319_1006108 3300028563 Bacteria 5635
104 Ga0265334_10000830 3300028573 Bacteria 15427
105 Ga0265318_10026691 3300028577 Bacteria 2273
106 Ga0265336_10008459 3300028666 Bacteria 3608
107 Ga0307515_10033425 3300028794 Bacteria 8468
108 Ga0265338_10001399 3300028800 Bacteria 39290
109 Ga0265338_10021168 3300028800 Bacteria 6795
110 Ga0307511_10038773 3300030521 Bacteria 4083
111 Ga0316177_1181354 3300030731 Bacteria 5953
112 Ga0316176_1069150 3300030732 Bacteria 1328
113 Ga0316176_1151539 3300030732 Bacteria 1632
114 Ga0316176_1169012 3300030732 Bacteria 2332
115 Ga0314311_1006858 3300030733 Bacteria 2043
116 Ga0316181_1171432 3300030744 Bacteria 808
117 Ga0265332_10001033 3300031238 Bacteria 16399
118 Ga0265320_10001145 3300031240 Bacteria 19503
119 Ga0265340_10003687 3300031247 Bacteria 8622
120 Ga0265340_10027239 3300031247 Bacteria 2882
121 Ga0265316_10068393 3300031344 Bacteria 2744
122 Ga0307513_10000003 3300031456 Bacteria 590921
123 Ga0307513_10022104 3300031456 Bacteria 7487
124 Ga0307509_10154746 3300031507 Bacteria 2201
125 Ga0307508_10000982 3300031616 Bacteria 33131
126 Ga0307508_10095933 3300031616 Bacteria 2557
127 Ga0265314_10007842 3300031711 Bacteria 9224
128 Ga0265342_10003442 3300031712 Bacteria 12991
129 Ga0307516_10026282 3300031730 Bacteria 5913
130 Ga0307516_10064659 3300031730 Bacteria 3536
131 Ga0307405_10281358 3300031731 Bacteria 1252
132 Ga0307410_10186631 3300031852 Bacteria 1574
133 Ga0307406_10088516 3300031901 Bacteria 2078
134 Ga0307407_10312529 3300031903 Bacteria 1100
135 Ga0307412_10307839 3300031911 Bacteria 1255
136 Ga0307409_100114874 3300031995 Bacteria 2266
137 Ga0307416_100657988 3300032002 Bacteria 1133
138 Ga0307415_100667837 3300032126 Bacteria 934
139 Ga0307507_10011980 3300033179 Bacteria 10823
140 Ga0307510_10076522 3300033180 Bacteria 3291
141 Ga0307510_10443583 3300033180 Bacteria 739
142 Ga0373940_0017581 3300035088 Bacteria 1784
143 Ga0373939_0058899 3300035114 Bacteria 1216
144 Ga0373941_0004317 3300035115 Bacteria 3276
145 Ga0373942_0000118 3300035207 Bacteria 18298
146 Ga0373961_0049723 3300035241 Bacteria 1240
147 Ga0373931_0017791 3300035691 Bacteria 3522
148 Ga0373937_0138497 3300036401 Bacteria 2276
149 Ga0395899_0033195 3300037312 Bacteria 3877
150 Ga0395900_0001084 3300037418 Bacteria 34636
151 Ga0395900_0029358 3300037418 Bacteria 5642
152 Ga0395898_0000270 3300037466 Bacteria 127152
153 Ga0395898_0001182 3300037466 Bacteria 39813
154 Ga0395898_0133767 3300037466 Bacteria 2374
155 Ga0395898_0222150 3300037466 Bacteria 1802
156 Ga0395905_0291441 3300037471 Bacteria 1519
157 Ga0395901_0379202 3300038443 Bacteria 1456
158 Ga0395901_0758502 3300038443 Bacteria 963
159 Ga0451791_0795522 3300041451 Bacteria 5652
160 Ga0451791_0889016 3300041451 Bacteria 988
161 Ga0451853_1533244 3300041512 Bacteria 954
162 Ga0439448_0027384 3300042005 Bacteria 1796
163 Ga0450903_001626 3300042138 Bacteria 4176
164 Ga0439458_0001072 3300042157 Bacteria 6971
165 Ga0466969_0011531 3300044656 Bacteria 4678
166 Ga0466969_0181925 3300044656 Bacteria 962
167 Ga0466972_0001194 3300044658 Bacteria 12489
168 Ga0466972_0004812 3300044658 Bacteria 6769
169 Ga0466972_0033284 3300044658 Bacteria 2528
170 Ga0466972_0073726 3300044658 Bacteria 1627
171 Ga0466972_0082250 3300044658 Bacteria 1532
172 Ga0466972_0085350 3300044658 Bacteria 1501
173 Ga0466972_0100538 3300044658 Bacteria 1368
174 Ga0466965_0005479 3300044683 Bacteria 5723
175 Ga0466965_0126057 3300044683 Bacteria 1325
176 Ga0466966_0043726 3300044684 Bacteria 2870
177 Ga0466961_0011092 3300044693 Bacteria 5761
178 Ga0466961_0046487 3300044693 Bacteria 2776
179 Ga0466961_0182953 3300044693 Bacteria 1301
180 Ga0466961_0296914 3300044693 Bacteria 987
181 Ga0466963_0611205 3300044694 Bacteria 770
182 Ga0466963_0625699 3300044694 Bacteria 760
183 Ga0466971_0123700 3300044719 Bacteria 1198
184 Ga0466971_0316194 3300044719 Bacteria 752
185 Ga0466968_0068730 3300044735 Bacteria 1539
186 Ga0466970_0002665 3300044765 Bacteria 8613
187 Ga0466970_0005251 3300044765 Bacteria 6411
188 Ga0466970_0041037 3300044765 Bacteria 2458
189 Ga0466970_0050504 3300044765 Bacteria 2218
190 Ga0466970_0080893 3300044765 Bacteria 1756
191 Ga0466957_0099647 3300044842 Bacteria 1830
192 Ga0466957_0181461 3300044842 Bacteria 1375
193 Ga0466960_0064561 3300044901 Bacteria 1806
194 Ga0466960_0082604 3300044901 Bacteria 1622
195 Ga0466960_0119547 3300044901 Bacteria 1378
196 Ga0466960_0120271 3300044901 Bacteria 1375
197 Ga0466959_0016731 3300045049 Bacteria 5365
198 Ga0466959_0019865 3300045049 Bacteria 4943
199 Ga0466959_0219281 3300045049 Bacteria 1320
200 Ga0466959_0381481 3300045049 Bacteria 959
201 Ga0466958_0128999 3300045836 Bacteria 1587
202 Ga0466967_0204584 3300045976 Bacteria 1871
203 Ga0495627_084542 3300046453 Bacteria 917
204 Ga0495651_0050777 3300046462 Bacteria 3199
205 Ga0495653_0049620 3300046463 Bacteria 3232
206 Ga0495608_0051682 3300046511 Bacteria 2723
207 Ga0495628_0269542 3300046516 Bacteria 1267
208 Ga0495666_0060039 3300046526 Bacteria 1818
209 Ga0495652_0178736 3300046529 Bacteria 1631
210 Ga0495667_0010730 3300046559 Bacteria 6196
211 Ga0495656_0291394 3300046615 Bacteria 834
212 Ga0495657_0015437 3300046675 Bacteria 5589
213 Ga0495646_0376599 3300046680 Bacteria 741
214 Ga0495613_0429243 3300046689 Bacteria 898
215 Ga0495600_0030529 3300046809 Bacteria 3491
216 Ga0495672_0217924 3300047320 Bacteria 944
217 Ga0495680_0008903 3300047322 Bacteria 9075
218 Ga0495675_0181583 3300047444 Bacteria 1288
219 Ga0495602_0372571 3300048088 Bacteria 1025
220 Ga0496108_0362791 3300048911 Bacteria 1265
221 Ga0496109_0354539 3300048912 Bacteria 1386
222 Ga0496111_0312862 3300048914 Bacteria 1164
223 Ga0496117_0007221 3300048920 Bacteria 10941
224 Ga0496118_0004415 3300048921 Bacteria 16691
225 Ga0496119_0350200 3300048922 Bacteria 715
226 Ga0496121_0009141 3300048924 Bacteria 11462
227 Ga0496121_0051779 3300048924 Bacteria 3455
228 Ga0496121_0314189 3300048924 Bacteria 1058
229 Ga0496126_0000007 3300048929 Bacteria 787364
230 Ga0496126_0100135 3300048929 Bacteria 2537
231 Ga0501031_0007621 3300049568 Bacteria 7048
232 Ga0501031_0077750 3300049568 Bacteria 2161
233 Ga0501031_0585772 3300049568 Bacteria 718
234 Ga0501032_0001829 3300049569 Bacteria 16817
235 Ga0501032_0006025 3300049569 Bacteria 8945
236 Ga0501032_0035444 3300049569 Bacteria 3410
237 Ga0501032_0077727 3300049569 Bacteria 2209
238 Ga0501032_0142009 3300049569 Bacteria 1581
239 Ga0501033_0001996 3300049570 Bacteria 17786
240 Ga0501033_0012580 3300049570 Bacteria 6457
241 Ga0501033_0043336 3300049570 Bacteria 3351
242 Ga0501033_0133592 3300049570 Bacteria 1796
243 Ga0501034_0003699 3300049571 Bacteria 17268
244 Ga0501034_0006099 3300049571 Bacteria 13012
245 Ga0501034_0008111 3300049571 Bacteria 11138
246 Ga0501034_0027371 3300049571 Bacteria 5798
247 Ga0501034_0048453 3300049571 Bacteria 4288
248 Ga0501034_0062470 3300049571 Bacteria 3740
249 Ga0501034_0209753 3300049571 Bacteria 1903
250 Ga0501036_0051300 3300049572 Bacteria 3492
251 Ga0501036_0109700 3300049572 Bacteria 2332
252 Ga0501036_0432138 3300049572 Bacteria 1098
253 Ga0501037_0003461 3300049573 Bacteria 11461
254 Ga0501037_0061308 3300049573 Bacteria 2742
255 Ga0501037_0101295 3300049573 Bacteria 2079
256 Ga0501037_0182287 3300049573 Bacteria 1489
257 Ga0501038_0005772 3300049574 Bacteria 11464
258 Ga0501038_0039941 3300049574 Bacteria 4101
259 Ga0501038_0041378 3300049574 Bacteria 4018
260 Ga0501038_0067867 3300049574 Bacteria 3033
261 Ga0501038_0267671 3300049574 Bacteria 1348
262 Ga0501038_0385543 3300049574 Bacteria 1086
263 Ga0501038_0650647 3300049574 Bacteria 793
264 Ga0501039_0001112 3300049575 Bacteria 19777
265 Ga0501042_0010648 3300049578 Bacteria 6178
266 Ga0501043_0005060 3300049579 Bacteria 10660
267 Ga0501043_0007219 3300049579 Bacteria 8826
268 Ga0501043_0031486 3300049579 Bacteria 4169
269 Ga0501043_0255502 3300049579 Bacteria 1349
270 Ga0501043_0497117 3300049579 Bacteria 911
271 Ga0501046_0000071 3300049580 Bacteria 107260
272 Ga0501046_0012276 3300049580 Bacteria 7300
273 Ga0501046_0015476 3300049580 Bacteria 6405
274 Ga0501046_0134570 3300049580 Bacteria 1873
275 Ga0501046_0251295 3300049580 Bacteria 1301
276 Ga0501047_0001726 3300049581 Bacteria 21217
277 Ga0501047_0076900 3300049581 Bacteria 3212
278 Ga0501047_0161805 3300049581 Bacteria 2110
279 Ga0501047_0244890 3300049581 Bacteria 1642
280 Ga0501047_0393598 3300049581 Bacteria 1219
281 Ga0501047_0633200 3300049581 Bacteria 889
282 Ga0501048_0002389 3300049582 Bacteria 14336
283 Ga0501048_0079412 3300049582 Bacteria 2315
284 Ga0501067_0010031 3300049583 Bacteria 5242
285 Ga0501067_0088528 3300049583 Bacteria 1718
286 Ga0501067_0205108 3300049583 Bacteria 1098
287 Ga0501068_0035876 3300049584 Bacteria 2962
288 Ga0501068_0361914 3300049584 Bacteria 933
289 Ga0501068_0478985 3300049584 Bacteria 806
290 Ga0501069_0000034 3300049585 Bacteria 92080
291 Ga0501069_0015159 3300049585 Bacteria 4129
292 Ga0501069_0046623 3300049585 Bacteria 2404
293 Ga0501069_0114306 3300049585 Bacteria 1539
294 Ga0501070_0000013 3300049586 Bacteria 180554
295 Ga0501070_0017765 3300049586 Bacteria 5972
296 Ga0501070_0045817 3300049586 Bacteria 3637
297 Ga0501070_0049742 3300049586 Bacteria 3480
298 Ga0501070_0052205 3300049586 Bacteria 3393
299 Ga0501070_0055155 3300049586 Bacteria 3294
300 Ga0501070_0074419 3300049586 Bacteria 2811
301 Ga0501071_0009171 3300049587 Bacteria 6576
302 Ga0501071_0066259 3300049587 Bacteria 2624
303 Ga0501071_0257684 3300049587 Bacteria 1317
304 Ga0501072_0000923 3300049588 Bacteria 21589
305 Ga0501072_0018975 3300049588 Bacteria 5309
306 Ga0501072_0038444 3300049588 Bacteria 3755
307 Ga0501073_0003311 3300049589 Bacteria 12110
308 Ga0501073_0012376 3300049589 Bacteria 6226
309 Ga0501073_0020098 3300049589 Bacteria 4816
310 Ga0501073_0024210 3300049589 Bacteria 4359
311 Ga0501074_0016568 3300049590 Bacteria 5350
312 Ga0501074_0093147 3300049590 Bacteria 2157
313 Ga0501074_0101514 3300049590 Bacteria 2059
314 Ga0501074_0150605 3300049590 Bacteria 1663
315 Ga0501074_0159980 3300049590 Bacteria 1608
316 Ga0501074_0314454 3300049590 Bacteria 1112
317 Ga0501074_0410555 3300049590 Bacteria 960
318 Ga0501075_0246536 3300049591 Bacteria 1362
319 Ga0501076_0010089 3300049592 Bacteria 6992
320 Ga0501077_0028344 3300049593 Bacteria 3559
321 Ga0501079_0006806 3300049741 Bacteria 8604
322 Ga0501079_0066534 3300049741 Bacteria 2780
323 Ga0501080_0015178 3300049742 Bacteria 7097
324 Ga0501080_0029263 3300049742 Bacteria 5127
325 Ga0501080_0102612 3300049742 Bacteria 2653
326 Ga0501080_0128086 3300049742 Bacteria 2350
327 Ga0501083_0000481 3300049744 Bacteria 25560
328 Ga0501083_0015575 3300049744 Bacteria 5322
329 Ga0501083_0116462 3300049744 Bacteria 1754
330 Ga0501083_0702412 3300049744 Bacteria 658
331 Ga0501035_0003845 3300049822 Bacteria 14309
332 Ga0501035_0005814 3300049822 Bacteria 11626
333 Ga0501035_0005953 3300049822 Bacteria 11480
334 Ga0501035_0010684 3300049822 Bacteria 8498
335 Ga0501035_0020540 3300049822 Bacteria 6065
336 Ga0501035_0021873 3300049822 Bacteria 5875
337 Ga0501035_0032379 3300049822 Bacteria 4757
338 Ga0501044_0000806 3300049823 Bacteria 37759
339 Ga0501044_0004767 3300049823 Bacteria 15173
340 Ga0501044_0005354 3300049823 Bacteria 14263
341 Ga0501044_0020035 3300049823 Bacteria 7142
342 Ga0501044_0050080 3300049823 Bacteria 4311
343 Ga0501044_0135456 3300049823 Bacteria 2454
344 Ga0501044_0159007 3300049823 Bacteria 2237
345 Ga0501044_0382864 3300049823 Bacteria 1321
346 Ga0501045_0188069 3300049824 Bacteria 1539
347 nmdc:mga03n38_102325_c1 3300050490 Bacteria 1383
348 nmdc:mga03n38_25420_c1 3300050490 Bacteria 2431
349 nmdc:mga00v17_209544_c1 3300050491 Bacteria 1261
350 nmdc:mga00v17_69218_c1 3300050491 Bacteria 2184
351 nmdc:mga00v17_94210_c1 3300050491 Bacteria 1884
352 nmdc:mga0yw44_157551_c1 3300050492 Bacteria 1485
353 nmdc:mga0yw44_71838_c1 3300050492 Bacteria 2150
354 nmdc:mga06z11_152340_c1 3300050494 Bacteria 1315
355 nmdc:mga06z11_85267_c1 3300050494 Bacteria 1704
356 nmdc:mga07m45_101258_c1 3300050496 Bacteria 1654
357 nmdc:mga07m45_6851_c1 3300050496 Bacteria 5793
358 Ga0495595_0009634 3300053084 Bacteria 4002
359 Ga0495619_0142778 3300053085 Bacteria 1649
360 Ga0500556_0197787 3300053104 Bacteria 794
361 Ga0500559_0074843 3300053136 Bacteria 1531
362 Ga0500568_0000502 3300053139 Bacteria 28764
363 Ga0500573_0143389 3300053140 Bacteria 1314
364 Ga0500579_121054 3300053143 Bacteria 1269
365 Ga0500600_0054838 3300053149 Bacteria 2246
366 Ga0500637_0333163 3300053178 Bacteria 815
367 Ga0501084_0001501 3300054114 Bacteria 18521
368 Ga0501084_0022838 3300054114 Bacteria 5219
369 Ga0501084_0280703 3300054114 Bacteria 1406
370 Ga0501082_0004003 3300060353 Bacteria 12862
371 Ga0466962_0011740 3300061719 Bacteria 4218
372 Ga0530510_0136912 3300061734 Bacteria 1803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0702412 Ga0501083_0702412_51_635 169
2 3300005445 Ga0070708_100103215 Ga0070708_1001032152 183
3 3300049572 Ga0501036_0432138 Ga0501036_0432138_514_1077 187
4 iso_pu_bacteria 2751185734 2753071865 193
5 iso_pu_bacteria 2791354901 2791912375 193
6 3300024225 Ga0224572_1053353 Ga0224572_10533531 196
7 3300030731 Ga0316177_1181354 Ga0316177_11813545 197
8 3300030732 Ga0316176_1151539 Ga0316176_11515392 197
9 3300030733 Ga0314311_1006858 Ga0314311_10068582 197
10 3300025931 Ga0207644_10065541 Ga0207644_100655414 198
11 3300032126 Ga0307415_100667837 Ga0307415_1006678371 198
12 iso_pu_bacteria 2508501039 2508674583 198
13 iso_pu_bacteria 2616644941 2616906576 198
14 iso_pu_bacteria 2675902999 2676202874 198
15 iso_pu_bacteria 2687453737 2689958218 198
16 iso_pu_bacteria 2738541305 2738868770 198
17 iso_pu_bacteria 2738543011 2739236214 198
18 iso_pu_bacteria 2751185725 2753036712 198
19 iso_pu_bacteria 2751185782 2753269576 198
20 iso_pu_bacteria 2751185792 2753324582 198
21 iso_pu_bacteria 2773857762 2774393094 198
22 iso_pu_bacteria 2773857921 2774847450 198
23 iso_pu_bacteria 2786546132 2786666917 198
24 iso_pu_bacteria 2795385472 2795793481 198
25 iso_pu_bacteria 2808606439 2809196935 198
26 iso_pu_bacteria 2808606522 2809587016 198
27 iso_pu_bacteria 2811994878 2812350906 198
28 iso_pu_bacteria 2889300758 2889304581 198
29 iso_pu_bacteria 2891968417 2891971501 198
30 iso_pu_bacteria 2899359706 2899362212 198
31 iso_pu_bacteria 2915768154 2915776133 198
32 iso_pu_bacteria 2917736166 2917743669 198
33 iso_pu_bacteria 2939743619 2939745030 198
34 iso_pu_bacteria 2954380949 2954382196 198
35 iso_pu_bacteria 2954673503 2954682002 198
36 iso_pu_bacteria 2954682443 2954690924 198
37 iso_pu_bacteria 8003314358 8003318140 198
38 iso_pu_bacteria 8023623736 8023628741 198
39 iso_pu_bacteria 8025530807 8025533590 198
40 iso_pu_bacteria 8055157932 8055161404 198
41 iso_pu_bacteria 8056054917 8056056034 198
42 iso_pu_bacteria 8056060235 8056066188 198
43 iso_pu_bacteria 8056207758 8056210855 198
44 iso_pu_bacteria 2558860112 2558909708 199
45 iso_pu_bacteria 2816332119 2816425817 199
46 iso_pu_bacteria 2582581313 2585302940 200
47 iso_pu_bacteria 2643221961 2645719675 200
48 iso_pu_bacteria 2643221962 2645726561 200
49 iso_pu_bacteria 2954711539 2954712147 200
50 iso_pu_bacteria 2954721474 2954722092 200
51 iso_pu_bacteria 2954731030 2954739759 200
52 iso_pu_bacteria 2954740390 2954740985 200
53 iso_pu_bacteria 2954749733 2954758582 200
54 iso_pu_bacteria 2954759201 2954759992 200
55 3300044658 Ga0466972_0033284 Ga0466972_0033284_1136_1741 201
56 3300044658 Ga0466972_0073726 Ga0466972_0073726_601_1206 201
57 3300044658 Ga0466972_0100538 Ga0466972_0100538_506_1111 201
58 3300044683 Ga0466965_0126057 Ga0466965_0126057_575_1180 201
59 3300044684 Ga0466966_0043726 Ga0466966_0043726_1335_1940 201
60 3300044693 Ga0466961_0046487 Ga0466961_0046487_595_1200 201
61 3300044735 Ga0466968_0068730 Ga0466968_0068730_298_903 201
62 3300044765 Ga0466970_0002665 Ga0466970_0002665_7305_7910 201
63 3300044765 Ga0466970_0041037 Ga0466970_0041037_1609_2220 201
64 3300044842 Ga0466957_0099647 Ga0466957_0099647_828_1433 201
65 3300044901 Ga0466960_0064561 Ga0466960_0064561_1062_1667 201
66 3300045049 Ga0466959_0019865 Ga0466959_0019865_3691_4296 201
67 3300049569 Ga0501032_0006025 Ga0501032_0006025_1665_2270 201
68 3300049570 Ga0501033_0133592 Ga0501033_0133592_930_1535 201
69 3300049571 Ga0501034_0008111 Ga0501034_0008111_7101_7706 201
70 3300049573 Ga0501037_0003461 Ga0501037_0003461_7210_7815 201
71 3300049574 Ga0501038_0067867 Ga0501038_0067867_2257_2862 201
72 3300049574 Ga0501038_0385543 Ga0501038_0385543_245_850 201
73 3300049578 Ga0501042_0010648 Ga0501042_0010648_19_624 201
74 3300049580 Ga0501046_0251295 Ga0501046_0251295_246_851 201
75 3300049586 Ga0501070_0045817 Ga0501070_0045817_2876_3481 201
76 3300049589 Ga0501073_0020098 Ga0501073_0020098_581_1186 201
77 3300049590 Ga0501074_0016568 Ga0501074_0016568_3569_4174 201
78 3300049742 Ga0501080_0102612 Ga0501080_0102612_963_1568 201
79 3300049822 Ga0501035_0005814 Ga0501035_0005814_3940_4545 201
80 3300049823 Ga0501044_0135456 Ga0501044_0135456_323_928 201
81 3300049823 Ga0501044_0382864 Ga0501044_0382864_383_988 201
82 3300049824 Ga0501045_0188069 Ga0501045_0188069_611_1216 201
83 iso_pu_bacteria 2751185782 2753266603 201
84 iso_pu_bacteria 2758568621 2760622423 201
85 iso_pu_bacteria 2862281513 2862287513 201
86 iso_pu_bacteria 2867428634 2867429664 201
87 3300003322 rootL2_10329516 rootL2_103295161 202
88 3300005327 Ga0070658_10370863 Ga0070658_103708632 202
89 3300005434 Ga0070709_10120774 Ga0070709_101207742 202
90 3300005435 Ga0070714_100006311 Ga0070714_1000063117 202
91 3300005435 Ga0070714_101145408 Ga0070714_1011454081 202
92 3300005436 Ga0070713_100086578 Ga0070713_1000865783 202
93 3300005436 Ga0070713_100709411 Ga0070713_1007094111 202
94 3300005437 Ga0070710_10002048 Ga0070710_1000204813 202
95 3300005439 Ga0070711_100280081 Ga0070711_1002800812 202
96 3300005439 Ga0070711_100381534 Ga0070711_1003815341 202
97 3300005455 Ga0070663_100016273 Ga0070663_1000162732 202
98 3300005458 Ga0070681_10322631 Ga0070681_103226312 202
99 3300005539 Ga0068853_100056923 Ga0068853_1000569232 202
100 3300005563 Ga0068855_101031304 Ga0068855_1010313041 202
101 3300005614 Ga0068856_100442094 Ga0068856_1004420942 202
102 3300005616 Ga0068852_100036339 Ga0068852_1000363392 202
103 3300005616 Ga0068852_100339298 Ga0068852_1003392982 202
104 3300006028 Ga0070717_10128178 Ga0070717_101281782 202
105 3300006038 Ga0075365_10014763 Ga0075365_100147632 202
106 3300006038 Ga0075365_10059959 Ga0075365_100599591 202
107 3300006038 Ga0075365_10240067 Ga0075365_102400672 202
108 3300006048 Ga0075363_100059437 Ga0075363_1000594372 202
109 3300006051 Ga0075364_10059016 Ga0075364_100590162 202
110 3300006178 Ga0075367_10163527 Ga0075367_101635272 202
111 3300006353 Ga0075370_10048716 Ga0075370_100487162 202
112 3300006353 Ga0075370_10050191 Ga0075370_100501912 202
113 3300009093 Ga0105240_10035555 Ga0105240_100355552 202
114 3300009551 Ga0105238_10022761 Ga0105238_100227613 202
115 3300009993 Ga0105028_100117 Ga0105028_10011710 202
116 3300010375 Ga0105239_10278371 Ga0105239_102783712 202
117 3300010375 Ga0105239_10430015 Ga0105239_104300152 202
118 3300013105 Ga0157369_10162277 Ga0157369_101622772 202
119 3300025904 Ga0207647_10010822 Ga0207647_100108225 202
120 3300025906 Ga0207699_10106737 Ga0207699_101067371 202
121 3300025913 Ga0207695_10267502 Ga0207695_102675022 202
122 3300025914 Ga0207671_10223728 Ga0207671_102237282 202
123 3300025919 Ga0207657_10118805 Ga0207657_101188053 202
124 3300025921 Ga0207652_10698239 Ga0207652_106982391 202
125 3300025924 Ga0207694_10000220 Ga0207694_1000022043 202
126 3300025928 Ga0207700_10024024 Ga0207700_100240242 202
127 3300025928 Ga0207700_10362830 Ga0207700_103628302 202
128 3300025929 Ga0207664_10016642 Ga0207664_100166424 202
129 3300025929 Ga0207664_10019644 Ga0207664_100196443 202
130 3300025935 Ga0207709_10002600 Ga0207709_100026007 202
131 3300025949 Ga0207667_10110291 Ga0207667_101102912 202
132 3300025949 Ga0207667_10146772 Ga0207667_101467722 202
133 3300025949 Ga0207667_10703032 Ga0207667_107030322 202
134 3300025981 Ga0207640_10096237 Ga0207640_100962372 202
135 3300026067 Ga0207678_10000793 Ga0207678_1000079330 202
136 3300026067 Ga0207678_10062753 Ga0207678_100627533 202
137 3300026078 Ga0207702_10154841 Ga0207702_101548413 202
138 3300026078 Ga0207702_10736556 Ga0207702_107365561 202
139 3300026116 Ga0207674_10460150 Ga0207674_104601502 202
140 3300026142 Ga0207698_10088585 Ga0207698_100885852 202
141 3300028556 Ga0265337_1000242 Ga0265337_100024218 202
142 3300028558 Ga0265326_10002177 Ga0265326_100021776 202
143 3300028563 Ga0265319_1006108 Ga0265319_10061084 202
144 3300028573 Ga0265334_10000830 Ga0265334_1000083013 202
145 3300028577 Ga0265318_10026691 Ga0265318_100266912 202
146 3300028666 Ga0265336_10008459 Ga0265336_100084592 202
147 3300028794 Ga0307515_10033425 Ga0307515_1003342511 202
148 3300028800 Ga0265338_10001399 Ga0265338_1000139912 202
149 3300028800 Ga0265338_10021168 Ga0265338_100211685 202
150 3300030521 Ga0307511_10038773 Ga0307511_100387732 202
151 3300030732 Ga0316176_1069150 Ga0316176_10691502 202
152 3300030744 Ga0316181_1171432 Ga0316181_11714322 202
153 3300031238 Ga0265332_10001033 Ga0265332_1000103312 202
154 3300031240 Ga0265320_10001145 Ga0265320_100011458 202
155 3300031247 Ga0265340_10003687 Ga0265340_100036876 202
156 3300031247 Ga0265340_10027239 Ga0265340_100272392 202
157 3300031344 Ga0265316_10068393 Ga0265316_100683932 202
158 3300031456 Ga0307513_10022104 Ga0307513_100221044 202
159 3300031507 Ga0307509_10154746 Ga0307509_101547463 202
160 3300031616 Ga0307508_10095933 Ga0307508_100959333 202
161 3300031711 Ga0265314_10007842 Ga0265314_100078427 202
162 3300031712 Ga0265342_10003442 Ga0265342_100034425 202
163 3300031730 Ga0307516_10026282 Ga0307516_100262825 202
164 3300031730 Ga0307516_10064659 Ga0307516_100646593 202
165 3300031903 Ga0307407_10312529 Ga0307407_103125292 202
166 3300033179 Ga0307507_10011980 Ga0307507_100119809 202
167 3300033180 Ga0307510_10076522 Ga0307510_100765222 202
168 3300033180 Ga0307510_10443583 Ga0307510_104435832 202
169 3300035088 Ga0373940_0017581 Ga0373940_0017581_66_674 202
170 3300035114 Ga0373939_0058899 Ga0373939_0058899_265_876 202
171 3300035115 Ga0373941_0004317 Ga0373941_0004317_425_1033 202
172 3300035207 Ga0373942_0000118 Ga0373942_0000118_904_1515 202
173 3300036401 Ga0373937_0138497 Ga0373937_0138497_1193_1807 202
174 3300037312 Ga0395899_0033195 Ga0395899_0033195_2270_2878 202
175 3300037418 Ga0395900_0001084 Ga0395900_0001084_17267_17875 202
176 3300037466 Ga0395898_0000270 Ga0395898_0000270_17116_17724 202
177 3300037466 Ga0395898_0133767 Ga0395898_0133767_1206_1814 202
178 3300037471 Ga0395905_0291441 Ga0395905_0291441_892_1500 202
179 3300038443 Ga0395901_0379202 Ga0395901_0379202_776_1396 202
180 3300041451 Ga0451791_0795522 Ga0451791_0795522_2722_3330 202
181 3300042005 Ga0439448_0027384 Ga0439448_0027384_475_1083 202
182 3300042138 Ga0450903_001626 Ga0450903_001626_625_1233 202
183 3300042157 Ga0439458_0001072 Ga0439458_0001072_4215_4823 202
184 3300044656 Ga0466969_0181925 Ga0466969_0181925_250_858 202
185 3300044658 Ga0466972_0001194 Ga0466972_0001194_9630_10238 202
186 3300044658 Ga0466972_0004812 Ga0466972_0004812_5244_5852 202
187 3300044658 Ga0466972_0082250 Ga0466972_0082250_24_638 202
188 3300044658 Ga0466972_0085350 Ga0466972_0085350_551_1159 202
189 3300044683 Ga0466965_0005479 Ga0466965_0005479_4388_4996 202
190 3300044693 Ga0466961_0011092 Ga0466961_0011092_4410_5018 202
191 3300044693 Ga0466961_0182953 Ga0466961_0182953_295_903 202
192 3300044693 Ga0466961_0296914 Ga0466961_0296914_368_976 202
193 3300044694 Ga0466963_0611205 Ga0466963_0611205_29_637 202
194 3300044719 Ga0466971_0316194 Ga0466971_0316194_23_631 202
195 3300044765 Ga0466970_0005251 Ga0466970_0005251_4421_5035 202
196 3300044765 Ga0466970_0050504 Ga0466970_0050504_141_749 202
197 3300044765 Ga0466970_0080893 Ga0466970_0080893_1109_1717 202
198 3300044901 Ga0466960_0082604 Ga0466960_0082604_308_922 202
199 3300044901 Ga0466960_0119547 Ga0466960_0119547_43_651 202
200 3300044901 Ga0466960_0120271 Ga0466960_0120271_190_798 202
201 3300045049 Ga0466959_0219281 Ga0466959_0219281_100_708 202
202 3300045049 Ga0466959_0381481 Ga0466959_0381481_44_652 202
203 3300045976 Ga0466967_0204584 Ga0466967_0204584_21_629 202
204 3300046453 Ga0495627_084542 Ga0495627_084542_261_869 202
205 3300046462 Ga0495651_0050777 Ga0495651_0050777_1695_2309 202
206 3300046463 Ga0495653_0049620 Ga0495653_0049620_156_770 202
207 3300046511 Ga0495608_0051682 Ga0495608_0051682_400_1014 202
208 3300046516 Ga0495628_0269542 Ga0495628_0269542_563_1177 202
209 3300046526 Ga0495666_0060039 Ga0495666_0060039_143_760 202
210 3300046529 Ga0495652_0178736 Ga0495652_0178736_810_1424 202
211 3300046559 Ga0495667_0010730 Ga0495667_0010730_741_1355 202
212 3300046615 Ga0495656_0291394 Ga0495656_0291394_107_715 202
213 3300046675 Ga0495657_0015437 Ga0495657_0015437_539_1153 202
214 3300046680 Ga0495646_0376599 Ga0495646_0376599_49_657 202
215 3300046809 Ga0495600_0030529 Ga0495600_0030529_1175_1789 202
216 3300047320 Ga0495672_0217924 Ga0495672_0217924_104_718 202
217 3300047322 Ga0495680_0008903 Ga0495680_0008903_1771_2385 202
218 3300047444 Ga0495675_0181583 Ga0495675_0181583_583_1197 202
219 3300048088 Ga0495602_0372571 Ga0495602_0372571_264_878 202
220 3300048924 Ga0496121_0009141 Ga0496121_0009141_8701_9369 202
221 3300048924 Ga0496121_0314189 Ga0496121_0314189_12_620 202
222 3300048929 Ga0496126_0000007 Ga0496126_0000007_691653_692261 202
223 3300048929 Ga0496126_0100135 Ga0496126_0100135_218_826 202
224 3300049568 Ga0501031_0007621 Ga0501031_0007621_5233_5841 202
225 3300049568 Ga0501031_0585772 Ga0501031_0585772_41_649 202
226 3300049569 Ga0501032_0001829 Ga0501032_0001829_10191_10799 202
227 3300049569 Ga0501032_0077727 Ga0501032_0077727_1441_2049 202
228 3300049569 Ga0501032_0142009 Ga0501032_0142009_756_1364 202
229 3300049570 Ga0501033_0001996 Ga0501033_0001996_4090_4698 202
230 3300049570 Ga0501033_0012580 Ga0501033_0012580_5290_5919 202
231 3300049571 Ga0501034_0003699 Ga0501034_0003699_12913_13521 202
232 3300049571 Ga0501034_0006099 Ga0501034_0006099_9100_9729 202
233 3300049571 Ga0501034_0027371 Ga0501034_0027371_1038_1646 202
234 3300049571 Ga0501034_0048453 Ga0501034_0048453_1192_1833 202
235 3300049571 Ga0501034_0062470 Ga0501034_0062470_2986_3594 202
236 3300049572 Ga0501036_0051300 Ga0501036_0051300_291_899 202
237 3300049572 Ga0501036_0109700 Ga0501036_0109700_14_622 202
238 3300049573 Ga0501037_0061308 Ga0501037_0061308_1844_2452 202
239 3300049573 Ga0501037_0101295 Ga0501037_0101295_10_618 202
240 3300049574 Ga0501038_0005772 Ga0501038_0005772_5233_5841 202
241 3300049574 Ga0501038_0039941 Ga0501038_0039941_3467_4075 202
242 3300049574 Ga0501038_0267671 Ga0501038_0267671_666_1295 202
243 3300049574 Ga0501038_0650647 Ga0501038_0650647_169_777 202
244 3300049579 Ga0501043_0005060 Ga0501043_0005060_4482_5090 202
245 3300049579 Ga0501043_0007219 Ga0501043_0007219_5285_5893 202
246 3300049579 Ga0501043_0255502 Ga0501043_0255502_560_1168 202
247 3300049579 Ga0501043_0497117 Ga0501043_0497117_142_750 202
248 3300049580 Ga0501046_0000071 Ga0501046_0000071_23732_24340 202
249 3300049580 Ga0501046_0015476 Ga0501046_0015476_1354_1962 202
250 3300049580 Ga0501046_0134570 Ga0501046_0134570_738_1346 202
251 3300049581 Ga0501047_0001726 Ga0501047_0001726_10772_11380 202
252 3300049581 Ga0501047_0076900 Ga0501047_0076900_2268_2897 202
253 3300049581 Ga0501047_0161805 Ga0501047_0161805_1017_1625 202
254 3300049581 Ga0501047_0244890 Ga0501047_0244890_617_1225 202
255 3300049581 Ga0501047_0393598 Ga0501047_0393598_25_633 202
256 3300049582 Ga0501048_0002389 Ga0501048_0002389_2045_2653 202
257 3300049583 Ga0501067_0010031 Ga0501067_0010031_848_1456 202
258 3300049584 Ga0501068_0035876 Ga0501068_0035876_729_1337 202
259 3300049585 Ga0501069_0000034 Ga0501069_0000034_10239_10847 202
260 3300049585 Ga0501069_0015159 Ga0501069_0015159_2722_3330 202
261 3300049586 Ga0501070_0000013 Ga0501070_0000013_160128_160736 202
262 3300049586 Ga0501070_0049742 Ga0501070_0049742_1721_2329 202
263 3300049586 Ga0501070_0055155 Ga0501070_0055155_2351_2959 202
264 3300049586 Ga0501070_0074419 Ga0501070_0074419_1299_1907 202
265 3300049587 Ga0501071_0009171 Ga0501071_0009171_1053_1661 202
266 3300049587 Ga0501071_0066259 Ga0501071_0066259_1527_2135 202
267 3300049588 Ga0501072_0000923 Ga0501072_0000923_12195_12803 202
268 3300049588 Ga0501072_0038444 Ga0501072_0038444_1173_1781 202
269 3300049589 Ga0501073_0012376 Ga0501073_0012376_5198_5806 202
270 3300049589 Ga0501073_0024210 Ga0501073_0024210_792_1400 202
271 3300049590 Ga0501074_0093147 Ga0501074_0093147_765_1373 202
272 3300049590 Ga0501074_0101514 Ga0501074_0101514_473_1081 202
273 3300049590 Ga0501074_0314454 Ga0501074_0314454_307_915 202
274 3300049590 Ga0501074_0410555 Ga0501074_0410555_20_628 202
275 3300049591 Ga0501075_0246536 Ga0501075_0246536_742_1350 202
276 3300049592 Ga0501076_0010089 Ga0501076_0010089_1908_2516 202
277 3300049593 Ga0501077_0028344 Ga0501077_0028344_2240_2848 202
278 3300049741 Ga0501079_0006806 Ga0501079_0006806_3987_4595 202
279 3300049741 Ga0501079_0066534 Ga0501079_0066534_329_937 202
280 3300049742 Ga0501080_0015178 Ga0501080_0015178_5470_6099 202
281 3300049742 Ga0501080_0029263 Ga0501080_0029263_2129_2737 202
282 3300049742 Ga0501080_0128086 Ga0501080_0128086_527_1135 202
283 3300049744 Ga0501083_0000481 Ga0501083_0000481_120_728 202
284 3300049744 Ga0501083_0015575 Ga0501083_0015575_2897_3505 202
285 3300049822 Ga0501035_0003845 Ga0501035_0003845_8177_8785 202
286 3300049822 Ga0501035_0005953 Ga0501035_0005953_9012_9641 202
287 3300049822 Ga0501035_0010684 Ga0501035_0010684_4551_5159 202
288 3300049822 Ga0501035_0032379 Ga0501035_0032379_986_1594 202
289 3300049823 Ga0501044_0000806 Ga0501044_0000806_20020_20628 202
290 3300049823 Ga0501044_0004767 Ga0501044_0004767_5364_5993 202
291 3300049823 Ga0501044_0005354 Ga0501044_0005354_9586_10194 202
292 3300049823 Ga0501044_0020035 Ga0501044_0020035_3865_4473 202
293 3300049823 Ga0501044_0159007 Ga0501044_0159007_1570_2178 202
294 3300050490 nmdc:mga03n38_102325_c1 nmdc:mga03n38_102325_c1_284_937 202
295 3300050490 nmdc:mga03n38_25420_c1 nmdc:mga03n38_25420_c1_829_1437 202
296 3300050491 nmdc:mga00v17_209544_c1 nmdc:mga00v17_209544_c1_499_1107 202
297 3300050491 nmdc:mga00v17_94210_c1 nmdc:mga00v17_94210_c1_1016_1657 202
298 3300050492 nmdc:mga0yw44_71838_c1 nmdc:mga0yw44_71838_c1_877_1518 202
299 3300050494 nmdc:mga06z11_85267_c1 nmdc:mga06z11_85267_c1_494_1135 202
300 3300050496 nmdc:mga07m45_101258_c1 nmdc:mga07m45_101258_c1_750_1391 202
301 3300050496 nmdc:mga07m45_6851_c1 nmdc:mga07m45_6851_c1_709_1317 202
302 3300053084 Ga0495595_0009634 Ga0495595_0009634_3200_3814 202
303 3300053085 Ga0495619_0142778 Ga0495619_0142778_767_1381 202
304 3300053136 Ga0500559_0074843 Ga0500559_0074843_517_1143 202
305 3300053140 Ga0500573_0143389 Ga0500573_0143389_123_731 202
306 3300053143 Ga0500579_121054 Ga0500579_121054_376_984 202
307 3300053149 Ga0500600_0054838 Ga0500600_0054838_1304_1912 202
308 3300053178 Ga0500637_0333163 Ga0500637_0333163_65_673 202
309 3300054114 Ga0501084_0001501 Ga0501084_0001501_6967_7575 202
310 3300054114 Ga0501084_0022838 Ga0501084_0022838_1231_1839 202
311 3300060353 Ga0501082_0004003 Ga0501082_0004003_296_904 202
312 3300061734 Ga0530510_0136912 Ga0530510_0136912_477_1085 202
313 iso_pu_bacteria 2643221619 2644110669 202
314 3300041451 Ga0451791_0889016 Ga0451791_0889016_141_752 203
315 3300044694 Ga0466963_0625699 Ga0466963_0625699_121_732 203
316 3300005367 Ga0070667_100159620 Ga0070667_1001596202 204
317 3300005843 Ga0068860_100000669 Ga0068860_10000066923 204
318 3300005985 Ga0081539_10135596 Ga0081539_101355962 204
319 3300006038 Ga0075365_10020990 Ga0075365_100209903 204
320 3300006051 Ga0075364_10148642 Ga0075364_101486422 204
321 3300024225 Ga0224572_1007101 Ga0224572_10071012 204
322 3300025944 Ga0207661_10462854 Ga0207661_104628542 204
323 3300025986 Ga0207658_10007168 Ga0207658_100071682 204
324 3300028379 Ga0268266_10456793 Ga0268266_104567932 204
325 3300028381 Ga0268264_10000510 Ga0268264_1000051031 204
326 3300031901 Ga0307406_10088516 Ga0307406_100885162 204
327 3300044656 Ga0466969_0011531 Ga0466969_0011531_162_806 204
328 3300044719 Ga0466971_0123700 Ga0466971_0123700_412_1056 204
329 3300044842 Ga0466957_0181461 Ga0466957_0181461_661_1305 204
330 3300045049 Ga0466959_0016731 Ga0466959_0016731_2310_2954 204
331 3300045836 Ga0466958_0128999 Ga0466958_0128999_446_1090 204
332 3300049568 Ga0501031_0077750 Ga0501031_0077750_743_1375 204
333 3300049569 Ga0501032_0035444 Ga0501032_0035444_851_1483 204
334 3300049570 Ga0501033_0043336 Ga0501033_0043336_569_1201 204
335 3300049571 Ga0501034_0209753 Ga0501034_0209753_1060_1692 204
336 3300049573 Ga0501037_0182287 Ga0501037_0182287_832_1464 204
337 3300049574 Ga0501038_0041378 Ga0501038_0041378_2928_3560 204
338 3300049579 Ga0501043_0031486 Ga0501043_0031486_2969_3601 204
339 3300049580 Ga0501046_0012276 Ga0501046_0012276_1285_1917 204
340 3300049581 Ga0501047_0633200 Ga0501047_0633200_21_653 204
341 3300049582 Ga0501048_0079412 Ga0501048_0079412_754_1386 204
342 3300049583 Ga0501067_0088528 Ga0501067_0088528_45_677 204
343 3300049584 Ga0501068_0478985 Ga0501068_0478985_27_659 204
344 3300049585 Ga0501069_0046623 Ga0501069_0046623_1511_2143 204
345 3300049586 Ga0501070_0052205 Ga0501070_0052205_2151_2783 204
346 3300049587 Ga0501071_0257684 Ga0501071_0257684_459_1091 204
347 3300049589 Ga0501073_0003311 Ga0501073_0003311_3992_4624 204
348 3300049590 Ga0501074_0159980 Ga0501074_0159980_742_1374 204
349 3300049744 Ga0501083_0116462 Ga0501083_0116462_160_792 204
350 3300049822 Ga0501035_0021873 Ga0501035_0021873_26_658 204
351 3300050492 nmdc:mga0yw44_157551_c1 nmdc:mga0yw44_157551_c1_64_693 204
352 3300050494 nmdc:mga06z11_152340_c1 nmdc:mga06z11_152340_c1_76_705 204
353 3300053104 Ga0500556_0197787 Ga0500556_0197787_64_678 204
354 3300054114 Ga0501084_0280703 Ga0501084_0280703_568_1200 204
355 3300061719 Ga0466962_0011740 Ga0466962_0011740_2254_2898 204
356 3300003322 rootL2_10026938 rootL2_100269381 205
357 3300005331 Ga0070670_100778254 Ga0070670_1007782542 205
358 3300005338 Ga0068868_100600501 Ga0068868_1006005012 205
359 3300005367 Ga0070667_100066699 Ga0070667_1000666993 205
360 3300005441 Ga0070700_100497311 Ga0070700_1004973111 205
361 3300005455 Ga0070663_100151772 Ga0070663_1001517722 205
362 3300005535 Ga0070684_100125761 Ga0070684_1001257612 205
363 3300005614 Ga0068856_100014553 Ga0068856_1000145533 205
364 3300005841 Ga0068863_100626202 Ga0068863_1006262022 205
365 3300005842 Ga0068858_100053628 Ga0068858_1000536283 205
366 3300005843 Ga0068860_100018186 Ga0068860_1000181866 205
367 3300006038 Ga0075365_10053917 Ga0075365_100539173 205
368 3300006038 Ga0075365_10142071 Ga0075365_101420712 205
369 3300006051 Ga0075364_10004072 Ga0075364_100040722 205
370 3300009148 Ga0105243_10036313 Ga0105243_100363134 205
371 3300013306 Ga0163162_10366598 Ga0163162_103665982 205
372 3300013308 Ga0157375_10164176 Ga0157375_101641762 205
373 3300014325 Ga0163163_10052820 Ga0163163_100528202 205
374 3300014326 Ga0157380_10871931 Ga0157380_108719311 205
375 3300014968 Ga0157379_10000516 Ga0157379_1000051629 205
376 3300014968 Ga0157379_10297843 Ga0157379_102978432 205
377 3300017792 Ga0163161_10040307 Ga0163161_100403074 205
378 3300025900 Ga0207710_10221867 Ga0207710_102218672 205
379 3300025905 Ga0207685_10025760 Ga0207685_100257601 205
380 3300025941 Ga0207711_10000170 Ga0207711_1000017018 205
381 3300025960 Ga0207651_10429257 Ga0207651_104292572 205
382 3300025986 Ga0207658_10067156 Ga0207658_100671563 205
383 3300026035 Ga0207703_10020490 Ga0207703_100204905 205
384 3300026078 Ga0207702_10025866 Ga0207702_100258663 205
385 3300026088 Ga0207641_10279786 Ga0207641_102797862 205
386 3300026089 Ga0207648_10539700 Ga0207648_105397002 205
387 3300026118 Ga0207675_100433853 Ga0207675_1004338531 205
388 3300028381 Ga0268264_10112569 Ga0268264_101125693 205
389 3300030732 Ga0316176_1169012 Ga0316176_11690123 205
390 3300031456 Ga0307513_10000003 Ga0307513_10000003366 205
391 3300031616 Ga0307508_10000982 Ga0307508_1000098225 205
392 3300031731 Ga0307405_10281358 Ga0307405_102813581 205
393 3300031852 Ga0307410_10186631 Ga0307410_101866312 205
394 3300031911 Ga0307412_10307839 Ga0307412_103078392 205
395 3300031995 Ga0307409_100114874 Ga0307409_1001148742 205
396 3300032002 Ga0307416_100657988 Ga0307416_1006579882 205
397 3300035241 Ga0373961_0049723 Ga0373961_0049723_557_1198 205
398 3300035691 Ga0373931_0017791 Ga0373931_0017791_2619_3260 205
399 3300037418 Ga0395900_0029358 Ga0395900_0029358_2970_3662 205
400 3300037466 Ga0395898_0001182 Ga0395898_0001182_38603_39295 205
401 3300037466 Ga0395898_0222150 Ga0395898_0222150_372_1016 205
402 3300038443 Ga0395901_0758502 Ga0395901_0758502_27_677 205
403 3300041512 Ga0451853_1533244 Ga0451853_1533244_235_873 205
404 3300046689 Ga0495613_0429243 Ga0495613_0429243_131_763 205
405 3300048911 Ga0496108_0362791 Ga0496108_0362791_42_689 205
406 3300048912 Ga0496109_0354539 Ga0496109_0354539_177_824 205
407 3300048914 Ga0496111_0312862 Ga0496111_0312862_185_832 205
408 3300048920 Ga0496117_0007221 Ga0496117_0007221_7574_8224 205
409 3300048921 Ga0496118_0004415 Ga0496118_0004415_12064_12714 205
410 3300048922 Ga0496119_0350200 Ga0496119_0350200_45_689 205
411 3300048924 Ga0496121_0051779 Ga0496121_0051779_894_1523 205
412 3300049575 Ga0501039_0001112 Ga0501039_0001112_8437_9129 205
413 3300049583 Ga0501067_0205108 Ga0501067_0205108_287_937 205
414 3300049584 Ga0501068_0361914 Ga0501068_0361914_211_861 205
415 3300049585 Ga0501069_0114306 Ga0501069_0114306_754_1404 205
416 3300049586 Ga0501070_0017765 Ga0501070_0017765_3451_4101 205
417 3300049588 Ga0501072_0018975 Ga0501072_0018975_430_1080 205
418 3300049590 Ga0501074_0150605 Ga0501074_0150605_463_1155 205
419 3300049822 Ga0501035_0020540 Ga0501035_0020540_1540_2196 205
420 3300049823 Ga0501044_0050080 Ga0501044_0050080_1119_1775 205
421 3300050491 nmdc:mga00v17_69218_c1 nmdc:mga00v17_69218_c1_49_675 205
422 3300053139 Ga0500568_0000502 Ga0500568_0000502_5992_6645 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01427

Peptidase_M15

D-ala-D-ala dipeptidase

1

204

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r44-assembly4.cif.gz_D crystal structure of vanx 0.9108 1 202
1r44-assembly4.cif.gz_D crystal structure of vanx 0.9066 1 202
4jid-assembly2.cif.gz_B crystal structure of baldcb / vany-like l,d-carboxypeptidase zinc(ii)-free 0.6444 2 190
4mph-assembly1.cif.gz_B crystal structure of baldcb / vany-like l,d-carboxypeptidase zinc(ii)-bound 0.6362 2 190
4ox3-assembly1.cif.gz_A structure of the ldcb ld-carboxypeptidase reveals the molecular basis of peptidoglycan recognition 0.633 2 191
ID Description Score Start End Superfamily
af_P9WLZ7_555_651_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9423 157 174 3.30.750.24
1r44D00 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.9108 1 202 3.30.1380.10
1r44D00 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.9066 1 202 3.30.1380.10
af_P77790_4_176_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.8621 2 190 3.30.1380.10
af_C7G020_710_890_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.8444 1 201 3.30.1380.10
ID Description Score Start End GO Terms
AF-A0A401M6G9-F1-model_v4 Vancomycin B-type resistance protein vanX 0.9598 110 202 GO:0006508
GO:0008237
GO:0016805
GO:0071555
AF-A0A401M6G9-F1-model_v4 Vancomycin B-type resistance protein vanX 0.9499 110 202 GO:0006508
GO:0008237
GO:0016805
GO:0071555
AF-O85362-F1-model_v4 Dipeptidase 0.9438 123 202 GO:0006508
GO:0008237
GO:0016805
GO:0071555
AF-A0A348ZH59-F1-model_v4 Peptidase M15 0.9331 104 202 GO:0006508
GO:0008237
GO:0016805
GO:0071555
AF-O85362-F1-model_v4 Dipeptidase 0.9327 123 202 GO:0006508
GO:0008237
GO:0016805
GO:0071555

Feature Viewer

pLDDT pTM Quality
86.53 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map