F440332

General Info

Members Datasets Scaffolds Average Seq Length
422 260 324 429

Family's Representative Sequence

Representative Sequence 3300038741|Ga0400488_12157|Ga0400488_12157_1852_3141
Length 417
Sequence MNILVIGGGGREHALAWKAAQSPLADTVYVAPGNAGTALEPKLENVAIGVEDIDALITFAKENNVGLTIVGPEAPLVIGVVDAFAKAGLNCFGPSQGAAQLEGSKSFTKDFLARHNIPTAEYQTFTDESAALAYLREQGAPIVVKADGLAAGKGVIVAMDLETAEAAVKDMLSGNAFGEAGHRVVIEEFLDGEEASFIVMADGEHVLPMATSQDHKRAGDGDTGLNTGGMGAYSPAPVVTDAIYQRIMDEVILPTVAGMASEMIMADGTPKVIEYNCRFGDPETQPIMLRMQSDLVAHCLAAMDGKLNQETAQWDPRASLGVVLAAGGYPGSYSKGAVISGLPQGEEQGQKVFHAGTEEKEGEVVTSGGRVLCATALGDSVSEAQQRAYELTKRIHWDGVYYRSDIGYRAVARELGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132181 Kosakonia sacchari SP1 Isolate Stem
3 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
4 2561511199 Enterobacter sp. R4-368 Isolate Nodule
5 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
6 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
7 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
8 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
9 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
10 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
11 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
12 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
13 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
14 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
15 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
16 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
17 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
18 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
19 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
20 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
21 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
22 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
23 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
24 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
25 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
26 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
27 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
28 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
29 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
30 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
31 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
32 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
33 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
34 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
35 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
36 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
37 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
38 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
39 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
40 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
41 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
42 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
43 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
44 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
45 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
46 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
47 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
48 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
49 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
50 2636415599 Klebsiella variicola DX120E Isolate Unclassified
51 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
52 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
53 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
54 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
55 2751185917 Enterobacter sp. HK169 Isolate Unclassified
56 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
57 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
58 2775507074 Klebsiella sp. D5A Isolate Unclassified
59 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
60 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
61 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
62 2821118458 Enterobacter asburiae 609 Isolate Unclassified
63 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
64 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
65 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
66 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
67 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
68 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
69 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
70 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
71 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
72 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
73 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
74 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
75 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
76 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
77 2937539931 Pantoea sp. LS15 Isolate Unclassified
78 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
79 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
80 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
81 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
82 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
83 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
84 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
85 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
86 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
87 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
88 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
89 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
90 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
91 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
92 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
93 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
101 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
146 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
147 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
148 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
189 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
190 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
191 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
204 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
205 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
206 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
207 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
208 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
209 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
210 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
211 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
212 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
252 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
253 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
254 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
255 8018221730 Enterobacter sp. CM29 Isolate Unclassified
256 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
257 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
258 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
259 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
260 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.93
Metatranscriptomes 2.84
Isolates 23.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 0.71
Nodule 2.84
Rhizoplane 13.74
Rhizosphere 60.43
Stem 0.24
Stem Tuber 0.24
Unclassified 21.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1822283 2162886007 Bacteria 3686
2 rootH2_10105015 3300003320 Bacteria 6208
3 Ga0058692_1006996 3300003856 Bacteria 3035
4 Ga0058692_1010826 3300003856 Bacteria 2238
5 Ga0065704_10003514 3300005289 Bacteria 4017
6 Ga0065704_10118575 3300005289 Bacteria 1814
7 Ga0070670_100000019 3300005331 Bacteria 215812
8 Ga0070670_100038360 3300005331 Bacteria 4120
9 Ga0070666_10001235 3300005335 Bacteria 15452
10 Ga0070666_10049606 3300005335 Bacteria 2821
11 Ga0070687_100025709 3300005343 Bacteria 2828
12 Ga0070661_100065404 3300005344 Bacteria 2672
13 Ga0070671_100009341 3300005355 Bacteria 7874
14 Ga0070673_100033402 3300005364 Bacteria 3885
15 Ga0070667_100000020 3300005367 Bacteria 215812
16 Ga0070667_100000243 3300005367 Bacteria 61793
17 Ga0070667_100006470 3300005367 Bacteria 9741
18 Ga0070701_10057376 3300005438 Bacteria 2041
19 Ga0070711_100015522 3300005439 Bacteria 4822
20 Ga0070663_100000262 3300005455 Bacteria 26428
21 Ga0070684_100018023 3300005535 Bacteria 5806
22 Ga0068853_100002328 3300005539 Bacteria 14211
23 Ga0070686_100013393 3300005544 Bacteria 4695
24 Ga0070693_100031180 3300005547 Bacteria 2920
25 Ga0070665_100010147 3300005548 Bacteria 9524
26 Ga0070665_100053006 3300005548 Bacteria 4068
27 Ga0070704_100006827 3300005549 Bacteria 6759
28 Ga0070664_100115997 3300005564 Bacteria 2341
29 Ga0068857_100000461 3300005577 Bacteria 28989
30 Ga0068852_100094264 3300005616 Bacteria 2685
31 Ga0068859_100014316 3300005617 Bacteria 7958
32 Ga0068864_100000030 3300005618 Bacteria 215812
33 Ga0068864_100078672 3300005618 Bacteria 2886
34 Ga0068864_100103753 3300005618 Bacteria 2525
35 Ga0068858_100021443 3300005842 Bacteria 6036
36 Ga0068862_100012920 3300005844 Bacteria 6908
37 Ga0075364_10022477 3300006051 Bacteria 3983
38 Ga0097621_100012529 3300006237 Bacteria 6291
39 Ga0075428_100059188 3300006844 Bacteria 4195
40 Ga0075430_100015755 3300006846 Bacteria 6438
41 Ga0075429_100003299 3300006880 Bacteria 13738
42 Ga0097620_100014316 3300006931 Bacteria 7958
43 Ga0079104_1000943 3300006946 Bacteria 23103
44 Ga0079104_1006804 3300006946 Bacteria 4243
45 Ga0079104_1008008 3300006946 Bacteria 3754
46 Ga0079104_1008318 3300006946 Bacteria 3645
47 Ga0079104_1009605 3300006946 Bacteria 3263
48 Ga0105251_10014348 3300009011 Bacteria 4387
49 Ga0105251_10015840 3300009011 Bacteria 4101
50 Ga0105251_10017988 3300009011 Bacteria 3772
51 Ga0105251_10037384 3300009011 Bacteria 2383
52 Ga0105251_10037509 3300009011 Bacteria 2378
53 Ga0105244_10001136 3300009036 Bacteria 22077
54 Ga0105244_10009121 3300009036 Bacteria 6124
55 Ga0105244_10016406 3300009036 Bacteria 4219
56 Ga0105244_10050074 3300009036 Bacteria 2131
57 Ga0105244_10050495 3300009036 Bacteria 2121
58 Ga0105250_10000725 3300009092 Bacteria 20132
59 Ga0105250_10009240 3300009092 Bacteria 4156
60 Ga0105250_10021605 3300009092 Bacteria 2597
61 Ga0105250_10024991 3300009092 Bacteria 2407
62 Ga0111539_10017599 3300009094 Bacteria 8846
63 Ga0105245_10015182 3300009098 Bacteria 6709
64 Ga0105247_10015505 3300009101 Bacteria 4564
65 Ga0105243_10013948 3300009148 Bacteria 6080
66 Ga0105243_10064060 3300009148 Bacteria 2948
67 Ga0105248_10000367 3300009177 Bacteria 52570
68 Ga0105248_10006684 3300009177 Bacteria 12655
69 Ga0105237_10000182 3300009545 Bacteria 89031
70 Ga0105238_10027128 3300009551 Bacteria 5838
71 Ga0105249_10012483 3300009553 Bacteria 7489
72 Ga0105249_10029487 3300009553 Bacteria 4955
73 Ga0105239_10136147 3300010375 Bacteria 2735
74 Ga0105246_10008029 3300011119 Bacteria 6477
75 Ga0157373_10028351 3300013100 Bacteria 4038
76 Ga0157371_10037882 3300013102 Bacteria 3450
77 Ga0157370_10005226 3300013104 Bacteria 14617
78 Ga0157370_10016113 3300013104 Bacteria 7577
79 Ga0163162_10060503 3300013306 Bacteria 3823
80 Ga0157375_10004470 3300013308 Bacteria 12146
81 Ga0163163_10000125 3300014325 Bacteria 80596
82 Ga0163163_10000876 3300014325 Bacteria 25650
83 Ga0157380_10144312 3300014326 Bacteria 2049
84 Ga0157376_10028548 3300014969 Bacteria 4435
85 Ga0183366_1010 3300015679 Bacteria 29263
86 Ga0183370_1010 3300015680 Bacteria 29263
87 Ga0183369_1025 3300015685 Bacteria 29263
88 Ga0183368_1013 3300015687 Bacteria 29263
89 Ga0213876_10000387 3300021384 Bacteria 36975
90 Ga0207696_1000512 3300025711 Bacteria 32191
91 Ga0207696_1000531 3300025711 Bacteria 31313
92 Ga0207655_1001092 3300025728 Bacteria 26682
93 Ga0207655_1009311 3300025728 Bacteria 6115
94 Ga0207655_1011506 3300025728 Bacteria 5260
95 Ga0207655_1015633 3300025728 Bacteria 4205
96 Ga0207655_1018314 3300025728 Bacteria 3722
97 Ga0207713_1001430 3300025735 Bacteria 19098
98 Ga0207713_1003631 3300025735 Bacteria 10387
99 Ga0207713_1008539 3300025735 Bacteria 5886
100 Ga0207713_1014406 3300025735 Bacteria 4113
101 Ga0207713_1014875 3300025735 Bacteria 4016
102 Ga0207713_1040502 3300025735 Bacteria 1955
103 Ga0207680_10005282 3300025903 Bacteria 6165
104 Ga0207695_10113387 3300025913 Bacteria 2687
105 Ga0207671_10002214 3300025914 Bacteria 21097
106 Ga0207663_10095058 3300025916 Bacteria 1987
107 Ga0207649_10132825 3300025920 Bacteria 1693
108 Ga0207694_10133254 3300025924 Bacteria 1993
109 Ga0207650_10000034 3300025925 Bacteria 215826
110 Ga0207650_10099632 3300025925 Bacteria 2234
111 Ga0207644_10043063 3300025931 Bacteria 3202
112 Ga0207709_10007478 3300025935 Bacteria 6079
113 Ga0207709_10013490 3300025935 Bacteria 4508
114 Ga0207709_10019457 3300025935 Bacteria 3819
115 Ga0207670_10034728 3300025936 Bacteria 3262
116 Ga0207670_10175781 3300025936 Bacteria 1609
117 Ga0207711_10002157 3300025941 Bacteria 17721
118 Ga0207711_10044513 3300025941 Bacteria 3789
119 Ga0207661_10129461 3300025944 Bacteria 2160
120 Ga0207712_10000443 3300025961 Bacteria 35195
121 Ga0207712_10184898 3300025961 Bacteria 1640
122 Ga0207658_10000015 3300025986 Bacteria 215826
123 Ga0207658_10000203 3300025986 Bacteria 61802
124 Ga0207677_10232580 3300026023 Bacteria 1486
125 Ga0207639_10008015 3300026041 Bacteria 7217
126 Ga0207678_10000947 3300026067 Bacteria 26485
127 Ga0207708_10006972 3300026075 Bacteria 8356
128 Ga0207641_10036531 3300026088 Bacteria 4101
129 Ga0207676_10000032 3300026095 Bacteria 215826
130 Ga0207676_10004867 3300026095 Bacteria 9508
131 Ga0207674_10001609 3300026116 Bacteria 29068
132 Ga0209281_1000810 3300027111 Bacteria 28512
133 Ga0209281_1000928 3300027111 Bacteria 24126
134 Ga0209281_1001108 3300027111 Bacteria 19578
135 Ga0209281_1005029 3300027111 Bacteria 3768
136 Ga0209281_1005217 3300027111 Bacteria 3659
137 Ga0209281_1005766 3300027111 Bacteria 3355
138 Ga0209371_1000680 3300027312 Bacteria 29361
139 Ga0209371_1000814 3300027312 Bacteria 25707
140 Ga0209371_1000879 3300027312 Bacteria 24061
141 Ga0209371_1007981 3300027312 Bacteria 3587
142 Ga0207428_10019778 3300027907 Bacteria 5735
143 Ga0268266_10017489 3300028379 Bacteria 6115
144 Ga0268266_10030432 3300028379 Bacteria 4586
145 Ga0268266_10096111 3300028379 Bacteria 2603
146 Ga0268265_10007743 3300028380 Bacteria 7251
147 Ga0268256_1000584 3300030500 Bacteria 29264
148 Ga0268256_1000715 3300030500 Bacteria 24647
149 Ga0268256_1003330 3300030500 Bacteria 7341
150 Ga0268256_1007969 3300030500 Bacteria 3687
151 Ga0268256_1013301 3300030500 Bacteria 2501
152 Ga0265327_10000764 3300031251 Bacteria 49808
153 Ga0265327_10001011 3300031251 Bacteria 39824
154 Ga0265327_10003698 3300031251 Bacteria 14279
155 Ga0265316_10000395 3300031344 Bacteria 49755
156 Ga0316575_10001211 3300031665 Bacteria 8170
157 Ga0316575_10004106 3300031665 Bacteria 5105
158 Ga0316579_10000214 3300031691 Bacteria 17404
159 Ga0316579_10000316 3300031691 Bacteria 14965
160 Ga0316579_10001278 3300031691 Bacteria 9066
161 Ga0316579_10060612 3300031691 Bacteria 1780
162 Ga0316576_10001907 3300031727 Bacteria 11607
163 Ga0316576_10001923 3300031727 Bacteria 11584
164 Ga0316576_10013091 3300031727 Bacteria 5502
165 Ga0316576_10041584 3300031727 Bacteria 3310
166 Ga0316576_10059962 3300031727 Bacteria 2786
167 Ga0316576_10072607 3300031727 Bacteria 2540
168 Ga0316578_10000441 3300031728 Bacteria 13732
169 Ga0316578_10001213 3300031728 Bacteria 10233
170 Ga0316578_10007602 3300031728 Bacteria 5449
171 Ga0316578_10017724 3300031728 Bacteria 3882
172 Ga0316578_10086897 3300031728 Bacteria 1864
173 Ga0316577_10003577 3300031733 Bacteria 7871
174 Ga0316577_10010328 3300031733 Bacteria 5039
175 Ga0316577_10071342 3300031733 Bacteria 1938
176 Ga0307416_100184365 3300032002 Bacteria 1960
177 Ga0316583_10004460 3300032133 Bacteria 4993
178 Ga0316583_10006051 3300032133 Bacteria 4350
179 Ga0316583_10012336 3300032133 Bacteria 3083
180 Ga0316585_10003572 3300032137 Bacteria 4280
181 Ga0316585_10041330 3300032137 Bacteria 1469
182 Ga0316580_10003803 3300032139 Bacteria 4320
183 Ga0316580_10009731 3300032139 Bacteria 2894
184 Ga0316593_10001128 3300032168 Bacteria 5644
185 Ga0316593_10001807 3300032168 Bacteria 4882
186 Ga0316593_10003588 3300032168 Bacteria 3875
187 Ga0316593_10021972 3300032168 Bacteria 2000
188 Ga0316592_1000730 3300033524 Bacteria 4868
189 Ga0316592_1010836 3300033524 Bacteria 1843
190 Ga0316592_1016722 3300033524 Bacteria 1535
191 Ga0316588_1001864 3300033528 Bacteria 3578
192 Ga0316596_1001326 3300033541 Bacteria 4926
193 Ga0316596_1002729 3300033541 Bacteria 3797
194 Ga0316596_1010850 3300033541 Bacteria 2215
195 Ga0316596_1011870 3300033541 Bacteria 2136
196 Ga0373955_0007126 3300035172 Bacteria 5123
197 Ga0316574_0000343 3300035398 Bacteria 17971
198 Ga0316574_0004091 3300035398 Bacteria 7602
199 Ga0316574_0006111 3300035398 Bacteria 6480
200 Ga0316574_0034950 3300035398 Bacteria 3068
201 Ga0316574_0053294 3300035398 Bacteria 2525
202 Ga0373927_0000002 3300035695 Bacteria 966219
203 Ga0373933_0041206 3300035724 Bacteria 2725
204 Ga0373937_0009864 3300036401 Bacteria 8325
205 Ga0373937_0024621 3300036401 Bacteria 5431
206 Ga0316582_0000140 3300036647 Bacteria 21435
207 Ga0316582_0002424 3300036647 Bacteria 8756
208 Ga0316582_0022161 3300036647 Bacteria 3767
209 Ga0316582_0058975 3300036647 Bacteria 2456
210 Ga0316582_0085764 3300036647 Bacteria 2064
211 Ga0316582_0133101 3300036647 Bacteria 1672
212 Ga0316584_0005195 3300036712 Bacteria 8705
213 Ga0316584_0006537 3300036712 Bacteria 7896
214 Ga0316584_0011129 3300036712 Bacteria 6312
215 Ga0316584_0034274 3300036712 Bacteria 3764
216 Ga0316584_0055850 3300036712 Bacteria 2956
217 Ga0316584_0058817 3300036712 Bacteria 2878
218 Ga0316584_0065202 3300036712 Bacteria 2728
219 Ga0316584_0212688 3300036712 Bacteria 1423
220 Ga0395900_0002547 3300037418 Bacteria 19968
221 Ga0316581_0000096 3300037588 Bacteria 11714
222 Ga0400484_08350 3300038725 Bacteria 14326
223 Ga0400484_36649 3300038725 Bacteria 28505
224 Ga0400490_06774 3300038726 Bacteria 50396
225 Ga0400490_07690 3300038726 Bacteria 2858
226 Ga0400490_19580 3300038726 Bacteria 58285
227 Ga0400490_40724 3300038726 Bacteria 13887
228 Ga0400491_13655 3300038727 Bacteria 10114
229 Ga0400485_19819 3300038735 Bacteria 2393
230 Ga0400485_21616 3300038735 Bacteria 2295
231 Ga0400488_12157 3300038741 Bacteria 3326
232 Ga0400488_23094 3300038741 Bacteria 4496
233 Ga0400488_52686 3300038741 Bacteria 4138
234 Ga0400486_31569 3300038742 Bacteria 10809
235 Ga0400483_007100 3300039062 Bacteria 2129
236 Ga0400483_030988 3300039062 Bacteria 3789
237 Ga0400483_072170 3300039062 Bacteria 5298
238 Ga0400483_225707 3300039062 Bacteria 10319
239 Ga0400483_267659 3300039062 Bacteria 2480
240 Ga0400483_287904 3300039062 Bacteria 22043
241 Ga0400489_48784 3300039093 Bacteria 41831
242 Ga0400487_41180 3300039110 Bacteria 49181
243 Ga0400487_51678 3300039110 Bacteria 12496
244 Ga0436365_0628801 3300039437 Bacteria 37043
245 Ga0439438_005064 3300041405 Bacteria 4914
246 Ga0439452_000637 3300042010 Bacteria 17667
247 Ga0439452_006127 3300042010 Bacteria 3794
248 Ga0451577_0000315 3300042876 Bacteria 92038
249 Ga0466981_0000054 3300044669 Bacteria 29349
250 Ga0453684_0001040 3300044712 Bacteria 88809
251 Ga0453684_0001204 3300044712 Bacteria 79823
252 Ga0453684_0004304 3300044712 Bacteria 30334
253 Ga0453684_0014484 3300044712 Bacteria 12605
254 Ga0451576_0292059 3300045051 Bacteria 1704
255 Ga0495650_0001118 3300046471 Bacteria 29311
256 Ga0496101_0067068 3300048904 Bacteria 2619
257 Ga0496104_0000670 3300048907 Bacteria 29396
258 Ga0496104_0068175 3300048907 Bacteria 3380
259 Ga0496105_0036570 3300048908 Bacteria 4045
260 Ga0496109_0008248 3300048912 Bacteria 8846
261 Ga0496113_0029160 3300048916 Bacteria 3981
262 Ga0496114_0000691 3300048917 Bacteria 25121
263 Ga0496115_0002874 3300048918 Bacteria 12404
264 Ga0496115_0045690 3300048918 Bacteria 3497
265 Ga0496116_0033799 3300048919 Bacteria 3622
266 Ga0496116_0038076 3300048919 Bacteria 3344
267 Ga0496117_0037673 3300048920 Bacteria 3598
268 Ga0496117_0039005 3300048920 Bacteria 3511
269 Ga0496118_0039252 3300048921 Bacteria 3780
270 Ga0496118_0053596 3300048921 Bacteria 3063
271 Ga0496119_0002538 3300048922 Bacteria 19865
272 Ga0496119_0025614 3300048922 Bacteria 4113
273 Ga0496119_0034686 3300048922 Bacteria 3316
274 Ga0496119_0035675 3300048922 Bacteria 3254
275 Ga0496119_0041054 3300048922 Bacteria 2951
276 Ga0496120_0018953 3300048923 Bacteria 4419
277 Ga0496120_0021457 3300048923 Bacteria 4081
278 Ga0496120_0025184 3300048923 Bacteria 3696
279 Ga0496120_0027033 3300048923 Bacteria 3535
280 Ga0496121_0046915 3300048924 Bacteria 3691
281 Ga0496121_0074238 3300048924 Bacteria 2721
282 Ga0496121_0087868 3300048924 Bacteria 2438
283 Ga0496121_0092497 3300048924 Bacteria 2357
284 Ga0496121_0097015 3300048924 Bacteria 2285
285 Ga0496122_0000142 3300048925 Bacteria 168391
286 Ga0496122_0004188 3300048925 Bacteria 18138
287 Ga0496122_0027721 3300048925 Bacteria 4833
288 Ga0496122_0045288 3300048925 Bacteria 3420
289 Ga0496122_0059986 3300048925 Bacteria 2805
290 Ga0496123_0000148 3300048926 Bacteria 143265
291 Ga0496123_0002946 3300048926 Bacteria 19879
292 Ga0496123_0011076 3300048926 Bacteria 7871
293 Ga0496123_0016759 3300048926 Bacteria 5928
294 Ga0496123_0034447 3300048926 Bacteria 3626
295 Ga0496123_0037504 3300048926 Bacteria 3420
296 Ga0496123_0069584 3300048926 Bacteria 2208
297 Ga0496124_0045910 3300048927 Bacteria 3743
298 Ga0496124_0048631 3300048927 Bacteria 3622
299 Ga0496124_0059750 3300048927 Bacteria 3200
300 Ga0496124_0064599 3300048927 Bacteria 3054
301 Ga0496125_0003254 3300048928 Bacteria 20006
302 Ga0496125_0022577 3300048928 Bacteria 5837
303 Ga0496125_0047859 3300048928 Bacteria 3570
304 Ga0496126_0003021 3300048929 Bacteria 21809
305 Ga0496126_0033733 3300048929 Bacteria 4815
306 Ga0496126_0040810 3300048929 Bacteria 4300
307 Ga0496126_0051888 3300048929 Bacteria 3731
308 Ga0496126_0063914 3300048929 Bacteria 3297
309 Ga0501037_0009994 3300049573 Bacteria 6961
310 Ga0501037_0011938 3300049573 Bacteria 6399
311 Ga0501039_0124699 3300049575 Bacteria 2020
312 Ga0501046_0029284 3300049580 Bacteria 4477
313 Ga0501070_0005094 3300049586 Bacteria 11199
314 Ga0501070_0031587 3300049586 Bacteria 4436
315 Ga0501073_0045505 3300049589 Bacteria 3091
316 Ga0501074_0038156 3300049590 Bacteria 3482
317 Ga0501079_0240249 3300049741 Bacteria 1415
318 Ga0501080_0005961 3300049742 Bacteria 10923
319 Ga0501080_0162567 3300049742 Bacteria 2061
320 Ga0501045_0026929 3300049824 Bacteria 4139
321 nmdc:mga00v17_5940_c1 3300050491 Bacteria 6455
322 nmdc:mga0qj67_10000_c1 3300050509 Bacteria 7074
323 nmdc:mga08y16_11502_c1 3300050511 Bacteria 9299
324 Ga0500650_0000095 3300053098 Bacteria 25492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8018221730 8018223860 386
2 3300038735 Ga0400485_19819 Ga0400485_19819_1071_2360 395
3 3300038725 Ga0400484_36649 Ga0400484_36649_8791_10080 401
4 3300035398 Ga0316574_0034950 Ga0316574_0034950_295_1587 402
5 3300036647 Ga0316582_0085764 Ga0316582_0085764_279_1571 402
6 3300039110 Ga0400487_41180 Ga0400487_41180_16371_17654 409
7 3300038741 Ga0400488_12157 Ga0400488_12157_1852_3141 417
8 3300038742 Ga0400486_31569 Ga0400486_31569_7839_9128 417
9 3300039062 Ga0400483_007100 Ga0400483_007100_465_1754 417
10 3300039062 Ga0400483_225707 Ga0400483_225707_449_1738 417
11 3300039093 Ga0400489_48784 Ga0400489_48784_28014_29303 417
12 iso_pu_bacteria 2608642108 2608672265 422
13 iso_pu_bacteria 2881609920 2881613514 422
14 iso_pu_bacteria 8054357960 8054358800 422
15 3300031727 Ga0316576_10059962 Ga0316576_100599621 423
16 iso_pu_bacteria 2894510363 2894512749 423
17 iso_pu_bacteria 8001522603 8001524832 423
18 iso_pu_bacteria 8002745576 8002748597 423
19 3300032168 Ga0316593_10021972 Ga0316593_100219722 424
20 iso_pu_bacteria 2919688452 2919689691 424
21 3300013104 Ga0157370_10005226 Ga0157370_100052263 425
22 3300031727 Ga0316576_10001907 Ga0316576_100019071 425
23 3300042876 Ga0451577_0000315 Ga0451577_0000315_67958_69310 425
24 3300044712 Ga0453684_0001040 Ga0453684_0001040_30_1382 425
25 iso_pu_bacteria 2791354903 2791923283 425
26 iso_pu_bacteria 2854601825 2854603929 425
27 iso_pu_bacteria 2884086401 2884090950 425
28 iso_pu_bacteria 2919543075 2919546342 425
29 iso_pu_bacteria 2939573065 2939577832 425
30 iso_pu_bacteria 651053060 651177315 425
31 3300005331 Ga0070670_100000019 Ga0070670_100000019154 426
32 3300005335 Ga0070666_10049606 Ga0070666_100496061 426
33 3300005367 Ga0070667_100000020 Ga0070667_100000020154 426
34 3300005618 Ga0068864_100000030 Ga0068864_100000030157 426
35 3300014325 Ga0163163_10000125 Ga0163163_1000012550 426
36 3300025903 Ga0207680_10005282 Ga0207680_100052825 426
37 3300025925 Ga0207650_10000034 Ga0207650_1000003464 426
38 3300025986 Ga0207658_10000015 Ga0207658_1000001564 426
39 3300026088 Ga0207641_10036531 Ga0207641_100365313 426
40 3300026095 Ga0207676_10000032 Ga0207676_1000003264 426
41 3300028379 Ga0268266_10017489 Ga0268266_100174896 426
42 3300031251 Ga0265327_10001011 Ga0265327_1000101115 426
43 3300031251 Ga0265327_10003698 Ga0265327_100036989 426
44 3300035398 Ga0316574_0000343 Ga0316574_0000343_15490_16770 426
45 3300038725 Ga0400484_08350 Ga0400484_08350_12425_13705 426
46 3300044712 Ga0453684_0004304 Ga0453684_0004304_22627_23907 426
47 3300053098 Ga0500650_0000095 Ga0500650_0000095_4628_5908 426
48 iso_pu_bacteria 2547132181 2547698796 426
49 iso_pu_bacteria 2554235234 2555262634 426
50 iso_pu_bacteria 2561511199 2562465446 426
51 iso_pu_bacteria 2599185169 2599413686 426
52 iso_pu_bacteria 2600255254 2601526351 426
53 iso_pu_bacteria 2600255255 2601531375 426
54 iso_pu_bacteria 2600255256 2601536714 426
55 iso_pu_bacteria 2600255257 2601542059 426
56 iso_pu_bacteria 2600255280 2601618181 426
57 iso_pu_bacteria 2600255281 2601623242 426
58 iso_pu_bacteria 2600255287 2601646583 426
59 iso_pu_bacteria 2600255288 2601651596 426
60 iso_pu_bacteria 2600255289 2601656656 426
61 iso_pu_bacteria 2600255290 2601661662 426
62 iso_pu_bacteria 2600255291 2601666542 426
63 iso_pu_bacteria 2600255298 2601699530 426
64 iso_pu_bacteria 2600255299 2601704413 426
65 iso_pu_bacteria 2600255300 2601709464 426
66 iso_pu_bacteria 2600255301 2601714480 426
67 iso_pu_bacteria 2600255302 2601719512 426
68 iso_pu_bacteria 2600255303 2601724413 426
69 iso_pu_bacteria 2600255304 2601729434 426
70 iso_pu_bacteria 2600255305 2601734457 426
71 iso_pu_bacteria 2600255306 2601739419 426
72 iso_pu_bacteria 2600255307 2601744568 426
73 iso_pu_bacteria 2600255309 2601755099 426
74 iso_pu_bacteria 2600255310 2601760395 426
75 iso_pu_bacteria 2600255311 2601765820 426
76 iso_pu_bacteria 2600255392 2602022338 426
77 iso_pu_bacteria 2602042046 2603636433 426
78 iso_pu_bacteria 2602042047 2603641915 426
79 iso_pu_bacteria 2602042052 2603659258 426
80 iso_pu_bacteria 2602042053 2603664151 426
81 iso_pu_bacteria 2602042066 2603697958 426
82 iso_pu_bacteria 2602042067 2603702277 426
83 iso_pu_bacteria 2602042103 2603836807 426
84 iso_pu_bacteria 2602042104 2603841858 426
85 iso_pu_bacteria 2602042105 2603846931 426
86 iso_pu_bacteria 2602042106 2603852030 426
87 iso_pu_bacteria 2602042109 2603864947 426
88 iso_pu_bacteria 2602042110 2603869573 426
89 iso_pu_bacteria 2602042111 2603874777 426
90 iso_pu_bacteria 2603880178 2606046759 426
91 iso_pu_bacteria 2603880184 2606068581 426
92 iso_pu_bacteria 2603880202 2606144431 426
93 iso_pu_bacteria 2603880211 2606174648 426
94 iso_pu_bacteria 2609459761 2609914424 426
95 iso_pu_bacteria 2636415599 2637227643 426
96 iso_pu_bacteria 2667528172 2671105899 426
97 iso_pu_bacteria 2675903046 2676410358 426
98 iso_pu_bacteria 2681812866 2681995274 426
99 iso_pu_bacteria 2681812869 2682010077 426
100 iso_pu_bacteria 2751185917 2753854126 426
101 iso_pu_bacteria 2765235842 2765587021 426
102 iso_pu_bacteria 2775506706 2775542445 426
103 iso_pu_bacteria 2775507074 2777024524 426
104 iso_pu_bacteria 2791355010 2792314825 426
105 iso_pu_bacteria 2814123068 2814698804 426
106 iso_pu_bacteria 2821118458 2821122134 426
107 iso_pu_bacteria 2823373977 2823378614 426
108 iso_pu_bacteria 2844425489 2844425740 426
109 iso_pu_bacteria 2881714928 2881715771 426
110 iso_pu_bacteria 2904513164 2904518458 426
111 iso_pu_bacteria 2919108558 2919114058 426
112 iso_pu_bacteria 2923634449 2923637508 426
113 iso_pu_bacteria 2927833300 2927836038 426
114 iso_pu_bacteria 2935625433 2935630319 426
115 iso_pu_bacteria 2937539931 2937542033 426
116 iso_pu_bacteria 2939568625 2939572974 426
117 iso_pu_bacteria 2939607340 2939611855 426
118 iso_pu_bacteria 2939617950 2939622496 426
119 iso_pu_bacteria 2939642701 2939646976 426
120 iso_pu_bacteria 2945874760 2945874913 426
121 iso_pu_bacteria 2969079654 2969084682 426
122 iso_pu_bacteria 2971820967 2971826207 426
123 iso_pu_bacteria 2974310843 2974314103 426
124 iso_pu_bacteria 2974435778 2974436495 426
125 iso_pu_bacteria 2984559226 2984561802 426
126 iso_pu_bacteria 2984595703 2984599868 426
127 iso_pu_bacteria 3000376612 3000380949 426
128 iso_pu_bacteria 8018405270 8018406518 426
129 iso_pu_bacteria 8019504834 8019509387 426
130 iso_pu_bacteria 8055097453 8055097656 426
131 iso_pu_bacteria 8057160832 8057161083 426
132 3300005367 Ga0070667_100000243 Ga0070667_10000024357 427
133 3300005455 Ga0070663_100000262 Ga0070663_10000026213 427
134 3300005539 Ga0068853_100002328 Ga0068853_10000232810 427
135 3300009177 Ga0105248_10000367 Ga0105248_1000036745 427
136 3300009545 Ga0105237_10000182 Ga0105237_1000018230 427
137 3300025913 Ga0207695_10113387 Ga0207695_101133872 427
138 3300025914 Ga0207671_10002214 Ga0207671_100022144 427
139 3300025941 Ga0207711_10002157 Ga0207711_100021572 427
140 3300025961 Ga0207712_10000443 Ga0207712_1000044323 427
141 3300025986 Ga0207658_10000203 Ga0207658_1000020356 427
142 3300026041 Ga0207639_10008015 Ga0207639_100080152 427
143 3300026067 Ga0207678_10000947 Ga0207678_1000094713 427
144 3300031251 Ga0265327_10000764 Ga0265327_1000076444 427
145 3300031344 Ga0265316_10000395 Ga0265316_100003959 427
146 3300031728 Ga0316578_10017724 Ga0316578_100177241 427
147 3300032139 Ga0316580_10009731 Ga0316580_100097313 427
148 3300032168 Ga0316593_10001807 Ga0316593_100018075 427
149 3300033524 Ga0316592_1016722 Ga0316592_10167221 427
150 3300033528 Ga0316588_1001864 Ga0316588_10018643 427
151 3300033541 Ga0316596_1011870 Ga0316596_10118702 427
152 3300035172 Ga0373955_0007126 Ga0373955_0007126_305_1600 427
153 3300035724 Ga0373933_0041206 Ga0373933_0041206_825_2120 427
154 3300036401 Ga0373937_0009864 Ga0373937_0009864_4972_6267 427
155 3300036712 Ga0316584_0034274 Ga0316584_0034274_2289_3572 427
156 3300036712 Ga0316584_0212688 Ga0316584_0212688_101_1384 427
157 3300048925 Ga0496122_0000142 Ga0496122_0000142_137586_138869 427
158 3300048926 Ga0496123_0000148 Ga0496123_0000148_127669_128952 427
159 3300048929 Ga0496126_0033733 Ga0496126_0033733_968_2251 427
160 3300031665 Ga0316575_10001211 Ga0316575_100012116 428
161 3300031691 Ga0316579_10001278 Ga0316579_100012782 428
162 3300031727 Ga0316576_10041584 Ga0316576_100415842 428
163 3300031733 Ga0316577_10010328 Ga0316577_100103283 428
164 3300032137 Ga0316585_10041330 Ga0316585_100413301 428
165 3300032139 Ga0316580_10003803 Ga0316580_100038032 428
166 3300035398 Ga0316574_0004091 Ga0316574_0004091_1301_2590 428
167 3300036712 Ga0316584_0065202 Ga0316584_0065202_36_1331 428
168 3300039062 Ga0400483_030988 Ga0400483_030988_1549_2838 428
169 3300039062 Ga0400483_072170 Ga0400483_072170_3202_4488 428
170 3300039062 Ga0400483_267659 Ga0400483_267659_794_2080 428
171 3300039062 Ga0400483_287904 Ga0400483_287904_11841_13127 428
172 3300044712 Ga0453684_0014484 Ga0453684_0014484_11031_12320 428
173 3300049573 Ga0501037_0009994 Ga0501037_0009994_235_1530 428
174 3300049573 Ga0501037_0011938 Ga0501037_0011938_3550_4863 428
175 3300049575 Ga0501039_0124699 Ga0501039_0124699_423_1718 428
176 3300049580 Ga0501046_0029284 Ga0501046_0029284_2189_3484 428
177 3300049586 Ga0501070_0031587 Ga0501070_0031587_1885_3198 428
178 3300049589 Ga0501073_0045505 Ga0501073_0045505_1610_2923 428
179 3300049590 Ga0501074_0038156 Ga0501074_0038156_477_1790 428
180 3300049741 Ga0501079_0240249 Ga0501079_0240249_50_1345 428
181 3300049742 Ga0501080_0005961 Ga0501080_0005961_4182_5495 428
182 3300049742 Ga0501080_0162567 Ga0501080_0162567_19_1314 428
183 3300005331 Ga0070670_100038360 Ga0070670_1000383604 429
184 3300005335 Ga0070666_10001235 Ga0070666_1000123510 429
185 3300005343 Ga0070687_100025709 Ga0070687_1000257092 429
186 3300005344 Ga0070661_100065404 Ga0070661_1000654042 429
187 3300005355 Ga0070671_100009341 Ga0070671_1000093417 429
188 3300005364 Ga0070673_100033402 Ga0070673_1000334024 429
189 3300005367 Ga0070667_100006470 Ga0070667_1000064707 429
190 3300005438 Ga0070701_10057376 Ga0070701_100573762 429
191 3300005439 Ga0070711_100015522 Ga0070711_1000155222 429
192 3300005535 Ga0070684_100018023 Ga0070684_1000180234 429
193 3300005544 Ga0070686_100013393 Ga0070686_1000133932 429
194 3300005547 Ga0070693_100031180 Ga0070693_1000311804 429
195 3300005548 Ga0070665_100010147 Ga0070665_1000101477 429
196 3300005549 Ga0070704_100006827 Ga0070704_1000068273 429
197 3300005564 Ga0070664_100115997 Ga0070664_1001159972 429
198 3300005616 Ga0068852_100094264 Ga0068852_1000942642 429
199 3300005617 Ga0068859_100014316 Ga0068859_1000143167 429
200 3300005618 Ga0068864_100078672 Ga0068864_1000786722 429
201 3300005618 Ga0068864_100103753 Ga0068864_1001037532 429
202 3300005842 Ga0068858_100021443 Ga0068858_1000214434 429
203 3300005844 Ga0068862_100012920 Ga0068862_1000129205 429
204 3300006237 Ga0097621_100012529 Ga0097621_1000125292 429
205 3300006844 Ga0075428_100059188 Ga0075428_1000591882 429
206 3300006846 Ga0075430_100015755 Ga0075430_1000157553 429
207 3300006880 Ga0075429_100003299 Ga0075429_1000032995 429
208 3300006931 Ga0097620_100014316 Ga0097620_1000143162 429
209 3300006946 Ga0079104_1000943 Ga0079104_100094321 429
210 3300009011 Ga0105251_10014348 Ga0105251_100143483 429
211 3300009036 Ga0105244_10001136 Ga0105244_100011362 429
212 3300009036 Ga0105244_10009121 Ga0105244_100091212 429
213 3300009092 Ga0105250_10000725 Ga0105250_100007253 429
214 3300009092 Ga0105250_10009240 Ga0105250_100092402 429
215 3300009094 Ga0111539_10017599 Ga0111539_100175999 429
216 3300009098 Ga0105245_10015182 Ga0105245_100151824 429
217 3300009101 Ga0105247_10015505 Ga0105247_100155052 429
218 3300009148 Ga0105243_10013948 Ga0105243_100139482 429
219 3300009177 Ga0105248_10006684 Ga0105248_100066844 429
220 3300009551 Ga0105238_10027128 Ga0105238_100271286 429
221 3300009553 Ga0105249_10012483 Ga0105249_100124832 429
222 3300009553 Ga0105249_10029487 Ga0105249_100294874 429
223 3300010375 Ga0105239_10136147 Ga0105239_101361472 429
224 3300011119 Ga0105246_10008029 Ga0105246_100080294 429
225 3300013306 Ga0163162_10060503 Ga0163162_100605034 429
226 3300013308 Ga0157375_10004470 Ga0157375_100044705 429
227 3300014325 Ga0163163_10000876 Ga0163163_100008767 429
228 3300014326 Ga0157380_10144312 Ga0157380_101443122 429
229 3300014969 Ga0157376_10028548 Ga0157376_100285484 429
230 3300025711 Ga0207696_1000512 Ga0207696_100051229 429
231 3300025711 Ga0207696_1000531 Ga0207696_100053127 429
232 3300025728 Ga0207655_1001092 Ga0207655_100109222 429
233 3300025728 Ga0207655_1009311 Ga0207655_10093112 429
234 3300025735 Ga0207713_1001430 Ga0207713_10014302 429
235 3300025916 Ga0207663_10095058 Ga0207663_100950581 429
236 3300025920 Ga0207649_10132825 Ga0207649_101328251 429
237 3300025924 Ga0207694_10133254 Ga0207694_101332542 429
238 3300025925 Ga0207650_10099632 Ga0207650_100996322 429
239 3300025931 Ga0207644_10043063 Ga0207644_100430634 429
240 3300025935 Ga0207709_10007478 Ga0207709_100074785 429
241 3300025936 Ga0207670_10034728 Ga0207670_100347284 429
242 3300025936 Ga0207670_10175781 Ga0207670_101757811 429
243 3300025941 Ga0207711_10044513 Ga0207711_100445132 429
244 3300025944 Ga0207661_10129461 Ga0207661_101294612 429
245 3300025961 Ga0207712_10184898 Ga0207712_101848982 429
246 3300026023 Ga0207677_10232580 Ga0207677_102325802 429
247 3300026075 Ga0207708_10006972 Ga0207708_100069722 429
248 3300026095 Ga0207676_10004867 Ga0207676_100048679 429
249 3300027111 Ga0209281_1000928 Ga0209281_100092821 429
250 3300027907 Ga0207428_10019778 Ga0207428_100197784 429
251 3300028379 Ga0268266_10096111 Ga0268266_100961112 429
252 3300028380 Ga0268265_10007743 Ga0268265_100077434 429
253 3300031665 Ga0316575_10004106 Ga0316575_100041064 429
254 3300031691 Ga0316579_10000214 Ga0316579_100002146 429
255 3300031691 Ga0316579_10000316 Ga0316579_1000031615 429
256 3300031691 Ga0316579_10060612 Ga0316579_100606122 429
257 3300031727 Ga0316576_10001923 Ga0316576_100019239 429
258 3300031727 Ga0316576_10013091 Ga0316576_100130912 429
259 3300031727 Ga0316576_10072607 Ga0316576_100726072 429
260 3300031728 Ga0316578_10000441 Ga0316578_1000044111 429
261 3300031728 Ga0316578_10001213 Ga0316578_100012137 429
262 3300031728 Ga0316578_10007602 Ga0316578_100076025 429
263 3300031728 Ga0316578_10086897 Ga0316578_100868972 429
264 3300031733 Ga0316577_10003577 Ga0316577_100035774 429
265 3300031733 Ga0316577_10071342 Ga0316577_100713422 429
266 3300032002 Ga0307416_100184365 Ga0307416_1001843652 429
267 3300032133 Ga0316583_10004460 Ga0316583_100044602 429
268 3300032133 Ga0316583_10006051 Ga0316583_100060512 429
269 3300032133 Ga0316583_10012336 Ga0316583_100123363 429
270 3300032137 Ga0316585_10003572 Ga0316585_100035721 429
271 3300032168 Ga0316593_10001128 Ga0316593_100011286 429
272 3300032168 Ga0316593_10003588 Ga0316593_100035883 429
273 3300033524 Ga0316592_1000730 Ga0316592_10007302 429
274 3300033524 Ga0316592_1010836 Ga0316592_10108362 429
275 3300033541 Ga0316596_1001326 Ga0316596_10013262 429
276 3300033541 Ga0316596_1002729 Ga0316596_10027293 429
277 3300033541 Ga0316596_1010850 Ga0316596_10108502 429
278 3300035398 Ga0316574_0006111 Ga0316574_0006111_2654_3943 429
279 3300035695 Ga0373927_0000002 Ga0373927_0000002_315893_317230 429
280 3300036401 Ga0373937_0024621 Ga0373937_0024621_1410_2708 429
281 3300036647 Ga0316582_0000140 Ga0316582_0000140_1297_2586 429
282 3300036647 Ga0316582_0002424 Ga0316582_0002424_136_1425 429
283 3300036647 Ga0316582_0022161 Ga0316582_0022161_2339_3628 429
284 3300036647 Ga0316582_0058975 Ga0316582_0058975_229_1518 429
285 3300036647 Ga0316582_0133101 Ga0316582_0133101_248_1540 429
286 3300036712 Ga0316584_0005195 Ga0316584_0005195_15_1304 429
287 3300036712 Ga0316584_0006537 Ga0316584_0006537_4506_5795 429
288 3300036712 Ga0316584_0011129 Ga0316584_0011129_1551_2840 429
289 3300036712 Ga0316584_0055850 Ga0316584_0055850_791_2098 429
290 3300036712 Ga0316584_0058817 Ga0316584_0058817_513_1802 429
291 3300037418 Ga0395900_0002547 Ga0395900_0002547_6780_8075 429
292 3300037588 Ga0316581_0000096 Ga0316581_0000096_4330_5619 429
293 3300038726 Ga0400490_06774 Ga0400490_06774_3494_4789 429
294 3300038726 Ga0400490_07690 Ga0400490_07690_1516_2805 429
295 3300038726 Ga0400490_19580 Ga0400490_19580_24405_25694 429
296 3300038726 Ga0400490_40724 Ga0400490_40724_7859_9148 429
297 3300038727 Ga0400491_13655 Ga0400491_13655_5732_7021 429
298 3300038735 Ga0400485_21616 Ga0400485_21616_962_2251 429
299 3300038741 Ga0400488_23094 Ga0400488_23094_24_1313 429
300 3300038741 Ga0400488_52686 Ga0400488_52686_535_1833 429
301 3300039110 Ga0400487_51678 Ga0400487_51678_6468_7757 429
302 3300044712 Ga0453684_0001204 Ga0453684_0001204_58924_60219 429
303 3300045051 Ga0451576_0292059 Ga0451576_0292059_266_1567 429
304 3300048904 Ga0496101_0067068 Ga0496101_0067068_1132_2424 429
305 3300048907 Ga0496104_0068175 Ga0496104_0068175_381_1670 429
306 3300048912 Ga0496109_0008248 Ga0496109_0008248_1330_2631 429
307 3300048916 Ga0496113_0029160 Ga0496113_0029160_1815_3116 429
308 3300048917 Ga0496114_0000691 Ga0496114_0000691_16519_17811 429
309 3300048918 Ga0496115_0002874 Ga0496115_0002874_999_2306 429
310 3300048918 Ga0496115_0045690 Ga0496115_0045690_77_1369 429
311 3300048922 Ga0496119_0034686 Ga0496119_0034686_1330_2619 429
312 3300048923 Ga0496120_0021457 Ga0496120_0021457_1507_2796 429
313 3300048928 Ga0496125_0003254 Ga0496125_0003254_2053_3342 429
314 3300048929 Ga0496126_0040810 Ga0496126_0040810_1496_2785 429
315 3300049586 Ga0501070_0005094 Ga0501070_0005094_3508_4806 429
316 3300049824 Ga0501045_0026929 Ga0501045_0026929_2572_3861 429
317 3300050509 nmdc:mga0qj67_10000_c1 nmdc:mga0qj67_10000_c1_4533_5831 429
318 3300050511 nmdc:mga08y16_11502_c1 nmdc:mga08y16_11502_c1_6898_8196 429
319 2162886007 SwRhRL2b_contig_1822283 SwRhRL2b_0726.00005580 430
320 3300003320 rootH2_10105015 rootH2_101050156 430
321 3300003856 Ga0058692_1006996 Ga0058692_10069962 430
322 3300003856 Ga0058692_1010826 Ga0058692_10108261 430
323 3300005289 Ga0065704_10003514 Ga0065704_100035142 430
324 3300005289 Ga0065704_10118575 Ga0065704_101185752 430
325 3300005548 Ga0070665_100053006 Ga0070665_1000530062 430
326 3300005577 Ga0068857_100000461 Ga0068857_10000046127 430
327 3300006051 Ga0075364_10022477 Ga0075364_100224773 430
328 3300006946 Ga0079104_1006804 Ga0079104_10068043 430
329 3300006946 Ga0079104_1008008 Ga0079104_10080082 430
330 3300006946 Ga0079104_1008318 Ga0079104_10083182 430
331 3300006946 Ga0079104_1009605 Ga0079104_10096052 430
332 3300009011 Ga0105251_10015840 Ga0105251_100158403 430
333 3300009011 Ga0105251_10017988 Ga0105251_100179883 430
334 3300009011 Ga0105251_10037384 Ga0105251_100373842 430
335 3300009011 Ga0105251_10037509 Ga0105251_100375092 430
336 3300009036 Ga0105244_10016406 Ga0105244_100164062 430
337 3300009036 Ga0105244_10050074 Ga0105244_100500742 430
338 3300009036 Ga0105244_10050495 Ga0105244_100504952 430
339 3300009092 Ga0105250_10021605 Ga0105250_100216052 430
340 3300009092 Ga0105250_10024991 Ga0105250_100249912 430
341 3300009148 Ga0105243_10064060 Ga0105243_100640602 430
342 3300013100 Ga0157373_10028351 Ga0157373_100283513 430
343 3300013102 Ga0157371_10037882 Ga0157371_100378822 430
344 3300013104 Ga0157370_10016113 Ga0157370_100161138 430
345 3300015679 Ga0183366_1010 Ga0183366_101026 430
346 3300015680 Ga0183370_1010 Ga0183370_101026 430
347 3300015685 Ga0183369_1025 Ga0183369_102526 430
348 3300015687 Ga0183368_1013 Ga0183368_101326 430
349 3300021384 Ga0213876_10000387 Ga0213876_1000038733 430
350 3300025728 Ga0207655_1011506 Ga0207655_10115062 430
351 3300025728 Ga0207655_1015633 Ga0207655_10156332 430
352 3300025728 Ga0207655_1018314 Ga0207655_10183143 430
353 3300025735 Ga0207713_1003631 Ga0207713_10036319 430
354 3300025735 Ga0207713_1008539 Ga0207713_10085396 430
355 3300025735 Ga0207713_1014406 Ga0207713_10144063 430
356 3300025735 Ga0207713_1014875 Ga0207713_10148752 430
357 3300025735 Ga0207713_1040502 Ga0207713_10405022 430
358 3300025935 Ga0207709_10013490 Ga0207709_100134905 430
359 3300025935 Ga0207709_10019457 Ga0207709_100194572 430
360 3300026116 Ga0207674_10001609 Ga0207674_1000160926 430
361 3300027111 Ga0209281_1000810 Ga0209281_10008102 430
362 3300027111 Ga0209281_1001108 Ga0209281_10011082 430
363 3300027111 Ga0209281_1005029 Ga0209281_10050292 430
364 3300027111 Ga0209281_1005217 Ga0209281_10052172 430
365 3300027111 Ga0209281_1005766 Ga0209281_10057663 430
366 3300027312 Ga0209371_1000680 Ga0209371_100068026 430
367 3300027312 Ga0209371_1000814 Ga0209371_10008142 430
368 3300027312 Ga0209371_1000879 Ga0209371_10008793 430
369 3300027312 Ga0209371_1007981 Ga0209371_10079812 430
370 3300028379 Ga0268266_10030432 Ga0268266_100304322 430
371 3300030500 Ga0268256_1000584 Ga0268256_100058426 430
372 3300030500 Ga0268256_1000715 Ga0268256_10007153 430
373 3300030500 Ga0268256_1003330 Ga0268256_10033307 430
374 3300030500 Ga0268256_1007969 Ga0268256_10079693 430
375 3300030500 Ga0268256_1013301 Ga0268256_10133013 430
376 3300035398 Ga0316574_0053294 Ga0316574_0053294_928_2307 430
377 3300039437 Ga0436365_0628801 Ga0436365_0628801_2071_3363 430
378 3300041405 Ga0439438_005064 Ga0439438_005064_1509_2801 430
379 3300042010 Ga0439452_000637 Ga0439452_000637_14383_15675 430
380 3300042010 Ga0439452_006127 Ga0439452_006127_876_2168 430
381 3300044669 Ga0466981_0000054 Ga0466981_0000054_25834_27126 430
382 3300046471 Ga0495650_0001118 Ga0495650_0001118_2149_3441 430
383 3300048907 Ga0496104_0000670 Ga0496104_0000670_2146_3438 430
384 3300048908 Ga0496105_0036570 Ga0496105_0036570_1970_3262 430
385 3300048919 Ga0496116_0033799 Ga0496116_0033799_850_2142 430
386 3300048919 Ga0496116_0038076 Ga0496116_0038076_529_1821 430
387 3300048920 Ga0496117_0037673 Ga0496117_0037673_2077_3369 430
388 3300048920 Ga0496117_0039005 Ga0496117_0039005_1638_2930 430
389 3300048921 Ga0496118_0039252 Ga0496118_0039252_851_2143 430
390 3300048921 Ga0496118_0053596 Ga0496118_0053596_1034_2329 430
391 3300048922 Ga0496119_0002538 Ga0496119_0002538_2001_3296 430
392 3300048922 Ga0496119_0025614 Ga0496119_0025614_1972_3264 430
393 3300048922 Ga0496119_0035675 Ga0496119_0035675_445_1737 430
394 3300048922 Ga0496119_0041054 Ga0496119_0041054_1140_2432 430
395 3300048923 Ga0496120_0018953 Ga0496120_0018953_2149_3441 430
396 3300048923 Ga0496120_0025184 Ga0496120_0025184_420_1715 430
397 3300048923 Ga0496120_0027033 Ga0496120_0027033_252_1544 430
398 3300048924 Ga0496121_0046915 Ga0496121_0046915_2042_3334 430
399 3300048924 Ga0496121_0074238 Ga0496121_0074238_883_2175 430
400 3300048924 Ga0496121_0087868 Ga0496121_0087868_681_1973 430
401 3300048924 Ga0496121_0092497 Ga0496121_0092497_441_1733 430
402 3300048924 Ga0496121_0097015 Ga0496121_0097015_529_1821 430
403 3300048925 Ga0496122_0004188 Ga0496122_0004188_14826_16118 430
404 3300048925 Ga0496122_0027721 Ga0496122_0027721_2806_4098 430
405 3300048925 Ga0496122_0045288 Ga0496122_0045288_857_2149 430
406 3300048925 Ga0496122_0059986 Ga0496122_0059986_1128_2420 430
407 3300048926 Ga0496123_0002946 Ga0496123_0002946_16567_17859 430
408 3300048926 Ga0496123_0011076 Ga0496123_0011076_2049_3341 430
409 3300048926 Ga0496123_0016759 Ga0496123_0016759_4280_5572 430
410 3300048926 Ga0496123_0034447 Ga0496123_0034447_187_1479 430
411 3300048926 Ga0496123_0037504 Ga0496123_0037504_857_2149 430
412 3300048926 Ga0496123_0069584 Ga0496123_0069584_422_1714 430
413 3300048927 Ga0496124_0045910 Ga0496124_0045910_460_1752 430
414 3300048927 Ga0496124_0048631 Ga0496124_0048631_187_1479 430
415 3300048927 Ga0496124_0059750 Ga0496124_0059750_1019_2311 430
416 3300048927 Ga0496124_0064599 Ga0496124_0064599_1638_2930 430
417 3300048928 Ga0496125_0022577 Ga0496125_0022577_87_1379 430
418 3300048928 Ga0496125_0047859 Ga0496125_0047859_2041_3333 430
419 3300048929 Ga0496126_0003021 Ga0496126_0003021_19246_20538 430
420 3300048929 Ga0496126_0051888 Ga0496126_0051888_1644_2936 430
421 3300048929 Ga0496126_0063914 Ga0496126_0063914_767_2059 430
422 3300050491 nmdc:mga00v17_5940_c1 nmdc:mga00v17_5940_c1_5063_6355 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

103

284

0.99

PF02844

GARS_N

Phosphoribosylglycinamide synthetase, N domain

1

102

0.99

PF02843

GARS_C

Phosphoribosylglycinamide synthetase, C domain

319

409

0.95

PF02655

ATP-grasp_3

ATP-grasp domain

103

282

0.84

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

104

260

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9642 1 420
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9624 1 424
2qk4-assembly1.cif.gz_A human glycinamide ribonucleotide synthetase 0.9566 2 426
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.953 1 420
2xd4-assembly1.cif.gz_A nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase 0.9516 1 424
ID Description Score Start End Superfamily
5vevA02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9822 121 190 3.30.1490.20
2yw2A03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9648 191 329 3.30.470.20
3lp8A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9645 3 95 3.40.50.20
5vevA02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9635 121 190 3.30.1490.20
af_P22102_4_97_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9602 3 95 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A2N5A2F1-F1-model_v4 phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9943 207 359 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A3C0GYZ9-F1-model_v4 deleted 0.9932 59 430
AF-A0A7X8LEI6-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) 0.9927 1 112 GO:0004637
GO:0009113
AF-A0A7V5HI60-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) 0.9919 1 123 GO:0004637
GO:0009113
AF-A0A7C5XVA4-F1-model_v4 phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9916 187 427 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.13 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map