F440324

General Info

Members Datasets Scaffolds Average Seq Length
422 209 844 133

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0738890|Ga0395900_0738890_341_814
Length 157
Sequence LKSLEKWLGAFDWHRIGVAARKEKPMAHWLMKSEPGTYSWADLQRDQTTEWDGVRNPAARLHLKAMKPGDEAFFYHSGDERSVIGIMRITRGAAPDPKDPNWVSVRVEPVSRLPRPVTLKEIKAEPTLAKMELIRQSRLSVSPVRDEEWEVVMALAR

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
169 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
170 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
197 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
198 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
199 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
206 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 1.42
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0738890 3300037418 Unclassified 915
2 JGI24736J21556_1001496 3300001904 Bacteria 4276
3 JGI24741J21665_1035991 3300001915 Unclassified 735
4 JGI24740J21852_10018180 3300001979 Bacteria 2500
5 JGI24737J22298_10174886 3300001990 Unclassified 633
6 JGI24748J21848_1004611 3300002074 Bacteria 1584
7 JGI24034J26672_10012970 3300002239 Bacteria 1261
8 JGI25406J46586_10153531 3300003203 Bacteria 672
9 rootH1_10149825 3300003316 Unclassified 1263
10 rootH1_10170626 3300003316 Bacteria 1226
11 rootH1_10276381 3300003323 Bacteria 2672
12 Ga0070658_10042832 3300005327 Bacteria 3657
13 Ga0070658_10063621 3300005327 Bacteria 3008
14 Ga0070658_10102938 3300005327 Bacteria 2361
15 Ga0070658_10122786 3300005327 Bacteria 2159
16 Ga0070676_10070364 3300005328 Bacteria 2099
17 Ga0070676_10072548 3300005328 Bacteria 2070
18 Ga0070676_10483965 3300005328 Bacteria 876
19 Ga0070670_100021676 3300005331 Bacteria 5525
20 Ga0070670_100139586 3300005331 Bacteria 2096
21 Ga0070670_101358433 3300005331 Unclassified 651
22 Ga0070677_10022784 3300005333 Bacteria 2310
23 Ga0068869_100337571 3300005334 Bacteria 1225
24 Ga0070680_100000088 3300005336 Bacteria 51479
25 Ga0070682_101152199 3300005337 Bacteria 652
26 Ga0068868_100001171 3300005338 Bacteria 17966
27 Ga0068868_100809112 3300005338 Bacteria 846
28 Ga0070660_100002771 3300005339 Bacteria 12034
29 Ga0070660_100028481 3300005339 Bacteria 4180
30 Ga0070660_100047439 3300005339 Bacteria 3296
31 Ga0070660_100069782 3300005339 Bacteria 2741
32 Ga0070660_100354681 3300005339 Bacteria 1208
33 Ga0070660_100378322 3300005339 Unclassified 1169
34 Ga0070660_100553840 3300005339 Bacteria 959
35 Ga0070689_100060636 3300005340 Bacteria 2942
36 Ga0070661_100000001 3300005344 Bacteria 424830
37 Ga0070661_100002768 3300005344 Bacteria 12034
38 Ga0070661_100036464 3300005344 Bacteria 3574
39 Ga0070661_100057888 3300005344 Bacteria 2839
40 Ga0070661_100250056 3300005344 Unclassified 1368
41 Ga0070661_100385221 3300005344 Bacteria 1106
42 Ga0070692_10868714 3300005345 Bacteria 621
43 Ga0070668_100000011 3300005347 Bacteria 123099
44 Ga0070669_100247353 3300005353 Bacteria 1419
45 Ga0070671_100000707 3300005355 Bacteria 23997
46 Ga0070671_100017804 3300005355 Bacteria 5761
47 Ga0070674_100030958 3300005356 Bacteria 3541
48 Ga0070673_100012848 3300005364 Bacteria 5765
49 Ga0070673_101066923 3300005364 Bacteria 754
50 Ga0070688_100333489 3300005365 Bacteria 1106
51 Ga0070659_100001332 3300005366 Bacteria 17806
52 Ga0070659_100021490 3300005366 Bacteria 4915
53 Ga0070659_100029693 3300005366 Bacteria 4226
54 Ga0070659_100032957 3300005366 Bacteria 4023
55 Ga0070659_100376077 3300005366 Bacteria 1196
56 Ga0070659_101377430 3300005366 Bacteria 627
57 Ga0070667_100004890 3300005367 Bacteria 11219
58 Ga0070667_100018164 3300005367 Bacteria 5831
59 Ga0070714_101602337 3300005435 Bacteria 636
60 Ga0070713_100077858 3300005436 Bacteria 2821
61 Ga0070700_101171946 3300005441 Unclassified 640
62 Ga0070700_102020048 3300005441 Bacteria 500
63 Ga0070694_100060168 3300005444 Bacteria 2590
64 Ga0070708_100091409 3300005445 Bacteria 2772
65 Ga0070663_100001444 3300005455 Bacteria 13033
66 Ga0070663_100010253 3300005455 Bacteria 5836
67 Ga0070663_100065406 3300005455 Bacteria 2632
68 Ga0070663_100129594 3300005455 Bacteria 1914
69 Ga0070663_100274969 3300005455 Bacteria 1340
70 Ga0070662_100014606 3300005457 Bacteria 5250
71 Ga0070662_100017196 3300005457 Bacteria 4869
72 Ga0070662_100080236 3300005457 Bacteria 2428
73 Ga0070706_102021536 3300005467 Bacteria 522
74 Ga0070698_101728625 3300005471 Bacteria 578
75 Ga0070699_100001110 3300005518 Bacteria 25050
76 Ga0070679_100000003 3300005530 Bacteria 307836
77 Ga0070679_100036143 3300005530 Bacteria 4901
78 Ga0070697_100045762 3300005536 Unclassified 3547
79 Ga0070697_100269915 3300005536 Bacteria 1458
80 Ga0068853_100050043 3300005539 Bacteria 3594
81 Ga0068853_100273762 3300005539 Unclassified 1555
82 Ga0070686_100032636 3300005544 Bacteria 3194
83 Ga0070695_100091291 3300005545 Unclassified 2034
84 Ga0070696_100040242 3300005546 Bacteria 3227
85 Ga0070693_100022700 3300005547 Bacteria 3341
86 Ga0070693_100378144 3300005547 Bacteria 976
87 Ga0070665_100072974 3300005548 Bacteria 3439
88 Ga0070665_100073769 3300005548 Bacteria 3418
89 Ga0070704_102234917 3300005549 Bacteria 509
90 Ga0068855_100343663 3300005563 Bacteria 1645
91 Ga0068855_100786166 3300005563 Bacteria 1012
92 Ga0070664_100009806 3300005564 Bacteria 7761
93 Ga0070664_100019302 3300005564 Bacteria 5608
94 Ga0070664_100164923 3300005564 Bacteria 1962
95 Ga0068857_100012590 3300005577 Bacteria 7369
96 Ga0068857_100072094 3300005577 Bacteria 3078
97 Ga0068857_100343959 3300005577 Bacteria 1380
98 Ga0068857_100716799 3300005577 Bacteria 951
99 Ga0068854_100015640 3300005578 Bacteria 5034
100 Ga0068854_100021473 3300005578 Bacteria 4382
101 Ga0068854_100039898 3300005578 Bacteria 3310
102 Ga0068856_100896964 3300005614 Bacteria 905
103 Ga0068852_100003209 3300005616 Bacteria 11419
104 Ga0068852_100035850 3300005616 Unclassified 4143
105 Ga0068852_100132761 3300005616 Bacteria 2295
106 Ga0068859_100004236 3300005617 Bacteria 14649
107 Ga0068859_100011759 3300005617 Bacteria 8793
108 Ga0068859_100169015 3300005617 Bacteria 2267
109 Ga0068859_100254915 3300005617 Bacteria 1845
110 Ga0068864_100039914 3300005618 Bacteria 4013
111 Ga0068866_10117601 3300005718 Bacteria 1493
112 Ga0068861_101489240 3300005719 Bacteria 664
113 Ga0068851_10243556 3300005834 Bacteria 1018
114 Ga0068851_10707661 3300005834 Unclassified 620
115 Ga0068863_100000186 3300005841 Bacteria 65963
116 Ga0068858_100000698 3300005842 Bacteria 35076
117 Ga0068858_100009576 3300005842 Bacteria 9240
118 Ga0068860_100026522 3300005843 Bacteria 5584
119 Ga0068860_100122679 3300005843 Bacteria 2489
120 Ga0068862_100028111 3300005844 Bacteria 4736
121 Ga0068862_100232421 3300005844 Bacteria 1673
122 Ga0068862_100555508 3300005844 Bacteria 1097
123 Ga0081539_10021054 3300005985 Bacteria 4374
124 Ga0075363_100000143 3300006048 Bacteria 17595
125 Ga0075430_100396131 3300006846 Bacteria 1140
126 Ga0075434_100852908 3300006871 Unclassified 926
127 Ga0068865_100066991 3300006881 Bacteria 2535
128 Ga0075436_100184282 3300006914 Bacteria 1476
129 Ga0097620_100004236 3300006931 Bacteria 14649
130 Ga0097620_100011759 3300006931 Bacteria 8793
131 Ga0097620_100169025 3300006931 Bacteria 2267
132 Ga0097620_100254923 3300006931 Bacteria 1845
133 Ga0075435_100290496 3300007076 Bacteria 1397
134 Ga0105245_10273924 3300009098 Bacteria 1647
135 Ga0114129_10121758 3300009147 Bacteria 3590
136 Ga0105241_10127781 3300009174 Bacteria 2054
137 Ga0105242_11060954 3300009176 Bacteria 822
138 Ga0105248_10002828 3300009177 Bacteria 19259
139 Ga0105238_10077879 3300009551 Bacteria 3306
140 Ga0105238_10345704 3300009551 Bacteria 1476
141 Ga0105249_10170672 3300009553 Bacteria 2109
142 Ga0105239_11298251 3300010375 Bacteria 839
143 Ga0105246_11510716 3300011119 Bacteria 631
144 Ga0157373_10024479 3300013100 Bacteria 4372
145 Ga0157373_10046132 3300013100 Bacteria 3110
146 Ga0157373_10048408 3300013100 Bacteria 3031
147 Ga0157373_10050333 3300013100 Unclassified 2967
148 Ga0157373_10065168 3300013100 Bacteria 2578
149 Ga0157373_10604853 3300013100 Bacteria 798
150 Ga0157373_10606720 3300013100 Bacteria 797
151 Ga0157371_10003298 3300013102 Bacteria 14771
152 Ga0157371_10011587 3300013102 Bacteria 6777
153 Ga0157371_10131550 3300013102 Bacteria 1780
154 Ga0157371_10402657 3300013102 Bacteria 1001
155 Ga0157371_10549978 3300013102 Bacteria 856
156 Ga0157370_10059811 3300013104 Bacteria 3620
157 Ga0157370_10238179 3300013104 Unclassified 1684
158 Ga0157370_10343126 3300013104 Unclassified 1377
159 Ga0157370_10451447 3300013104 Bacteria 1182
160 Ga0157370_10632652 3300013104 Bacteria 979
161 Ga0157369_10001005 3300013105 Bacteria 35591
162 Ga0157369_10011167 3300013105 Bacteria 10210
163 Ga0157369_10055391 3300013105 Bacteria 4281
164 Ga0157369_10220265 3300013105 Unclassified 1986
165 Ga0157369_10458966 3300013105 Bacteria 1319
166 Ga0157374_10003303 3300013296 Bacteria 13547
167 Ga0163162_10891669 3300013306 Bacteria 1003
168 Ga0157372_10082805 3300013307 Bacteria 3633
169 Ga0157372_10146444 3300013307 Bacteria 2723
170 Ga0157375_11688464 3300013308 Bacteria 750
171 Ga0163163_11894139 3300014325 Bacteria 656
172 Ga0157380_10454036 3300014326 Bacteria 1232
173 Ga0157379_10049042 3300014968 Bacteria 3770
174 Ga0157379_11529753 3300014968 Bacteria 650
175 Ga0206353_10864735 3300020082 Bacteria 582
176 Ga0213873_10000008 3300021358 Bacteria 263363
177 Ga0213876_10000005 3300021384 Bacteria 727326
178 Ga0207682_10031128 3300025893 Bacteria 2140
179 Ga0207688_10165793 3300025901 Bacteria 1311
180 Ga0207680_10001713 3300025903 Bacteria 10337
181 Ga0207680_10578646 3300025903 Bacteria 802
182 Ga0207647_10013837 3300025904 Bacteria 5587
183 Ga0207645_10003797 3300025907 Bacteria 11337
184 Ga0207645_10127139 3300025907 Bacteria 1657
185 Ga0207645_10846131 3300025907 Bacteria 622
186 Ga0207705_10000059 3300025909 Bacteria 155683
187 Ga0207705_10001546 3300025909 Bacteria 18269
188 Ga0207705_10046913 3300025909 Bacteria 3106
189 Ga0207705_10050362 3300025909 Bacteria 2998
190 Ga0207705_10076353 3300025909 Bacteria 2435
191 Ga0207705_10104543 3300025909 Bacteria 2086
192 Ga0207705_10112347 3300025909 Bacteria 2014
193 Ga0207705_10142559 3300025909 Bacteria 1790
194 Ga0207705_10454050 3300025909 Bacteria 994
195 Ga0207654_10122849 3300025911 Bacteria 1633
196 Ga0207707_10092181 3300025912 Bacteria 2648
197 Ga0207695_10005105 3300025913 Bacteria 17584
198 Ga0207663_11057176 3300025916 Unclassified 652
199 Ga0207660_10000078 3300025917 Bacteria 51142
200 Ga0207660_10601672 3300025917 Bacteria 895
201 Ga0207657_10006524 3300025919 Bacteria 12087
202 Ga0207657_10006637 3300025919 Bacteria 11976
203 Ga0207657_10010524 3300025919 Bacteria 9224
204 Ga0207657_10011074 3300025919 Bacteria 8963
205 Ga0207657_10198981 3300025919 Bacteria 1613
206 Ga0207657_10199300 3300025919 Bacteria 1611
207 Ga0207657_11135061 3300025919 Bacteria 596
208 Ga0207649_10000011 3300025920 Bacteria 266219
209 Ga0207649_10003090 3300025920 Bacteria 9137
210 Ga0207649_10104395 3300025920 Bacteria 1882
211 Ga0207649_10130584 3300025920 Bacteria 1706
212 Ga0207649_10223571 3300025920 Bacteria 1342
213 Ga0207649_10231620 3300025920 Bacteria 1321
214 Ga0207649_10267240 3300025920 Unclassified 1238
215 Ga0207649_10280827 3300025920 Bacteria 1211
216 Ga0207652_10000004 3300025921 Bacteria 436303
217 Ga0207652_10681985 3300025921 Bacteria 918
218 Ga0207652_10831193 3300025921 Bacteria 819
219 Ga0207694_10093958 3300025924 Bacteria 2369
220 Ga0207694_10155170 3300025924 Bacteria 1846
221 Ga0207650_10019263 3300025925 Bacteria 4792
222 Ga0207650_10194020 3300025925 Bacteria 1624
223 Ga0207650_10410278 3300025925 Unclassified 1122
224 Ga0207687_10171614 3300025927 Bacteria 1673
225 Ga0207700_11339971 3300025928 Bacteria 637
226 Ga0207664_10170597 3300025929 Bacteria 1862
227 Ga0207644_10000032 3300025931 Bacteria 133759
228 Ga0207644_10006064 3300025931 Bacteria 7884
229 Ga0207644_11324810 3300025931 Bacteria 605
230 Ga0207690_10013465 3300025932 Bacteria 4915
231 Ga0207690_10057730 3300025932 Bacteria 2623
232 Ga0207690_10080664 3300025932 Bacteria 2271
233 Ga0207690_10331472 3300025932 Bacteria 1199
234 Ga0207690_11739296 3300025932 Bacteria 521
235 Ga0207706_10000906 3300025933 Bacteria 30490
236 Ga0207706_10012364 3300025933 Bacteria 7777
237 Ga0207706_10053884 3300025933 Bacteria 3551
238 Ga0207706_10553531 3300025933 Bacteria 990
239 Ga0207706_10822805 3300025933 Bacteria 788
240 Ga0207670_10144166 3300025936 Bacteria 1759
241 Ga0207669_10110408 3300025937 Bacteria 1841
242 Ga0207704_10126636 3300025938 Bacteria 1760
243 Ga0207711_10002485 3300025941 Bacteria 16450
244 Ga0207711_10018994 3300025941 Bacteria 5718
245 Ga0207689_10128580 3300025942 Bacteria 2084
246 Ga0207679_10010707 3300025945 Bacteria 5914
247 Ga0207679_10569854 3300025945 Bacteria 1018
248 Ga0207679_10644038 3300025945 Bacteria 958
249 Ga0207667_10010674 3300025949 Bacteria 10720
250 Ga0207667_10298892 3300025949 Bacteria 1645
251 Ga0207667_10432021 3300025949 Bacteria 1339
252 Ga0207667_10462051 3300025949 Bacteria 1289
253 Ga0207651_10007655 3300025960 Bacteria 5766
254 Ga0207651_10678957 3300025960 Bacteria 906
255 Ga0207712_10409455 3300025961 Bacteria 1142
256 Ga0207668_10000034 3300025972 Bacteria 119274
257 Ga0207640_10014481 3300025981 Bacteria 4543
258 Ga0207640_10022818 3300025981 Bacteria 3753
259 Ga0207640_10134737 3300025981 Unclassified 1791
260 Ga0207658_10010369 3300025986 Bacteria 6330
261 Ga0207658_10037873 3300025986 Bacteria 3469
262 Ga0207677_10001583 3300026023 Bacteria 12062
263 Ga0207703_10002020 3300026035 Bacteria 17906
264 Ga0207703_10707522 3300026035 Bacteria 958
265 Ga0207639_10046821 3300026041 Bacteria 3265
266 Ga0207639_10221480 3300026041 Bacteria 1634
267 Ga0207639_11016156 3300026041 Bacteria 777
268 Ga0207678_10006277 3300026067 Bacteria 10557
269 Ga0207678_10008333 3300026067 Bacteria 9137
270 Ga0207678_10010853 3300026067 Bacteria 8006
271 Ga0207678_10086522 3300026067 Bacteria 2679
272 Ga0207678_10420587 3300026067 Bacteria 1159
273 Ga0207702_10006795 3300026078 Bacteria 9810
274 Ga0207702_10138751 3300026078 Bacteria 2197
275 Ga0207641_10000031 3300026088 Bacteria 224320
276 Ga0207641_10034150 3300026088 Bacteria 4229
277 Ga0207641_10838621 3300026088 Bacteria 911
278 Ga0207648_10293937 3300026089 Bacteria 1455
279 Ga0207676_10256491 3300026095 Bacteria 1576
280 Ga0207674_10003401 3300026116 Bacteria 19514
281 Ga0207674_10033906 3300026116 Bacteria 5341
282 Ga0207675_100288165 3300026118 Bacteria 1597
283 Ga0207683_11028407 3300026121 Unclassified 765
284 Ga0207698_10002542 3300026142 Bacteria 10828
285 Ga0207698_10096169 3300026142 Bacteria 2440
286 Ga0207698_10840200 3300026142 Bacteria 923
287 Ga0207698_11178151 3300026142 Bacteria 780
288 Ga0210002_1027052 3300027617 Bacteria 944
289 Ga0209974_10218845 3300027876 Bacteria 708
290 Ga0268266_10059330 3300028379 Bacteria 3296
291 Ga0268266_10089219 3300028379 Bacteria 2699
292 Ga0268265_10056797 3300028380 Bacteria 2980
293 Ga0268265_10408270 3300028380 Bacteria 1257
294 Ga0268264_10004290 3300028381 Bacteria 12168
295 Ga0268264_11253970 3300028381 Bacteria 751
296 Ga0307408_100016777 3300031548 Bacteria 4895
297 Ga0307408_100805196 3300031548 Bacteria 853
298 Ga0307408_101964235 3300031548 Bacteria 562
299 Ga0307405_10082299 3300031731 Bacteria 2106
300 Ga0307405_10723513 3300031731 Bacteria 827
301 Ga0307405_11186882 3300031731 Bacteria 659
302 Ga0307410_10092218 3300031852 Bacteria 2153
303 Ga0307410_10115932 3300031852 Bacteria 1945
304 Ga0307410_10383482 3300031852 Bacteria 1131
305 Ga0307410_10408533 3300031852 Bacteria 1098
306 Ga0307406_10028319 3300031901 Bacteria 3384
307 Ga0307406_11019658 3300031901 Bacteria 711
308 Ga0307407_10111366 3300031903 Bacteria 1719
309 Ga0307412_10260941 3300031911 Bacteria 1350
310 Ga0307409_100044421 3300031995 Bacteria 3347
311 Ga0307409_102278665 3300031995 Bacteria 571
312 Ga0307409_102788222 3300031995 Bacteria 516
313 Ga0307416_100018355 3300032002 Bacteria 4925
314 Ga0307416_100706700 3300032002 Bacteria 1097
315 Ga0307414_10007303 3300032004 Bacteria 6207
316 Ga0307414_10032779 3300032004 Bacteria 3425
317 Ga0307414_10413488 3300032004 Bacteria 1174
318 Ga0307414_10472540 3300032004 Bacteria 1104
319 Ga0307411_10017474 3300032005 Bacteria 4088
320 Ga0307411_10166948 3300032005 Bacteria 1655
321 Ga0307415_100223340 3300032126 Bacteria 1511
322 Ga0307415_100276466 3300032126 Bacteria 1378
323 Ga0307415_100466442 3300032126 Bacteria 1096
324 Ga0373940_0008470 3300035088 Bacteria 2361
325 Ga0373943_0720191 3300035170 Bacteria 592
326 Ga0373935_0008238 3300035692 Bacteria 6240
327 Ga0395899_0042769 3300037312 Bacteria 3381
328 Ga0395899_0135408 3300037312 Unclassified 1756
329 Ga0395899_0175264 3300037312 Unclassified 1508
330 Ga0395899_0189640 3300037312 Bacteria 1439
331 Ga0395899_0279429 3300037312 Bacteria 1136
332 Ga0395899_0606103 3300037312 Bacteria 697
333 Ga0395900_0028450 3300037418 Bacteria 5724
334 Ga0395900_0055890 3300037418 Bacteria 4064
335 Ga0395900_0152700 3300037418 Bacteria 2359
336 Ga0395900_0202503 3300037418 Unclassified 2007
337 Ga0395900_0308227 3300037418 Unclassified 1567
338 Ga0395900_0483555 3300037418 Bacteria 1190
339 Ga0395900_0511869 3300037418 Bacteria 1149
340 Ga0395900_0641301 3300037418 Unclassified 999
341 Ga0395900_0668215 3300037418 Bacteria 974
342 Ga0395900_1562887 3300037418 Bacteria 571
343 Ga0395898_0024193 3300037466 Bacteria 6127
344 Ga0395898_0290899 3300037466 Bacteria 1558
345 Ga0395898_0339968 3300037466 Bacteria 1431
346 Ga0395898_0499181 3300037466 Bacteria 1157
347 Ga0395898_0534895 3300037466 Bacteria 1114
348 Ga0395898_1062231 3300037466 Unclassified 744
349 Ga0395898_1074798 3300037466 Unclassified 739
350 Ga0395905_0000618 3300037471 Bacteria 47635
351 Ga0395905_0001667 3300037471 Bacteria 26190
352 Ga0395905_0221446 3300037471 Bacteria 1771
353 Ga0395905_0269256 3300037471 Unclassified 1589
354 Ga0395905_0277670 3300037471 Bacteria 1561
355 Ga0395905_0294723 3300037471 Bacteria 1509
356 Ga0395905_0750132 3300037471 Bacteria 878
357 Ga0395905_1114497 3300037471 Bacteria 692
358 Ga0395905_1127996 3300037471 Bacteria 687
359 Ga0395901_0141668 3300038443 Bacteria 2527
360 Ga0395901_0168006 3300038443 Unclassified 2302
361 Ga0395901_0202192 3300038443 Bacteria 2082
362 Ga0395901_0211034 3300038443 Unclassified 2032
363 Ga0395901_0326630 3300038443 Bacteria 1587
364 Ga0395901_0416916 3300038443 Unclassified 1377
365 Ga0395901_0486525 3300038443 Unclassified 1258
366 Ga0395901_0515610 3300038443 Bacteria 1215
367 Ga0395901_0873061 3300038443 Bacteria 883
368 Ga0395901_0975285 3300038443 Bacteria 825
369 Ga0436365_1858586 3300039437 Bacteria 166193
370 Ga0436362_0193924 3300039453 Bacteria 38478
371 Ga0439432_037595 3300042006 Bacteria 1544
372 Ga0450914_044889 3300042118 Bacteria 569
373 Ga0450892_016303 3300042130 Bacteria 699
374 Ga0450889_001049 3300042144 Bacteria 2911
375 Ga0439464_0000308 3300042439 Bacteria 9312
376 Ga0466969_0006491 3300044656 Bacteria 6224
377 Ga0466972_0170501 3300044658 Bacteria 1022
378 Ga0466965_0600832 3300044683 Bacteria 625
379 Ga0466966_0000003 3300044684 Bacteria 233677
380 Ga0466966_0006119 3300044684 Bacteria 7951
381 Ga0466961_0078600 3300044693 Bacteria 2089
382 Ga0466961_0506327 3300044693 Bacteria 729
383 Ga0466963_0005408 3300044694 Bacteria 7478
384 Ga0466963_0055991 3300044694 Bacteria 2623
385 Ga0466963_0440158 3300044694 Unclassified 919
386 Ga0466963_0776993 3300044694 Bacteria 676
387 Ga0466964_0785215 3300044706 Unclassified 537
388 Ga0466971_0004179 3300044719 Bacteria 6221
389 Ga0466970_0010052 3300044765 Unclassified 4793
390 Ga0466970_0112284 3300044765 Bacteria 1489
391 Ga0466957_0227642 3300044842 Bacteria 1233
392 Ga0466959_0051065 3300045049 Unclassified 3034
393 Ga0466958_0053063 3300045836 Unclassified 2458
394 Ga0466958_0150935 3300045836 Bacteria 1466
395 Ga0466967_0295518 3300045976 Unclassified 1557
396 Ga0466967_0565269 3300045976 Bacteria 1120
397 Ga0495663_0107152 3300046525 Bacteria 925
398 Ga0495669_0330137 3300046684 Bacteria 736
399 Ga0495685_204280 3300047447 Bacteria 633
400 Ga0496105_0007086 3300048908 Bacteria 8642
401 Ga0496106_0301061 3300048909 Bacteria 1286
402 Ga0496107_0106449 3300048910 Bacteria 2060
403 Ga0496107_0166796 3300048910 Unclassified 1633
404 Ga0496111_0051750 3300048914 Bacteria 2965
405 Ga0496112_1523243 3300048915 Bacteria 582
406 Ga0501047_0350905 3300049581 Unclassified 1312
407 Ga0501071_0462708 3300049587 Bacteria 971
408 Ga0501074_0409995 3300049590 Bacteria 961
409 Ga0501199_020660 3300049650 Bacteria 763
410 Ga0501224_014345 3300049664 Bacteria 1172
411 Ga0501247_002363 3300049677 Bacteria 1956
412 Ga0501270_024694 3300049767 Bacteria 946
413 Ga0501035_0158316 3300049822 Bacteria 1962
414 Ga0501044_0546267 3300049823 Bacteria 1056
415 nmdc:mga0qj67_104668_c1 3300050509 Bacteria 2283
416 nmdc:mga08x19_56458_c1 3300050514 Bacteria 2534
417 Ga0500643_099695 3300053087 Bacteria 788
418 Ga0500618_007954 3300053125 Bacteria 2994
419 Ga0500590_000931 3300053148 Bacteria 11186
420 Ga0501084_1100966 3300054114 Bacteria 667
421 Ga0590071_065954 3300059421 Bacteria 889
422 Ga0466962_0001241 3300061719 Bacteria 11750
423 Ga0395900_0738890
424 JGI24736J21556_1001496
425 JGI24741J21665_1035991
426 JGI24740J21852_10018180
427 JGI24737J22298_10174886
428 JGI24748J21848_1004611
429 JGI24034J26672_10012970
430 JGI25406J46586_10153531
431 rootH1_10149825
432 rootH1_10170626
433 rootH1_10276381
434 Ga0070658_10042832
435 Ga0070658_10063621
436 Ga0070658_10102938
437 Ga0070658_10122786
438 Ga0070676_10070364
439 Ga0070676_10072548
440 Ga0070676_10483965
441 Ga0070670_100021676
442 Ga0070670_100139586
443 Ga0070670_101358433
444 Ga0070677_10022784
445 Ga0068869_100337571
446 Ga0070680_100000088
447 Ga0070682_101152199
448 Ga0068868_100001171
449 Ga0068868_100809112
450 Ga0070660_100002771
451 Ga0070660_100028481
452 Ga0070660_100047439
453 Ga0070660_100069782
454 Ga0070660_100354681
455 Ga0070660_100378322
456 Ga0070660_100553840
457 Ga0070689_100060636
458 Ga0070661_100000001
459 Ga0070661_100002768
460 Ga0070661_100036464
461 Ga0070661_100057888
462 Ga0070661_100250056
463 Ga0070661_100385221
464 Ga0070692_10868714
465 Ga0070668_100000011
466 Ga0070669_100247353
467 Ga0070671_100000707
468 Ga0070671_100017804
469 Ga0070674_100030958
470 Ga0070673_100012848
471 Ga0070673_101066923
472 Ga0070688_100333489
473 Ga0070659_100001332
474 Ga0070659_100021490
475 Ga0070659_100029693
476 Ga0070659_100032957
477 Ga0070659_100376077
478 Ga0070659_101377430
479 Ga0070667_100004890
480 Ga0070667_100018164
481 Ga0070714_101602337
482 Ga0070713_100077858
483 Ga0070700_101171946
484 Ga0070700_102020048
485 Ga0070694_100060168
486 Ga0070708_100091409
487 Ga0070663_100001444
488 Ga0070663_100010253
489 Ga0070663_100065406
490 Ga0070663_100129594
491 Ga0070663_100274969
492 Ga0070662_100014606
493 Ga0070662_100017196
494 Ga0070662_100080236
495 Ga0070706_102021536
496 Ga0070698_101728625
497 Ga0070699_100001110
498 Ga0070679_100000003
499 Ga0070679_100036143
500 Ga0070697_100045762
501 Ga0070697_100269915
502 Ga0068853_100050043
503 Ga0068853_100273762
504 Ga0070686_100032636
505 Ga0070695_100091291
506 Ga0070696_100040242
507 Ga0070693_100022700
508 Ga0070693_100378144
509 Ga0070665_100072974
510 Ga0070665_100073769
511 Ga0070704_102234917
512 Ga0068855_100343663
513 Ga0068855_100786166
514 Ga0070664_100009806
515 Ga0070664_100019302
516 Ga0070664_100164923
517 Ga0068857_100012590
518 Ga0068857_100072094
519 Ga0068857_100343959
520 Ga0068857_100716799
521 Ga0068854_100015640
522 Ga0068854_100021473
523 Ga0068854_100039898
524 Ga0068856_100896964
525 Ga0068852_100003209
526 Ga0068852_100035850
527 Ga0068852_100132761
528 Ga0068859_100004236
529 Ga0068859_100011759
530 Ga0068859_100169015
531 Ga0068859_100254915
532 Ga0068864_100039914
533 Ga0068866_10117601
534 Ga0068861_101489240
535 Ga0068851_10243556
536 Ga0068851_10707661
537 Ga0068863_100000186
538 Ga0068858_100000698
539 Ga0068858_100009576
540 Ga0068860_100026522
541 Ga0068860_100122679
542 Ga0068862_100028111
543 Ga0068862_100232421
544 Ga0068862_100555508
545 Ga0081539_10021054
546 Ga0075363_100000143
547 Ga0075430_100396131
548 Ga0075434_100852908
549 Ga0068865_100066991
550 Ga0075436_100184282
551 Ga0097620_100004236
552 Ga0097620_100011759
553 Ga0097620_100169025
554 Ga0097620_100254923
555 Ga0075435_100290496
556 Ga0105245_10273924
557 Ga0114129_10121758
558 Ga0105241_10127781
559 Ga0105242_11060954
560 Ga0105248_10002828
561 Ga0105238_10077879
562 Ga0105238_10345704
563 Ga0105249_10170672
564 Ga0105239_11298251
565 Ga0105246_11510716
566 Ga0157373_10024479
567 Ga0157373_10046132
568 Ga0157373_10048408
569 Ga0157373_10050333
570 Ga0157373_10065168
571 Ga0157373_10604853
572 Ga0157373_10606720
573 Ga0157371_10003298
574 Ga0157371_10011587
575 Ga0157371_10131550
576 Ga0157371_10402657
577 Ga0157371_10549978
578 Ga0157370_10059811
579 Ga0157370_10238179
580 Ga0157370_10343126
581 Ga0157370_10451447
582 Ga0157370_10632652
583 Ga0157369_10001005
584 Ga0157369_10011167
585 Ga0157369_10055391
586 Ga0157369_10220265
587 Ga0157369_10458966
588 Ga0157374_10003303
589 Ga0163162_10891669
590 Ga0157372_10082805
591 Ga0157372_10146444
592 Ga0157375_11688464
593 Ga0163163_11894139
594 Ga0157380_10454036
595 Ga0157379_10049042
596 Ga0157379_11529753
597 Ga0206353_10864735
598 Ga0213873_10000008
599 Ga0213876_10000005
600 Ga0207682_10031128
601 Ga0207688_10165793
602 Ga0207680_10001713
603 Ga0207680_10578646
604 Ga0207647_10013837
605 Ga0207645_10003797
606 Ga0207645_10127139
607 Ga0207645_10846131
608 Ga0207705_10000059
609 Ga0207705_10001546
610 Ga0207705_10046913
611 Ga0207705_10050362
612 Ga0207705_10076353
613 Ga0207705_10104543
614 Ga0207705_10112347
615 Ga0207705_10142559
616 Ga0207705_10454050
617 Ga0207654_10122849
618 Ga0207707_10092181
619 Ga0207695_10005105
620 Ga0207663_11057176
621 Ga0207660_10000078
622 Ga0207660_10601672
623 Ga0207657_10006524
624 Ga0207657_10006637
625 Ga0207657_10010524
626 Ga0207657_10011074
627 Ga0207657_10198981
628 Ga0207657_10199300
629 Ga0207657_11135061
630 Ga0207649_10000011
631 Ga0207649_10003090
632 Ga0207649_10104395
633 Ga0207649_10130584
634 Ga0207649_10223571
635 Ga0207649_10231620
636 Ga0207649_10267240
637 Ga0207649_10280827
638 Ga0207652_10000004
639 Ga0207652_10681985
640 Ga0207652_10831193
641 Ga0207694_10093958
642 Ga0207694_10155170
643 Ga0207650_10019263
644 Ga0207650_10194020
645 Ga0207650_10410278
646 Ga0207687_10171614
647 Ga0207700_11339971
648 Ga0207664_10170597
649 Ga0207644_10000032
650 Ga0207644_10006064
651 Ga0207644_11324810
652 Ga0207690_10013465
653 Ga0207690_10057730
654 Ga0207690_10080664
655 Ga0207690_10331472
656 Ga0207690_11739296
657 Ga0207706_10000906
658 Ga0207706_10012364
659 Ga0207706_10053884
660 Ga0207706_10553531
661 Ga0207706_10822805
662 Ga0207670_10144166
663 Ga0207669_10110408
664 Ga0207704_10126636
665 Ga0207711_10002485
666 Ga0207711_10018994
667 Ga0207689_10128580
668 Ga0207679_10010707
669 Ga0207679_10569854
670 Ga0207679_10644038
671 Ga0207667_10010674
672 Ga0207667_10298892
673 Ga0207667_10432021
674 Ga0207667_10462051
675 Ga0207651_10007655
676 Ga0207651_10678957
677 Ga0207712_10409455
678 Ga0207668_10000034
679 Ga0207640_10014481
680 Ga0207640_10022818
681 Ga0207640_10134737
682 Ga0207658_10010369
683 Ga0207658_10037873
684 Ga0207677_10001583
685 Ga0207703_10002020
686 Ga0207703_10707522
687 Ga0207639_10046821
688 Ga0207639_10221480
689 Ga0207639_11016156
690 Ga0207678_10006277
691 Ga0207678_10008333
692 Ga0207678_10010853
693 Ga0207678_10086522
694 Ga0207678_10420587
695 Ga0207702_10006795
696 Ga0207702_10138751
697 Ga0207641_10000031
698 Ga0207641_10034150
699 Ga0207641_10838621
700 Ga0207648_10293937
701 Ga0207676_10256491
702 Ga0207674_10003401
703 Ga0207674_10033906
704 Ga0207675_100288165
705 Ga0207683_11028407
706 Ga0207698_10002542
707 Ga0207698_10096169
708 Ga0207698_10840200
709 Ga0207698_11178151
710 Ga0210002_1027052
711 Ga0209974_10218845
712 Ga0268266_10059330
713 Ga0268266_10089219
714 Ga0268265_10056797
715 Ga0268265_10408270
716 Ga0268264_10004290
717 Ga0268264_11253970
718 Ga0307408_100016777
719 Ga0307408_100805196
720 Ga0307408_101964235
721 Ga0307405_10082299
722 Ga0307405_10723513
723 Ga0307405_11186882
724 Ga0307410_10092218
725 Ga0307410_10115932
726 Ga0307410_10383482
727 Ga0307410_10408533
728 Ga0307406_10028319
729 Ga0307406_11019658
730 Ga0307407_10111366
731 Ga0307412_10260941
732 Ga0307409_100044421
733 Ga0307409_102278665
734 Ga0307409_102788222
735 Ga0307416_100018355
736 Ga0307416_100706700
737 Ga0307414_10007303
738 Ga0307414_10032779
739 Ga0307414_10413488
740 Ga0307414_10472540
741 Ga0307411_10017474
742 Ga0307411_10166948
743 Ga0307415_100223340
744 Ga0307415_100276466
745 Ga0307415_100466442
746 Ga0373940_0008470
747 Ga0373943_0720191
748 Ga0373935_0008238
749 Ga0395899_0042769
750 Ga0395899_0135408
751 Ga0395899_0175264
752 Ga0395899_0189640
753 Ga0395899_0279429
754 Ga0395899_0606103
755 Ga0395900_0028450
756 Ga0395900_0055890
757 Ga0395900_0152700
758 Ga0395900_0202503
759 Ga0395900_0308227
760 Ga0395900_0483555
761 Ga0395900_0511869
762 Ga0395900_0641301
763 Ga0395900_0668215
764 Ga0395900_1562887
765 Ga0395898_0024193
766 Ga0395898_0290899
767 Ga0395898_0339968
768 Ga0395898_0499181
769 Ga0395898_0534895
770 Ga0395898_1062231
771 Ga0395898_1074798
772 Ga0395905_0000618
773 Ga0395905_0001667
774 Ga0395905_0221446
775 Ga0395905_0269256
776 Ga0395905_0277670
777 Ga0395905_0294723
778 Ga0395905_0750132
779 Ga0395905_1114497
780 Ga0395905_1127996
781 Ga0395901_0141668
782 Ga0395901_0168006
783 Ga0395901_0202192
784 Ga0395901_0211034
785 Ga0395901_0326630
786 Ga0395901_0416916
787 Ga0395901_0486525
788 Ga0395901_0515610
789 Ga0395901_0873061
790 Ga0395901_0975285
791 Ga0436365_1858586
792 Ga0436362_0193924
793 Ga0439432_037595
794 Ga0450914_044889
795 Ga0450892_016303
796 Ga0450889_001049
797 Ga0439464_0000308
798 Ga0466969_0006491
799 Ga0466972_0170501
800 Ga0466965_0600832
801 Ga0466966_0000003
802 Ga0466966_0006119
803 Ga0466961_0078600
804 Ga0466961_0506327
805 Ga0466963_0005408
806 Ga0466963_0055991
807 Ga0466963_0440158
808 Ga0466963_0776993
809 Ga0466964_0785215
810 Ga0466971_0004179
811 Ga0466970_0010052
812 Ga0466970_0112284
813 Ga0466957_0227642
814 Ga0466959_0051065
815 Ga0466958_0053063
816 Ga0466958_0150935
817 Ga0466967_0295518
818 Ga0466967_0565269
819 Ga0495663_0107152
820 Ga0495669_0330137
821 Ga0495685_204280
822 Ga0496105_0007086
823 Ga0496106_0301061
824 Ga0496107_0106449
825 Ga0496107_0166796
826 Ga0496111_0051750
827 Ga0496112_1523243
828 Ga0501047_0350905
829 Ga0501071_0462708
830 Ga0501074_0409995
831 Ga0501199_020660
832 Ga0501224_014345
833 Ga0501247_002363
834 Ga0501270_024694
835 Ga0501035_0158316
836 Ga0501044_0546267
837 nmdc:mga0qj67_104668_c1
838 nmdc:mga08x19_56458_c1
839 Ga0500643_099695
840 Ga0500618_007954
841 Ga0500590_000931
842 Ga0501084_1100966
843 Ga0590071_065954
844 Ga0466962_0001241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

27

155

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9802 1 131
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9656 1 131
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9616 1 131
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.953 1 131
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9475 2 132
ID Description Score Start End Superfamily
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.96 1 131 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9588 3 67 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9497 2 131 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9458 1 131 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9286 2 131 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A2V6EM40-F1-model_v4 EVE domain-containing protein 1.002 2 68
AF-A0A1M5N861-F1-model_v4 Predicted RNA-binding protein, contains PUA-like domain 1 1 132
AF-A0A2S6TIU4-F1-model_v4 EVE domain-containing protein 0.9987 1 67
AF-A0A3D4TA91-F1-model_v4 EVE domain-containing protein 0.9987 1 63
AF-C0GCV9-F1-model_v4 EVE domain-containing protein 0.9984 1 131

Map