F440309

General Info

Members Datasets Scaffolds Average Seq Length
422 273 363 311

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100050184|Ga0307408_1000501842
Length 329
Sequence MTSTTSGTPAVQGHPAATSGKPVILVTGADLAPQAVEILNGFEIVYAGKTPNEEGLVSLCQSTQPVGIIVRYGKISARIMDASARLRVISKHGVGIDTIDTAAAAERGIAVKAAVGANADAVAEHTWALILACAKGIPQLNDRMHDGHWDKATHKSLELKGRTLGLIGLGAIGRRAAQVGVAMGMRVIAFDPFASEVPGGVEVTSLDTVIEGAHILSLHCPLTPENRRMINADTIGRMRDGAILVNTARGGLVDEAALLAAIASGKLRSAGLDSFETEPLADEHAFRDVAGVVLTPHIGGVTSDAYVSMGTAAARNVLAALEDSEPQSH

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
3 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
6 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
7 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
8 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
9 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
10 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
11 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
12 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
13 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
14 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
15 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
16 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
17 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
18 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
19 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
20 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
21 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
22 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
23 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
24 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
25 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
26 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
27 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
28 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
29 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
30 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
31 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
32 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
33 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
34 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
35 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
36 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
37 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
38 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
39 2636415599 Klebsiella variicola DX120E Isolate Unclassified
40 2643221569 Achromobacter sp. Root565 Isolate Unclassified
41 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
42 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
43 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
44 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
45 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
46 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
47 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
48 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
49 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
50 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
51 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
52 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
53 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
54 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
55 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
56 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
57 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
58 2941479691
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
61 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
62 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
63 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
64 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
65 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
273 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.02
Metatranscriptomes 0
Isolates 13.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.69
Nodule 0.24
Rhizoplane 11.37
Rhizosphere 73.22
Stem 0
Stem Tuber 0
Unclassified 9.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000552 3300001989 Bacteria 13402
2 JGI25155J39150_1000430 3300002704 Bacteria 11248
3 JGI25154J39366_1000223 3300002738 Bacteria 38684
4 JGI25157J39369_1005384 3300002741 Bacteria 2099
5 Ga0055539_1000089 3300003752 Bacteria 112508
6 Ga0055533_1000098 3300003756 Bacteria 112508
7 Ga0055525_1000130 3300003759 Bacteria 112508
8 Ga0055526_1003897 3300003771 Bacteria 9241
9 Ga0055540_1003277 3300003792 Bacteria 7918
10 Ga0055531_10008522 3300003794 Bacteria 5383
11 Ga0055541_1000061 3300003841 Bacteria 112508
12 Ga0058692_1010221 3300003856 Bacteria 2328
13 Ga0070658_10037644 3300005327 Bacteria 3900
14 Ga0070658_10377014 3300005327 Bacteria 1217
15 Ga0070670_100032117 3300005331 Bacteria 4521
16 Ga0070677_10003805 3300005333 Bacteria 4889
17 Ga0068869_100110702 3300005334 Bacteria 2089
18 Ga0070660_100131184 3300005339 Bacteria 2005
19 Ga0070660_100397054 3300005339 Bacteria 1140
20 Ga0070689_100028244 3300005340 Bacteria 4238
21 Ga0070668_100070645 3300005347 Bacteria 2718
22 Ga0070671_100033682 3300005355 Bacteria 4239
23 Ga0070673_100001521 3300005364 Bacteria 13655
24 Ga0070659_100015829 3300005366 Bacteria 5654
25 Ga0070659_100048917 3300005366 Bacteria 3323
26 Ga0070659_100093463 3300005366 Bacteria 2413
27 Ga0070663_100153466 3300005455 Bacteria 1768
28 Ga0070678_100049450 3300005456 Bacteria 3034
29 Ga0070662_100108954 3300005457 Bacteria 2107
30 Ga0068867_100041116 3300005459 Bacteria 3378
31 Ga0070699_100205726 3300005518 Bacteria 1751
32 Ga0070672_100000155 3300005543 Bacteria 37829
33 Ga0070672_100072694 3300005543 Bacteria 2739
34 Ga0070686_100049187 3300005544 Bacteria 2674
35 Ga0068855_100080949 3300005563 Bacteria 3765
36 Ga0070664_100109961 3300005564 Bacteria 2404
37 Ga0068854_100002758 3300005578 Bacteria 10913
38 Ga0068852_100053456 3300005616 Bacteria 3476
39 Ga0068866_10297979 3300005718 Bacteria 1006
40 Ga0068851_10017355 3300005834 Bacteria 3456
41 Ga0068863_100050810 3300005841 Bacteria 3929
42 Ga0068858_100145125 3300005842 Bacteria 2228
43 Ga0068860_100232752 3300005843 Bacteria 1791
44 Ga0075365_10016589 3300006038 Bacteria 4484
45 Ga0097621_100013983 3300006237 Bacteria 5995
46 Ga0068871_100003268 3300006358 Bacteria 11117
47 Ga0068865_100224545 3300006881 Bacteria 1470
48 Ga0105240_10251433 3300009093 Bacteria 2044
49 Ga0105243_10009485 3300009148 Bacteria 7409
50 Ga0105241_10037840 3300009174 Bacteria 3636
51 Ga0105242_10000960 3300009176 Bacteria 22493
52 Ga0105242_10006647 3300009176 Bacteria 8920
53 Ga0105242_10280991 3300009176 Bacteria 1512
54 Ga0105237_10018113 3300009545 Bacteria 7291
55 Ga0105237_10069972 3300009545 Bacteria 3504
56 Ga0105238_10000031 3300009551 Bacteria 179497
57 Ga0105238_10387957 3300009551 Bacteria 1389
58 Ga0105239_10000539 3300010375 Bacteria 54773
59 Ga0105239_10216595 3300010375 Bacteria 2147
60 Ga0105246_10106319 3300011119 Bacteria 2053
61 Ga0157375_10160317 3300013308 Bacteria 2391
62 Ga0157377_10109756 3300014745 Bacteria 1656
63 Ga0157377_10153321 3300014745 Bacteria 1426
64 Ga0157376_10005505 3300014969 Bacteria 8855
65 Ga0182006_1000715 3300015261 Bacteria 22949
66 Ga0182007_10023908 3300015262 Bacteria 2144
67 Ga0163161_10013559 3300017792 Bacteria 5674
68 Ga0213872_10002910 3300021361 Bacteria 9735
69 Ga0213872_10012337 3300021361 Bacteria 4021
70 Ga0209435_100293 3300025206 Bacteria 12076
71 Ga0209784_100018 3300025224 Bacteria 456816
72 Ga0209566_100016 3300025225 Bacteria 456824
73 Ga0209674_100030 3300025226 Bacteria 456824
74 Ga0209563_100034 3300025230 Bacteria 456824
75 Ga0209646_1000021 3300025246 Bacteria 461083
76 Ga0209026_1002477 3300025250 Bacteria 6880
77 Ga0209677_100019 3300025253 Bacteria 456824
78 Ga0209759_1000100 3300025256 Bacteria 156294
79 Ga0209565_1013390 3300025263 Bacteria 1921
80 Ga0209673_1001087 3300025273 Bacteria 30591
81 Ga0209673_1014421 3300025273 Bacteria 3058
82 Ga0209025_1001076 3300025294 Bacteria 39574
83 Ga0209025_1033387 3300025294 Bacteria 2379
84 Ga0209564_1001300 3300025295 Bacteria 26937
85 Ga0209051_1004117 3300025303 Bacteria 9114
86 Ga0209257_1000022 3300025304 Bacteria 765258
87 Ga0207656_10089142 3300025321 Bacteria 1398
88 Ga0207682_10018988 3300025893 Bacteria 2690
89 Ga0207682_10026333 3300025893 Bacteria 2311
90 Ga0207645_10007383 3300025907 Bacteria 7775
91 Ga0207705_10009817 3300025909 Bacteria 6968
92 Ga0207705_10248415 3300025909 Bacteria 1356
93 Ga0207654_10001334 3300025911 Bacteria 13114
94 Ga0207695_10004706 3300025913 Bacteria 18482
95 Ga0207695_10234085 3300025913 Bacteria 1740
96 Ga0207671_10128998 3300025914 Bacteria 1939
97 Ga0207657_10034438 3300025919 Bacteria 4553
98 Ga0207657_10058155 3300025919 Bacteria 3328
99 Ga0207657_10403449 3300025919 Bacteria 1075
100 Ga0207649_10332472 3300025920 Bacteria 1119
101 Ga0207694_10000062 3300025924 Bacteria 140156
102 Ga0207659_10092154 3300025926 Bacteria 2265
103 Ga0207659_10191218 3300025926 Bacteria 1629
104 Ga0207644_10000418 3300025931 Bacteria 27576
105 Ga0207690_10005628 3300025932 Bacteria 7406
106 Ga0207686_10004348 3300025934 Bacteria 7592
107 Ga0207686_10129105 3300025934 Bacteria 1731
108 Ga0207691_10000319 3300025940 Bacteria 47784
109 Ga0207691_10068084 3300025940 Bacteria 3217
110 Ga0207661_10003878 3300025944 Bacteria 10426
111 Ga0207679_10003128 3300025945 Bacteria 10231
112 Ga0207679_10272877 3300025945 Bacteria 1447
113 Ga0207667_10000044 3300025949 Bacteria 248251
114 Ga0207667_10003171 3300025949 Bacteria 20339
115 Ga0207667_10117147 3300025949 Bacteria 2745
116 Ga0207668_10106091 3300025972 Bacteria 2098
117 Ga0207640_10019241 3300025981 Bacteria 4030
118 Ga0207678_10074169 3300026067 Bacteria 2915
119 Ga0207708_10005812 3300026075 Bacteria 9124
120 Ga0207675_100029755 3300026118 Bacteria 5086
121 Ga0207675_100266061 3300026118 Bacteria 1663
122 Ga0207683_10015987 3300026121 Bacteria 6386
123 Ga0207683_10017319 3300026121 Bacteria 6140
124 Ga0207698_10160638 3300026142 Bacteria 1964
125 Ga0209371_1000224 3300027312 Bacteria 74156
126 Ga0268266_10285479 3300028379 Bacteria 1536
127 Ga0268256_1000427 3300030500 Bacteria 37795
128 Ga0268256_1000907 3300030500 Bacteria 20451
129 Ga0265327_10001420 3300031251 Bacteria 30486
130 Ga0307408_100050184 3300031548 Bacteria 3000
131 Ga0307408_100074965 3300031548 Bacteria 2512
132 Ga0307405_10255523 3300031731 Bacteria 1306
133 Ga0307413_10079986 3300031824 Bacteria 2091
134 Ga0307410_10047859 3300031852 Bacteria 2860
135 Ga0307412_10085957 3300031911 Bacteria 2187
136 Ga0307409_100023757 3300031995 Bacteria 4257
137 Ga0307414_10105008 3300032004 Bacteria 2135
138 Ga0307411_10019007 3300032005 Bacteria 3958
139 Ga0307415_100084279 3300032126 Bacteria 2280
140 Ga0395899_0011132 3300037312 Bacteria 6889
141 Ga0395899_0017421 3300037312 Bacteria 5472
142 Ga0395899_0022435 3300037312 Bacteria 4787
143 Ga0395899_0039309 3300037312 Bacteria 3541
144 Ga0395900_0009735 3300037418 Bacteria 9842
145 Ga0395900_0013163 3300037418 Bacteria 8454
146 Ga0395900_0359956 3300037418 Bacteria 1426
147 Ga0395900_0575505 3300037418 Bacteria 1068
148 Ga0395898_0013241 3300037466 Bacteria 8498
149 Ga0395898_0028615 3300037466 Bacteria 5583
150 Ga0395898_0243160 3300037466 Bacteria 1716
151 Ga0395905_0000761 3300037471 Bacteria 42458
152 Ga0395905_0036069 3300037471 Bacteria 4644
153 Ga0395905_0041083 3300037471 Bacteria 4339
154 Ga0395905_0087952 3300037471 Bacteria 2913
155 Ga0395905_0138602 3300037471 Bacteria 2289
156 Ga0395905_0260381 3300037471 Bacteria 1619
157 Ga0395901_0016680 3300038443 Bacteria 7483
158 Ga0395901_0034146 3300038443 Bacteria 5252
159 Ga0395901_0085508 3300038443 Bacteria 3297
160 Ga0395901_0175699 3300038443 Bacteria 2246
161 Ga0395901_0315475 3300038443 Bacteria 1618
162 Ga0436361_0073109 3300039447 Bacteria 5166
163 Ga0436361_0335889 3300039447 Bacteria 24833
164 Ga0436361_0545860 3300039447 Bacteria 8977
165 Ga0439448_0004092 3300042005 Bacteria 4103
166 Ga0439458_0008821 3300042157 Bacteria 2249
167 Ga0439464_0000033 3300042439 Bacteria 17131
168 Ga0466969_0049913 3300044656 Bacteria 2063
169 Ga0466966_0025381 3300044684 Bacteria 3871
170 Ga0466966_0074541 3300044684 Bacteria 2121
171 Ga0466961_0087497 3300044693 Bacteria 1969
172 Ga0466961_0144586 3300044693 Bacteria 1487
173 Ga0466964_0025799 3300044706 Bacteria 2297
174 Ga0466957_0005362 3300044842 Bacteria 7198
175 Ga0466957_0127097 3300044842 Bacteria 1629
176 Ga0466959_0132175 3300045049 Bacteria 1768
177 Ga0466958_0066746 3300045836 Bacteria 2197
178 Ga0495603_0127161 3300046455 Bacteria 1485
179 Ga0495590_0000975 3300046457 Bacteria 12612
180 Ga0495590_0008127 3300046457 Bacteria 4020
181 Ga0495653_0005257 3300046463 Bacteria 10530
182 Ga0495653_0012537 3300046463 Bacteria 6922
183 Ga0495653_0040274 3300046463 Bacteria 3652
184 Ga0495650_0000103 3300046471 Bacteria 210023
185 Ga0495650_0003567 3300046471 Bacteria 11255
186 Ga0495650_0024842 3300046471 Bacteria 2823
187 Ga0495580_0044541 3300046472 Bacteria 3155
188 Ga0495582_0003527 3300046473 Bacteria 8813
189 Ga0495582_0017828 3300046473 Bacteria 3881
190 Ga0495605_0000166 3300046474 Bacteria 83477
191 Ga0495605_0005322 3300046474 Bacteria 7502
192 Ga0495605_0015552 3300046474 Bacteria 4135
193 Ga0495605_0021909 3300046474 Bacteria 3379
194 Ga0495605_0056173 3300046474 Bacteria 1899
195 Ga0495639_0011412 3300046475 Bacteria 3832
196 Ga0495584_0000699 3300046491 Bacteria 22182
197 Ga0495584_0001070 3300046491 Bacteria 16994
198 Ga0495584_0009484 3300046491 Bacteria 5011
199 Ga0495584_0014351 3300046491 Bacteria 4036
200 Ga0495584_0067993 3300046491 Bacteria 1790
201 Ga0495585_0001038 3300046492 Bacteria 23043
202 Ga0495585_0022880 3300046492 Bacteria 3587
203 Ga0495585_0107552 3300046492 Bacteria 1486
204 Ga0495594_0005904 3300046499 Bacteria 6289
205 Ga0495594_0008986 3300046499 Bacteria 5153
206 Ga0495594_0020075 3300046499 Bacteria 3557
207 Ga0495594_0070322 3300046499 Bacteria 1945
208 Ga0495596_0000180 3300046500 Bacteria 44100
209 Ga0495596_0030352 3300046500 Bacteria 2164
210 Ga0495607_0001529 3300046501 Bacteria 20340
211 Ga0495607_0002231 3300046501 Bacteria 16013
212 Ga0495583_0000075 3300046506 Bacteria 177074
213 Ga0495583_0007098 3300046506 Bacteria 7157
214 Ga0495606_0011717 3300046507 Bacteria 7116
215 Ga0495616_0015183 3300046513 Bacteria 4286
216 Ga0495616_0026484 3300046513 Bacteria 3085
217 Ga0495616_0042882 3300046513 Bacteria 2300
218 Ga0495616_0061326 3300046513 Bacteria 1844
219 Ga0495630_0010524 3300046517 Bacteria 6682
220 Ga0495631_0010597 3300046518 Bacteria 4558
221 Ga0495631_0011788 3300046518 Bacteria 4288
222 Ga0495632_0001052 3300046519 Bacteria 23678
223 Ga0495632_0005978 3300046519 Bacteria 7923
224 Ga0495632_0110058 3300046519 Bacteria 1294
225 Ga0495643_0005632 3300046522 Bacteria 8401
226 Ga0495643_0015687 3300046522 Bacteria 4469
227 Ga0495643_0022364 3300046522 Bacteria 3609
228 Ga0495644_0001654 3300046523 Bacteria 9048
229 Ga0495644_0010714 3300046523 Bacteria 3532
230 Ga0495644_0053740 3300046523 Bacteria 1513
231 Ga0495648_0006905 3300046524 Bacteria 9156
232 Ga0495648_0024406 3300046524 Bacteria 4118
233 Ga0495648_0046843 3300046524 Bacteria 2677
234 Ga0495648_0108440 3300046524 Bacteria 1516
235 Ga0495666_0005759 3300046526 Bacteria 6247
236 Ga0495666_0009850 3300046526 Bacteria 4772
237 Ga0495666_0168332 3300046526 Bacteria 1014
238 Ga0495642_0001566 3300046528 Bacteria 10058
239 Ga0495642_0014070 3300046528 Bacteria 3101
240 Ga0495642_0057836 3300046528 Bacteria 1604
241 Ga0495654_0014598 3300046530 Bacteria 4178
242 Ga0495665_0060891 3300046531 Bacteria 1993
243 Ga0495586_0008051 3300046535 Bacteria 5619
244 Ga0495586_0042681 3300046535 Bacteria 2441
245 Ga0495587_0026537 3300046536 Bacteria 3532
246 Ga0495587_0045595 3300046536 Bacteria 2605
247 Ga0495609_0000444 3300046538 Bacteria 34134
248 Ga0495609_0016894 3300046538 Bacteria 3396
249 Ga0495609_0019858 3300046538 Bacteria 3107
250 Ga0495597_0041714 3300046542 Bacteria 2048
251 Ga0495597_0042795 3300046542 Bacteria 2018
252 Ga0495633_0009616 3300046558 Bacteria 5324
253 Ga0495667_0067974 3300046559 Bacteria 2328
254 Ga0495656_0061366 3300046615 Bacteria 1642
255 Ga0495668_0015790 3300046616 Bacteria 4400
256 Ga0495668_0111513 3300046616 Bacteria 1496
257 Ga0495668_0166219 3300046616 Bacteria 1208
258 Ga0495634_0016516 3300046642 Bacteria 5278
259 Ga0495611_0038042 3300046648 Bacteria 2139
260 Ga0495611_0088392 3300046648 Bacteria 1430
261 Ga0495625_0028803 3300046660 Bacteria 4160
262 Ga0495635_0001006 3300046663 Bacteria 18627
263 Ga0495661_0000857 3300046665 Bacteria 28333
264 Ga0495661_0001987 3300046665 Bacteria 16165
265 Ga0495661_0003456 3300046665 Bacteria 11660
266 Ga0495661_0010412 3300046665 Bacteria 6345
267 Ga0495661_0010954 3300046665 Bacteria 6163
268 Ga0495661_0013388 3300046665 Bacteria 5509
269 Ga0495661_0018850 3300046665 Bacteria 4530
270 Ga0495661_0082911 3300046665 Bacteria 1844
271 Ga0495588_0000113 3300046674 Bacteria 137279
272 Ga0495588_0002771 3300046674 Bacteria 7530
273 Ga0495588_0004634 3300046674 Bacteria 6070
274 Ga0495588_0006704 3300046674 Bacteria 5201
275 Ga0495588_0025731 3300046674 Bacteria 2934
276 Ga0495669_0000075 3300046684 Bacteria 65812
277 Ga0495669_0002745 3300046684 Bacteria 7222
278 Ga0495613_0029207 3300046689 Bacteria 4101
279 Ga0495670_0000828 3300046691 Bacteria 14943
280 Ga0495670_0008032 3300046691 Bacteria 5187
281 Ga0495670_0010701 3300046691 Bacteria 4509
282 Ga0495671_0013667 3300046692 Bacteria 4388
283 Ga0495649_0015865 3300046694 Bacteria 4280
284 Ga0495649_0017481 3300046694 Bacteria 4045
285 Ga0495649_0106872 3300046694 Bacteria 1485
286 Ga0495589_0000321 3300046794 Bacteria 37723
287 Ga0495589_0000376 3300046794 Bacteria 34281
288 Ga0495589_0042065 3300046794 Bacteria 2277
289 Ga0495660_0000250 3300046810 Bacteria 51806
290 Ga0495660_0003286 3300046810 Bacteria 10034
291 Ga0495660_0051304 3300046810 Bacteria 2245
292 Ga0495581_0014024 3300047315 Bacteria 4647
293 Ga0495581_0045904 3300047315 Bacteria 2525
294 Ga0495604_0004249 3300047317 Bacteria 11337
295 Ga0495604_0019703 3300047317 Bacteria 5398
296 Ga0495604_0032999 3300047317 Bacteria 4099
297 Ga0495672_0001718 3300047320 Bacteria 21200
298 Ga0495676_0000034 3300047321 Bacteria 124977
299 Ga0495680_0004940 3300047322 Bacteria 12620
300 Ga0495680_0029499 3300047322 Bacteria 4492
301 Ga0495680_0115226 3300047322 Bacteria 1989
302 Ga0495683_0009904 3300047323 Bacteria 5062
303 Ga0495683_0017917 3300047323 Bacteria 3666
304 Ga0495687_000054 3300047443 Bacteria 194607
305 Ga0495687_001159 3300047443 Bacteria 25522
306 Ga0495687_002424 3300047443 Bacteria 15007
307 Ga0495687_016229 3300047443 Bacteria 3750
308 Ga0495687_042748 3300047443 Bacteria 1978
309 Ga0495687_094565 3300047443 Bacteria 1136
310 Ga0495675_0006740 3300047444 Bacteria 7042
311 Ga0495675_0016808 3300047444 Bacteria 4627
312 Ga0495677_0000012 3300047445 Bacteria 146763
313 Ga0495677_0001035 3300047445 Bacteria 11163
314 Ga0495677_0002966 3300047445 Bacteria 6597
315 Ga0495679_008410 3300047446 Bacteria 4197
316 Ga0495685_029948 3300047447 Bacteria 1872
317 Ga0495593_0014029 3300047673 Bacteria 4562
318 Ga0495602_0161296 3300048088 Bacteria 1750
319 Ga0495614_0001277 3300048089 Bacteria 10824
320 Ga0495614_0017532 3300048089 Bacteria 3110
321 Ga0495626_0000036 3300048091 Bacteria 180464
322 Ga0495626_0001409 3300048091 Bacteria 19214
323 Ga0495626_0001898 3300048091 Bacteria 15583
324 Ga0495626_0007105 3300048091 Bacteria 6271
325 Ga0495626_0012929 3300048091 Bacteria 4356
326 Ga0495626_0026341 3300048091 Bacteria 2835
327 Ga0496102_0081988 3300048905 Bacteria 2975
328 Ga0496103_0080399 3300048906 Bacteria 2050
329 Ga0496103_0199258 3300048906 Bacteria 1287
330 Ga0496106_0052661 3300048909 Bacteria 3072
331 Ga0496107_0115666 3300048910 Bacteria 1974
332 Ga0496111_0239903 3300048914 Bacteria 1346
333 Ga0496112_0114775 3300048915 Bacteria 2664
334 Ga0496113_0007544 3300048916 Bacteria 7012
335 Ga0496114_0128825 3300048917 Bacteria 2184
336 Ga0496114_0467062 3300048917 Bacteria 1117
337 Ga0496115_0066889 3300048918 Bacteria 2905
338 Ga0496116_0005690 3300048919 Bacteria 11465
339 Ga0496117_0001054 3300048920 Bacteria 42049
340 Ga0496117_0037853 3300048920 Bacteria 3587
341 Ga0496118_0012455 3300048921 Bacteria 8163
342 Ga0496118_0014822 3300048921 Bacteria 7269
343 Ga0496118_0024718 3300048921 Bacteria 5174
344 Ga0496119_0010495 3300048922 Bacteria 7786
345 Ga0496120_0005639 3300048923 Bacteria 9917
346 Ga0496121_0021568 3300048924 Bacteria 6302
347 Ga0496122_0010863 3300048925 Bacteria 9322
348 Ga0496122_0035194 3300048925 Bacteria 4081
349 Ga0496122_0063379 3300048925 Bacteria 2698
350 Ga0496122_0069463 3300048925 Bacteria 2522
351 Ga0496123_0005895 3300048926 Bacteria 12105
352 Ga0496123_0008799 3300048926 Bacteria 9206
353 Ga0496124_0090251 3300048927 Bacteria 2500
354 Ga0496124_0294700 3300048927 Bacteria 1175
355 Ga0496125_0000095 3300048928 Bacteria 208094
356 Ga0496125_0043616 3300048928 Bacteria 3803
357 Ga0496126_0023977 3300048929 Bacteria 5899
358 Ga0495678_002304 3300049459 Bacteria 13170
359 Ga0501034_0154522 3300049571 Bacteria 2269
360 Ga0501262_000161 3300049759 Bacteria 8247
361 nmdc:mga00v17_78044_c1 3300050491 Bacteria 2063
362 nmdc:mga0yw44_185996_c1 3300050492 Bacteria 1369
363 Ga0500619_000114 3300053154 Bacteria 21450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0128825 Ga0496114_0128825_1004_1909 269
2 3300050491 nmdc:mga00v17_78044_c1 nmdc:mga00v17_78044_c1_1069_1986 272
3 3300053154 Ga0500619_000114 Ga0500619_000114_2976_3911 272
4 3300037471 Ga0395905_0260381 Ga0395905_0260381_533_1474 277
5 3300003792 Ga0055540_1003277 Ga0055540_10032774 278
6 3300003794 Ga0055531_10008522 Ga0055531_100085224 278
7 3300014969 Ga0157376_10005505 Ga0157376_100055052 278
8 3300025273 Ga0209673_1014421 Ga0209673_10144212 278
9 3300025303 Ga0209051_1004117 Ga0209051_10041174 278
10 3300025304 Ga0209257_1000022 Ga0209257_1000022404 278
11 3300005327 Ga0070658_10377014 Ga0070658_103770141 280
12 3300005543 Ga0070672_100072694 Ga0070672_1000726941 280
13 3300025926 Ga0207659_10191218 Ga0207659_101912182 280
14 3300025940 Ga0207691_10068084 Ga0207691_100680842 280
15 3300026118 Ga0207675_100266061 Ga0207675_1002660612 280
16 3300026121 Ga0207683_10017319 Ga0207683_100173192 280
17 3300031548 Ga0307408_100074965 Ga0307408_1000749654 281
18 3300031731 Ga0307405_10255523 Ga0307405_102555232 281
19 3300031911 Ga0307412_10085957 Ga0307412_100859572 281
20 3300049759 Ga0501262_000161 Ga0501262_000161_3471_4397 281
21 3300005457 Ga0070662_100108954 Ga0070662_1001089543 282
22 3300025893 Ga0207682_10026333 Ga0207682_100263332 282
23 3300025294 Ga0209025_1001076 Ga0209025_100107630 283
24 3300025294 Ga0209025_1033387 Ga0209025_10333872 284
25 3300006038 Ga0075365_10016589 Ga0075365_100165893 285
26 3300050492 nmdc:mga0yw44_185996_c1 nmdc:mga0yw44_185996_c1_387_1313 285
27 3300025263 Ga0209565_1013390 Ga0209565_10133902 289
28 3300048091 Ga0495626_0007105 Ga0495626_0007105_2312_3229 289
29 3300031251 Ga0265327_10001420 Ga0265327_1000142031 291
30 3300046492 Ga0495585_0001038 Ga0495585_0001038_19535_20482 291
31 3300037471 Ga0395905_0036069 Ga0395905_0036069_376_1293 292
32 3300038443 Ga0395901_0315475 Ga0395901_0315475_350_1267 292
33 3300003771 Ga0055526_1003897 Ga0055526_10038978 293
34 3300025295 Ga0209564_1001300 Ga0209564_10013007 293
35 3300042005 Ga0439448_0004092 Ga0439448_0004092_356_1300 293
36 3300010375 Ga0105239_10216595 Ga0105239_102165952 294
37 3300025920 Ga0207649_10332472 Ga0207649_103324721 294
38 3300046492 Ga0495585_0022880 Ga0495585_0022880_537_1484 294
39 3300046522 Ga0495643_0015687 Ga0495643_0015687_222_1169 294
40 3300046665 Ga0495661_0013388 Ga0495661_0013388_1846_2793 294
41 3300046691 Ga0495670_0000828 Ga0495670_0000828_11440_12387 294
42 3300047446 Ga0495679_008410 Ga0495679_008410_1993_2943 294
43 3300048909 Ga0496106_0052661 Ga0496106_0052661_25_969 294
44 3300030500 Ga0268256_1000907 Ga0268256_100090710 298
45 3300046660 Ga0495625_0028803 Ga0495625_0028803_2988_3905 298
46 3300037471 Ga0395905_0087952 Ga0395905_0087952_1876_2817 299
47 3300046523 Ga0495644_0010714 Ga0495644_0010714_950_1852 300
48 3300046457 Ga0495590_0000975 Ga0495590_0000975_3460_4407 301
49 3300046665 Ga0495661_0010954 Ga0495661_0010954_3450_4355 301
50 3300046691 Ga0495670_0008032 Ga0495670_0008032_445_1350 301
51 3300046499 Ga0495594_0008986 Ga0495594_0008986_2772_3698 303
52 iso_pu_bacteria 2928130867 2928132852 303
53 3300021361 Ga0213872_10012337 Ga0213872_100123372 304
54 3300039447 Ga0436361_0335889 Ga0436361_0335889_23152_24072 304
55 3300048925 Ga0496122_0069463 Ga0496122_0069463_956_1894 304
56 3300014745 Ga0157377_10109756 Ga0157377_101097561 305
57 3300037312 Ga0395899_0017421 Ga0395899_0017421_2582_3499 305
58 3300037418 Ga0395900_0013163 Ga0395900_0013163_2913_3830 305
59 3300037466 Ga0395898_0028615 Ga0395898_0028615_2693_3610 305
60 3300038443 Ga0395901_0034146 Ga0395901_0034146_910_1827 305
61 3300038443 Ga0395901_0085508 Ga0395901_0085508_908_1825 305
62 3300046474 Ga0495605_0005322 Ga0495605_0005322_1858_2775 305
63 3300046491 Ga0495584_0001070 Ga0495584_0001070_11451_12368 305
64 3300046501 Ga0495607_0002231 Ga0495607_0002231_8947_9864 305
65 3300046513 Ga0495616_0042882 Ga0495616_0042882_759_1676 305
66 3300046528 Ga0495642_0014070 Ga0495642_0014070_255_1172 305
67 3300046538 Ga0495609_0000444 Ga0495609_0000444_6094_7011 305
68 3300046615 Ga0495656_0061366 Ga0495656_0061366_436_1374 305
69 3300046665 Ga0495661_0001987 Ga0495661_0001987_8991_9908 305
70 3300046694 Ga0495649_0015865 Ga0495649_0015865_327_1244 305
71 3300046794 Ga0495589_0000376 Ga0495589_0000376_6241_7158 305
72 3300047443 Ga0495687_000054 Ga0495687_000054_27124_28041 305
73 3300047445 Ga0495677_0000012 Ga0495677_0000012_27124_28041 305
74 3300048915 Ga0496112_0114775 Ga0496112_0114775_481_1398 305
75 3300048916 Ga0496113_0007544 Ga0496113_0007544_3692_4609 305
76 3300048925 Ga0496122_0010863 Ga0496122_0010863_3677_4594 305
77 iso_pu_bacteria 2808606418 2809143891 305
78 iso_pu_bacteria 8047673197 8047678671 305
79 3300025949 Ga0207667_10000044 Ga0207667_10000044102 306
80 3300046523 Ga0495644_0053740 Ga0495644_0053740_21_968 306
81 3300046674 Ga0495588_0002771 Ga0495588_0002771_2855_3796 306
82 3300047321 Ga0495676_0000034 Ga0495676_0000034_105248_106189 306
83 3300048914 Ga0496111_0239903 Ga0496111_0239903_95_1036 306
84 3300048920 Ga0496117_0037853 Ga0496117_0037853_1318_2259 306
85 3300048921 Ga0496118_0014822 Ga0496118_0014822_2814_3755 306
86 3300005339 Ga0070660_100131184 Ga0070660_1001311842 307
87 3300005366 Ga0070659_100093463 Ga0070659_1000934632 307
88 3300005455 Ga0070663_100153466 Ga0070663_1001534662 307
89 3300005563 Ga0068855_100080949 Ga0068855_1000809491 307
90 3300005564 Ga0070664_100109961 Ga0070664_1001099612 307
91 3300005616 Ga0068852_100053456 Ga0068852_1000534563 307
92 3300006881 Ga0068865_100224545 Ga0068865_1002245451 307
93 3300009093 Ga0105240_10251433 Ga0105240_102514332 307
94 3300009148 Ga0105243_10009485 Ga0105243_100094856 307
95 3300009174 Ga0105241_10037840 Ga0105241_100378401 307
96 3300009176 Ga0105242_10006647 Ga0105242_100066476 307
97 3300009545 Ga0105237_10069972 Ga0105237_100699723 307
98 3300011119 Ga0105246_10106319 Ga0105246_101063192 307
99 3300025909 Ga0207705_10009817 Ga0207705_100098174 307
100 3300025911 Ga0207654_10001334 Ga0207654_100013344 307
101 3300025913 Ga0207695_10234085 Ga0207695_102340852 307
102 3300025914 Ga0207671_10128998 Ga0207671_101289982 307
103 3300025919 Ga0207657_10058155 Ga0207657_100581554 307
104 3300025934 Ga0207686_10004348 Ga0207686_100043484 307
105 3300025945 Ga0207679_10272877 Ga0207679_102728772 307
106 3300025949 Ga0207667_10117147 Ga0207667_101171472 307
107 3300026067 Ga0207678_10074169 Ga0207678_100741693 307
108 3300026142 Ga0207698_10160638 Ga0207698_101606382 307
109 3300037312 Ga0395899_0022435 Ga0395899_0022435_1120_2064 307
110 3300037312 Ga0395899_0039309 Ga0395899_0039309_1467_2411 307
111 3300037418 Ga0395900_0009735 Ga0395900_0009735_3012_3956 307
112 3300037418 Ga0395900_0359956 Ga0395900_0359956_136_1080 307
113 3300037466 Ga0395898_0013241 Ga0395898_0013241_233_1177 307
114 3300037466 Ga0395898_0243160 Ga0395898_0243160_181_1125 307
115 3300038443 Ga0395901_0016680 Ga0395901_0016680_3491_4435 307
116 3300038443 Ga0395901_0175699 Ga0395901_0175699_539_1483 307
117 3300042157 Ga0439458_0008821 Ga0439458_0008821_301_1245 307
118 3300044706 Ga0466964_0025799 Ga0466964_0025799_822_1766 307
119 3300044842 Ga0466957_0127097 Ga0466957_0127097_576_1520 307
120 3300046471 Ga0495650_0024842 Ga0495650_0024842_622_1578 307
121 3300046506 Ga0495583_0007098 Ga0495583_0007098_2980_3936 307
122 3300046694 Ga0495649_0106872 Ga0495649_0106872_354_1298 307
123 3300047443 Ga0495687_094565 Ga0495687_094565_93_1016 307
124 3300048906 Ga0496103_0199258 Ga0496103_0199258_211_1167 307
125 3300048917 Ga0496114_0467062 Ga0496114_0467062_70_1014 307
126 3300048918 Ga0496115_0066889 Ga0496115_0066889_1765_2721 307
127 iso_pu_bacteria 2511231003 2511251768 307
128 iso_pu_bacteria 2765235838 2765568185 307
129 iso_pu_bacteria 2839094727 2839097520 307
130 3300005366 Ga0070659_100015829 Ga0070659_1000158292 308
131 3300009176 Ga0105242_10000960 Ga0105242_1000096020 308
132 3300009551 Ga0105238_10387957 Ga0105238_103879571 308
133 3300025273 Ga0209673_1001087 Ga0209673_100108721 308
134 3300025909 Ga0207705_10248415 Ga0207705_102484151 308
135 3300025919 Ga0207657_10034438 Ga0207657_100344382 308
136 3300025932 Ga0207690_10005628 Ga0207690_100056284 308
137 3300025934 Ga0207686_10129105 Ga0207686_101291052 308
138 3300037312 Ga0395899_0011132 Ga0395899_0011132_3175_4122 308
139 3300037418 Ga0395900_0575505 Ga0395900_0575505_24_971 308
140 3300037471 Ga0395905_0041083 Ga0395905_0041083_2977_3924 308
141 3300044656 Ga0466969_0049913 Ga0466969_0049913_797_1744 308
142 3300044684 Ga0466966_0025381 Ga0466966_0025381_2912_3859 308
143 3300044684 Ga0466966_0074541 Ga0466966_0074541_829_1776 308
144 3300044693 Ga0466961_0087497 Ga0466961_0087497_575_1522 308
145 3300044693 Ga0466961_0144586 Ga0466961_0144586_390_1337 308
146 3300044842 Ga0466957_0005362 Ga0466957_0005362_5917_6864 308
147 3300045049 Ga0466959_0132175 Ga0466959_0132175_711_1658 308
148 3300045836 Ga0466958_0066746 Ga0466958_0066746_753_1700 308
149 3300046455 Ga0495603_0127161 Ga0495603_0127161_337_1284 308
150 3300046457 Ga0495590_0008127 Ga0495590_0008127_2481_3428 308
151 3300046463 Ga0495653_0005257 Ga0495653_0005257_3472_4419 308
152 3300046463 Ga0495653_0012537 Ga0495653_0012537_1716_2663 308
153 3300046463 Ga0495653_0040274 Ga0495653_0040274_2519_3466 308
154 3300046472 Ga0495580_0044541 Ga0495580_0044541_827_1774 308
155 3300046473 Ga0495582_0017828 Ga0495582_0017828_2365_3312 308
156 3300046474 Ga0495605_0000166 Ga0495605_0000166_60655_61602 308
157 3300046474 Ga0495605_0015552 Ga0495605_0015552_523_1482 308
158 3300046475 Ga0495639_0011412 Ga0495639_0011412_2199_3146 308
159 3300046491 Ga0495584_0000699 Ga0495584_0000699_11421_12368 308
160 3300046491 Ga0495584_0067993 Ga0495584_0067993_277_1224 308
161 3300046492 Ga0495585_0107552 Ga0495585_0107552_404_1351 308
162 3300046499 Ga0495594_0005904 Ga0495594_0005904_2226_3173 308
163 3300046499 Ga0495594_0020075 Ga0495594_0020075_1229_2176 308
164 3300046499 Ga0495594_0070322 Ga0495594_0070322_461_1420 308
165 3300046500 Ga0495596_0000180 Ga0495596_0000180_15419_16366 308
166 3300046501 Ga0495607_0001529 Ga0495607_0001529_16687_17634 308
167 3300046506 Ga0495583_0000075 Ga0495583_0000075_91924_92871 308
168 3300046507 Ga0495606_0011717 Ga0495606_0011717_3562_4509 308
169 3300046513 Ga0495616_0015183 Ga0495616_0015183_2848_3795 308
170 3300046513 Ga0495616_0026484 Ga0495616_0026484_308_1255 308
171 3300046517 Ga0495630_0010524 Ga0495630_0010524_780_1727 308
172 3300046518 Ga0495631_0010597 Ga0495631_0010597_437_1384 308
173 3300046518 Ga0495631_0011788 Ga0495631_0011788_279_1238 308
174 3300046519 Ga0495632_0001052 Ga0495632_0001052_18585_19532 308
175 3300046519 Ga0495632_0005978 Ga0495632_0005978_4097_5056 308
176 3300046519 Ga0495632_0110058 Ga0495632_0110058_212_1159 308
177 3300046522 Ga0495643_0005632 Ga0495643_0005632_4751_5698 308
178 3300046524 Ga0495648_0006905 Ga0495648_0006905_4309_5262 308
179 3300046524 Ga0495648_0024406 Ga0495648_0024406_1846_2805 308
180 3300046524 Ga0495648_0046843 Ga0495648_0046843_1259_2206 308
181 3300046524 Ga0495648_0108440 Ga0495648_0108440_277_1224 308
182 3300046526 Ga0495666_0005759 Ga0495666_0005759_1823_2749 308
183 3300046526 Ga0495666_0009850 Ga0495666_0009850_3256_4203 308
184 3300046526 Ga0495666_0168332 Ga0495666_0168332_14_961 308
185 3300046528 Ga0495642_0001566 Ga0495642_0001566_1562_2521 308
186 3300046530 Ga0495654_0014598 Ga0495654_0014598_2676_3635 308
187 3300046531 Ga0495665_0060891 Ga0495665_0060891_196_1143 308
188 3300046535 Ga0495586_0008051 Ga0495586_0008051_3198_4145 308
189 3300046535 Ga0495586_0042681 Ga0495586_0042681_980_1927 308
190 3300046536 Ga0495587_0026537 Ga0495587_0026537_1684_2631 308
191 3300046536 Ga0495587_0045595 Ga0495587_0045595_981_1928 308
192 3300046538 Ga0495609_0016894 Ga0495609_0016894_1644_2591 308
193 3300046538 Ga0495609_0019858 Ga0495609_0019858_1506_2453 308
194 3300046542 Ga0495597_0042795 Ga0495597_0042795_979_1908 308
195 3300046558 Ga0495633_0009616 Ga0495633_0009616_1802_2749 308
196 3300046559 Ga0495667_0067974 Ga0495667_0067974_1162_2109 308
197 3300046616 Ga0495668_0111513 Ga0495668_0111513_141_1088 308
198 3300046642 Ga0495634_0016516 Ga0495634_0016516_3593_4540 308
199 3300046648 Ga0495611_0038042 Ga0495611_0038042_1066_2013 308
200 3300046663 Ga0495635_0001006 Ga0495635_0001006_1134_2081 308
201 3300046665 Ga0495661_0000857 Ga0495661_0000857_18546_19493 308
202 3300046665 Ga0495661_0018850 Ga0495661_0018850_2607_3560 308
203 3300046665 Ga0495661_0082911 Ga0495661_0082911_148_1095 308
204 3300046674 Ga0495588_0000113 Ga0495588_0000113_114385_115332 308
205 3300046674 Ga0495588_0004634 Ga0495588_0004634_3256_4203 308
206 3300046674 Ga0495588_0006704 Ga0495588_0006704_310_1257 308
207 3300046674 Ga0495588_0025731 Ga0495588_0025731_1107_2054 308
208 3300046684 Ga0495669_0002745 Ga0495669_0002745_5854_6813 308
209 3300046689 Ga0495613_0029207 Ga0495613_0029207_1272_2219 308
210 3300046691 Ga0495670_0010701 Ga0495670_0010701_3203_4150 308
211 3300046692 Ga0495671_0013667 Ga0495671_0013667_1446_2393 308
212 3300046694 Ga0495649_0017481 Ga0495649_0017481_1389_2336 308
213 3300046794 Ga0495589_0000321 Ga0495589_0000321_14900_15847 308
214 3300046810 Ga0495660_0000250 Ga0495660_0000250_21872_22819 308
215 3300046810 Ga0495660_0003286 Ga0495660_0003286_4094_5041 308
216 3300046810 Ga0495660_0051304 Ga0495660_0051304_691_1638 308
217 3300047315 Ga0495581_0045904 Ga0495581_0045904_280_1227 308
218 3300047317 Ga0495604_0004249 Ga0495604_0004249_3952_4878 308
219 3300047317 Ga0495604_0019703 Ga0495604_0019703_3087_4034 308
220 3300047317 Ga0495604_0032999 Ga0495604_0032999_2477_3424 308
221 3300047320 Ga0495672_0001718 Ga0495672_0001718_18447_19394 308
222 3300047322 Ga0495680_0004940 Ga0495680_0004940_5623_6570 308
223 3300047322 Ga0495680_0029499 Ga0495680_0029499_1568_2515 308
224 3300047322 Ga0495680_0115226 Ga0495680_0115226_623_1570 308
225 3300047323 Ga0495683_0009904 Ga0495683_0009904_1890_2837 308
226 3300047443 Ga0495687_001159 Ga0495687_001159_2704_3651 308
227 3300047443 Ga0495687_002424 Ga0495687_002424_7415_8362 308
228 3300047443 Ga0495687_042748 Ga0495687_042748_150_1097 308
229 3300047444 Ga0495675_0006740 Ga0495675_0006740_2720_3667 308
230 3300047444 Ga0495675_0016808 Ga0495675_0016808_58_1005 308
231 3300047445 Ga0495677_0001035 Ga0495677_0001035_5708_6655 308
232 3300047673 Ga0495593_0014029 Ga0495593_0014029_1406_2353 308
233 3300048088 Ga0495602_0161296 Ga0495602_0161296_776_1723 308
234 3300048089 Ga0495614_0001277 Ga0495614_0001277_6935_7882 308
235 3300048091 Ga0495626_0000036 Ga0495626_0000036_160171_161118 308
236 3300048091 Ga0495626_0001409 Ga0495626_0001409_6166_7116 308
237 3300048091 Ga0495626_0001898 Ga0495626_0001898_2422_3378 308
238 3300048906 Ga0496103_0080399 Ga0496103_0080399_834_1781 308
239 3300048910 Ga0496107_0115666 Ga0496107_0115666_116_1063 308
240 3300048925 Ga0496122_0035194 Ga0496122_0035194_2130_3077 308
241 3300048926 Ga0496123_0005895 Ga0496123_0005895_2673_3620 308
242 3300048927 Ga0496124_0090251 Ga0496124_0090251_153_1100 308
243 3300048928 Ga0496125_0043616 Ga0496125_0043616_2401_3348 308
244 3300049459 Ga0495678_002304 Ga0495678_002304_7955_8908 308
245 3300049571 Ga0501034_0154522 Ga0501034_0154522_1246_2193 308
246 iso_pu_bacteria 2551306416 2553005545 308
247 iso_pu_bacteria 2599185169 2599409775 308
248 iso_pu_bacteria 2599185292 2599903524 308
249 iso_pu_bacteria 2600255254 2601522980 308
250 iso_pu_bacteria 2600255255 2601528139 308
251 iso_pu_bacteria 2600255280 2601614970 308
252 iso_pu_bacteria 2600255281 2601620101 308
253 iso_pu_bacteria 2600255287 2601643430 308
254 iso_pu_bacteria 2600255288 2601648507 308
255 iso_pu_bacteria 2600255289 2601653024 308
256 iso_pu_bacteria 2600255290 2601658854 308
257 iso_pu_bacteria 2600255291 2601663253 308
258 iso_pu_bacteria 2600255298 2601696864 308
259 iso_pu_bacteria 2600255299 2601700886 308
260 iso_pu_bacteria 2600255300 2601705679 308
261 iso_pu_bacteria 2600255301 2601711264 308
262 iso_pu_bacteria 2600255302 2601716282 308
263 iso_pu_bacteria 2600255303 2601721889 308
264 iso_pu_bacteria 2600255304 2601726688 308
265 iso_pu_bacteria 2600255305 2601731228 308
266 iso_pu_bacteria 2600255306 2601736240 308
267 iso_pu_bacteria 2600255307 2601740786 308
268 iso_pu_bacteria 2600255309 2601751721 308
269 iso_pu_bacteria 2600255392 2602018418 308
270 iso_pu_bacteria 2602042052 2603660637 308
271 iso_pu_bacteria 2602042053 2603665909 308
272 iso_pu_bacteria 2602042103 2603838623 308
273 iso_pu_bacteria 2602042104 2603844119 308
274 iso_pu_bacteria 2602042105 2603848778 308
275 iso_pu_bacteria 2602042106 2603853850 308
276 iso_pu_bacteria 2602042109 2603867534 308
277 iso_pu_bacteria 2602042110 2603871903 308
278 iso_pu_bacteria 2602042111 2603876722 308
279 iso_pu_bacteria 2603880178 2606049086 308
280 iso_pu_bacteria 2603880184 2606070343 308
281 iso_pu_bacteria 2603880202 2606146769 308
282 iso_pu_bacteria 2603880211 2606176493 308
283 iso_pu_bacteria 2636415599 2637223682 308
284 iso_pu_bacteria 2643221569 2643860013 308
285 iso_pu_bacteria 2675903046 2676408145 308
286 iso_pu_bacteria 2808606414 2809127269 308
287 iso_pu_bacteria 2818991449 2819617049 308
288 iso_pu_bacteria 2857537821 2857540111 308
289 iso_pu_bacteria 2904439833 2904442643 308
290 iso_pu_bacteria 2904530477 2904535148 308
291 iso_pu_bacteria 2904584206 2904588509 308
292 iso_pu_bacteria 2904589729 2904594417 308
293 iso_pu_bacteria 2904601388 2904604751 308
294 iso_pu_bacteria 2919046199 2919047305 308
295 iso_pu_bacteria 2919079590 2919082979 308
296 iso_pu_bacteria 2923510766 2923514214 308
297 iso_pu_bacteria 2941479691 2941484468 308
298 3300005518 Ga0070699_100205726 Ga0070699_1002057262 309
299 3300002704 JGI25155J39150_1000430 JGI25155J39150_10004308 310
300 3300002738 JGI25154J39366_1000223 JGI25154J39366_100022315 310
301 3300002741 JGI25157J39369_1005384 JGI25157J39369_10053842 310
302 3300005327 Ga0070658_10037644 Ga0070658_100376442 310
303 3300005331 Ga0070670_100032117 Ga0070670_1000321172 310
304 3300005333 Ga0070677_10003805 Ga0070677_100038053 310
305 3300005339 Ga0070660_100397054 Ga0070660_1003970541 310
306 3300005364 Ga0070673_100001521 Ga0070673_1000015219 310
307 3300005366 Ga0070659_100048917 Ga0070659_1000489172 310
308 3300005459 Ga0068867_100041116 Ga0068867_1000411162 310
309 3300005543 Ga0070672_100000155 Ga0070672_10000015511 310
310 3300005578 Ga0068854_100002758 Ga0068854_1000027583 310
311 3300005718 Ga0068866_10297979 Ga0068866_102979791 310
312 3300006358 Ga0068871_100003268 Ga0068871_10000326810 310
313 3300009176 Ga0105242_10280991 Ga0105242_102809912 310
314 3300013308 Ga0157375_10160317 Ga0157375_101603172 310
315 3300014745 Ga0157377_10153321 Ga0157377_101533212 310
316 3300025206 Ga0209435_100293 Ga0209435_10029311 310
317 3300025246 Ga0209646_1000021 Ga0209646_1000021367 310
318 3300025250 Ga0209026_1002477 Ga0209026_10024776 310
319 3300025256 Ga0209759_1000100 Ga0209759_100010011 310
320 3300025893 Ga0207682_10018988 Ga0207682_100189883 310
321 3300025919 Ga0207657_10403449 Ga0207657_104034492 310
322 3300025931 Ga0207644_10000418 Ga0207644_100004185 310
323 3300025940 Ga0207691_10000319 Ga0207691_100003199 310
324 3300025944 Ga0207661_10003878 Ga0207661_100038787 310
325 3300025945 Ga0207679_10003128 Ga0207679_100031283 310
326 3300031548 Ga0307408_100050184 Ga0307408_1000501842 310
327 3300031824 Ga0307413_10079986 Ga0307413_100799862 310
328 3300031852 Ga0307410_10047859 Ga0307410_100478592 310
329 3300031995 Ga0307409_100023757 Ga0307409_1000237574 310
330 3300032004 Ga0307414_10105008 Ga0307414_101050082 310
331 3300032005 Ga0307411_10019007 Ga0307411_100190072 310
332 3300032126 Ga0307415_100084279 Ga0307415_1000842791 310
333 3300048905 Ga0496102_0081988 Ga0496102_0081988_1386_2333 310
334 iso_pu_bacteria 2856287931 2856292442 310
335 3300003752 Ga0055539_1000089 Ga0055539_100008956 311
336 3300003756 Ga0055533_1000098 Ga0055533_100009856 311
337 3300003759 Ga0055525_1000130 Ga0055525_100013056 311
338 3300003841 Ga0055541_1000061 Ga0055541_100006156 311
339 3300005334 Ga0068869_100110702 Ga0068869_1001107022 311
340 3300005340 Ga0070689_100028244 Ga0070689_1000282444 311
341 3300005347 Ga0070668_100070645 Ga0070668_1000706452 311
342 3300005355 Ga0070671_100033682 Ga0070671_1000336822 311
343 3300005456 Ga0070678_100049450 Ga0070678_1000494504 311
344 3300005544 Ga0070686_100049187 Ga0070686_1000491873 311
345 3300005834 Ga0068851_10017355 Ga0068851_100173553 311
346 3300005841 Ga0068863_100050810 Ga0068863_1000508102 311
347 3300005842 Ga0068858_100145125 Ga0068858_1001451252 311
348 3300005843 Ga0068860_100232752 Ga0068860_1002327522 311
349 3300006237 Ga0097621_100013983 Ga0097621_1000139834 311
350 3300009545 Ga0105237_10018113 Ga0105237_100181132 311
351 3300009551 Ga0105238_10000031 Ga0105238_1000003133 311
352 3300010375 Ga0105239_10000539 Ga0105239_1000053919 311
353 3300015261 Ga0182006_1000715 Ga0182006_10007152 311
354 3300015262 Ga0182007_10023908 Ga0182007_100239082 311
355 3300017792 Ga0163161_10013559 Ga0163161_100135594 311
356 3300021361 Ga0213872_10002910 Ga0213872_100029103 311
357 3300025224 Ga0209784_100018 Ga0209784_100018278 311
358 3300025225 Ga0209566_100016 Ga0209566_100016278 311
359 3300025226 Ga0209674_100030 Ga0209674_100030278 311
360 3300025230 Ga0209563_100034 Ga0209563_100034278 311
361 3300025253 Ga0209677_100019 Ga0209677_100019278 311
362 3300025321 Ga0207656_10089142 Ga0207656_100891422 311
363 3300025907 Ga0207645_10007383 Ga0207645_100073835 311
364 3300025913 Ga0207695_10004706 Ga0207695_1000470612 311
365 3300025924 Ga0207694_10000062 Ga0207694_1000006299 311
366 3300025926 Ga0207659_10092154 Ga0207659_100921542 311
367 3300025949 Ga0207667_10003171 Ga0207667_100031716 311
368 3300025972 Ga0207668_10106091 Ga0207668_101060912 311
369 3300025981 Ga0207640_10019241 Ga0207640_100192413 311
370 3300026075 Ga0207708_10005812 Ga0207708_100058124 311
371 3300026118 Ga0207675_100029755 Ga0207675_1000297553 311
372 3300026121 Ga0207683_10015987 Ga0207683_100159875 311
373 3300028379 Ga0268266_10285479 Ga0268266_102854792 311
374 3300037471 Ga0395905_0000761 Ga0395905_0000761_34526_35473 311
375 3300037471 Ga0395905_0138602 Ga0395905_0138602_311_1258 311
376 3300039447 Ga0436361_0073109 Ga0436361_0073109_1272_2216 311
377 3300039447 Ga0436361_0545860 Ga0436361_0545860_4617_5570 311
378 3300046473 Ga0495582_0003527 Ga0495582_0003527_6027_6998 311
379 3300046474 Ga0495605_0021909 Ga0495605_0021909_1600_2571 311
380 3300046474 Ga0495605_0056173 Ga0495605_0056173_305_1264 311
381 3300046491 Ga0495584_0009484 Ga0495584_0009484_914_1873 311
382 3300046491 Ga0495584_0014351 Ga0495584_0014351_1718_2677 311
383 3300046500 Ga0495596_0030352 Ga0495596_0030352_186_1145 311
384 3300046513 Ga0495616_0061326 Ga0495616_0061326_280_1251 311
385 3300046522 Ga0495643_0022364 Ga0495643_0022364_1727_2674 311
386 3300046523 Ga0495644_0001654 Ga0495644_0001654_1475_2446 311
387 3300046528 Ga0495642_0057836 Ga0495642_0057836_338_1285 311
388 3300046542 Ga0495597_0041714 Ga0495597_0041714_977_1924 311
389 3300046616 Ga0495668_0015790 Ga0495668_0015790_2421_3380 311
390 3300046616 Ga0495668_0166219 Ga0495668_0166219_127_1098 311
391 3300046648 Ga0495611_0088392 Ga0495611_0088392_368_1327 311
392 3300046665 Ga0495661_0003456 Ga0495661_0003456_1322_2269 311
393 3300046665 Ga0495661_0010412 Ga0495661_0010412_857_1828 311
394 3300046684 Ga0495669_0000075 Ga0495669_0000075_56369_57328 311
395 3300046794 Ga0495589_0042065 Ga0495589_0042065_103_1062 311
396 3300047315 Ga0495581_0014024 Ga0495581_0014024_66_1037 311
397 3300047323 Ga0495683_0017917 Ga0495683_0017917_1364_2323 311
398 3300047443 Ga0495687_016229 Ga0495687_016229_1523_2470 311
399 3300047445 Ga0495677_0002966 Ga0495677_0002966_1018_1989 311
400 3300047447 Ga0495685_029948 Ga0495685_029948_649_1608 311
401 3300048089 Ga0495614_0017532 Ga0495614_0017532_1416_2387 311
402 3300048091 Ga0495626_0012929 Ga0495626_0012929_286_1245 311
403 3300048091 Ga0495626_0026341 Ga0495626_0026341_691_1650 311
404 3300048919 Ga0496116_0005690 Ga0496116_0005690_6366_7313 311
405 3300048921 Ga0496118_0024718 Ga0496118_0024718_3574_4521 311
406 3300048922 Ga0496119_0010495 Ga0496119_0010495_4453_5400 311
407 3300048923 Ga0496120_0005639 Ga0496120_0005639_2505_3452 311
408 3300048924 Ga0496121_0021568 Ga0496121_0021568_922_1869 311
409 3300048925 Ga0496122_0063379 Ga0496122_0063379_1401_2348 311
410 3300048926 Ga0496123_0008799 Ga0496123_0008799_3935_4882 311
411 3300048927 Ga0496124_0294700 Ga0496124_0294700_194_1141 311
412 3300048928 Ga0496125_0000095 Ga0496125_0000095_3996_4943 311
413 3300048929 Ga0496126_0023977 Ga0496126_0023977_4300_5247 311
414 3300001989 JGI24739J22299_10000552 JGI24739J22299_1000055211 312
415 3300003856 Ga0058692_1010221 Ga0058692_10102212 312
416 3300027312 Ga0209371_1000224 Ga0209371_100022460 312
417 3300030500 Ga0268256_1000427 Ga0268256_100042717 312
418 3300042439 Ga0439464_0000033 Ga0439464_0000033_3626_4564 312
419 3300046471 Ga0495650_0000103 Ga0495650_0000103_46208_47146 312
420 3300046471 Ga0495650_0003567 Ga0495650_0003567_2344_3291 312
421 3300048920 Ga0496117_0001054 Ga0496117_0001054_16334_17281 312
422 3300048921 Ga0496118_0012455 Ga0496118_0012455_6817_7764 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

127

299

0.97

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

24

329

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pfz-assembly2.cif.gz_A structure of a nad-dependent persulfide reductase from a. fulgidus 0.9534 145 173
6lkd-assembly1.cif.gz_A in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor 0.9363 143 174
7e0g-assembly1.cif.gz_A crystal structure of lysine specific demethylase 1 (lsd1) with tak-418, fad-adduct 0.9314 143 174
6rj6-assembly1.cif.gz_B crystal structure of phgdh in complex with bi-4924 0.9294 100 303
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.9273 101 301
ID Description Score Start End Superfamily
af_Q54LY4_9_236_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9652 143 174 3.90.180.10
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9622 143 173 3.90.180.10
af_A0A1D6QTI4_68_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 113 254 3.40.50.720
af_Q9VII9_150_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9506 141 281 3.40.50.720
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9417 144 174 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6A5L562-F1-model_v4 deleted 0.9866 4 312
AF-A0A059WZM9-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain protein 0.9853 1 307 GO:0016616
GO:0051287
AF-A0A2S8VHC1-F1-model_v4 3-phosphoglycerate dehydrogenase 0.9851 2 311 GO:0016616
GO:0051287
AF-A0A2W5P989-F1-model_v4 3-phosphoglycerate dehydrogenase 0.9836 5 307 GO:0016616
GO:0051287
AF-A0A6N1XCR5-F1-model_v4 3-phosphoglycerate dehydrogenase 0.9835 5 312 GO:0016616
GO:0051287

Feature Viewer

pLDDT pTM Quality
92.79 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map