F440337

General Info

Members Datasets Scaffolds Average Seq Length
422 161 844 243

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0004558|Ga0439448_0004558_1444_2175
Length 243
Sequence MSAERTAVVTGAGKRVGAAVAQALLEDGWAVVAHIHDSSDSVPDGAKKIAADLADGECARTIFAATKGLPPVRLLLNNAARFAWDGFGEFSVDEFDAHMAVNVRAPTLLIEELARNHDGRDALVVNLLDSKLSAPNPDYLSYTLSKYGLAALTELAARALAPRSIRVNGVAPALMLRSSGQSEENFEAMHASNPLRRGVEPADVIGAIRYLVEATAVTGQIITVDSGQRFMALERDVQFVGDV

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
134 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.45
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0004558 3300042005 Bacteria 3913
2 JGI24741J21665_1000971 3300001915 Bacteria 8621
3 JGI24740J21852_10006193 3300001979 Bacteria 4984
4 JGI24740J21852_10027945 3300001979 Bacteria 1869
5 JGI24740J21852_10028535 3300001979 Bacteria 1843
6 JGI24739J22299_10016108 3300001989 Bacteria 2710
7 JGI24737J22298_10004113 3300001990 Bacteria 5082
8 JGI24737J22298_10026247 3300001990 Bacteria 1840
9 JGI24735J21928_10012073 3300002067 Bacteria 2732
10 JGI24735J21928_10017481 3300002067 Bacteria 2217
11 JGI24735J21928_10023994 3300002067 Bacteria 1848
12 JGI24735J21928_10031895 3300002067 Bacteria 1561
13 JGI24735J21928_10076665 3300002067 Unclassified 958
14 JGI24738J21930_10002211 3300002075 Bacteria 5173
15 JGI24738J21930_10041185 3300002075 Bacteria 939
16 Ga0065712_10263473 3300005290 Bacteria 932
17 Ga0070658_10001347 3300005327 Bacteria 20977
18 Ga0070658_10012460 3300005327 Bacteria 6821
19 Ga0070658_10379242 3300005327 Bacteria 1213
20 Ga0070683_100005771 3300005329 Bacteria 10347
21 Ga0070683_100005789 3300005329 Bacteria 10336
22 Ga0070683_100268923 3300005329 Bacteria 1621
23 Ga0070690_100031790 3300005330 Bacteria 3291
24 Ga0070670_100001836 3300005331 Bacteria 17303
25 Ga0068869_100073637 3300005334 Bacteria 2533
26 Ga0070666_10000168 3300005335 Bacteria 45111
27 Ga0070680_100003062 3300005336 Bacteria 12405
28 Ga0070680_100073538 3300005336 Bacteria 2811
29 Ga0068868_100264469 3300005338 Bacteria 1452
30 Ga0070660_100000009 3300005339 Bacteria 145691
31 Ga0070660_100022816 3300005339 Bacteria 4634
32 Ga0070660_100077346 3300005339 Bacteria 2607
33 Ga0070660_100085639 3300005339 Bacteria 2479
34 Ga0070660_100442725 3300005339 Bacteria 1077
35 Ga0070660_100589872 3300005339 Bacteria 929
36 Ga0070687_100305988 3300005343 Bacteria 1010
37 Ga0070661_100000100 3300005344 Bacteria 70585
38 Ga0070661_100089202 3300005344 Bacteria 2283
39 Ga0070661_100111399 3300005344 Bacteria 2044
40 Ga0070692_10009633 3300005345 Bacteria 4365
41 Ga0070692_10491897 3300005345 Unclassified 793
42 Ga0070668_100027417 3300005347 Bacteria 4325
43 Ga0070668_100031969 3300005347 Bacteria 4005
44 Ga0070671_100006764 3300005355 Bacteria 9174
45 Ga0070671_100012914 3300005355 Bacteria 6731
46 Ga0070671_100057522 3300005355 Bacteria 3236
47 Ga0070673_100077404 3300005364 Bacteria 2688
48 Ga0070673_100150489 3300005364 Bacteria 1971
49 Ga0070673_100248561 3300005364 Bacteria 1549
50 Ga0070659_100000981 3300005366 Bacteria 20980
51 Ga0070659_100009507 3300005366 Bacteria 7143
52 Ga0070659_100015805 3300005366 Bacteria 5657
53 Ga0070659_100054107 3300005366 Bacteria 3161
54 Ga0070659_100109335 3300005366 Bacteria 2231
55 Ga0070659_100119759 3300005366 Bacteria 2131
56 Ga0070659_100132384 3300005366 Bacteria 2026
57 Ga0070659_100144457 3300005366 Bacteria 1938
58 Ga0070659_100150974 3300005366 Bacteria 1895
59 Ga0070659_100176280 3300005366 Bacteria 1753
60 Ga0070667_100000836 3300005367 Bacteria 28641
61 Ga0070667_100006655 3300005367 Bacteria 9606
62 Ga0070667_100023527 3300005367 Bacteria 5112
63 Ga0070714_100042221 3300005435 Bacteria 3851
64 Ga0070714_100638840 3300005435 Bacteria 1024
65 Ga0070694_100011864 3300005444 Bacteria 5405
66 Ga0070663_100004141 3300005455 Bacteria 8476
67 Ga0070663_100004583 3300005455 Bacteria 8141
68 Ga0070663_100074548 3300005455 Bacteria 2478
69 Ga0070663_100582026 3300005455 Bacteria 939
70 Ga0070662_100000035 3300005457 Bacteria 77342
71 Ga0070662_100039429 3300005457 Bacteria 3359
72 Ga0070662_100098623 3300005457 Bacteria 2207
73 Ga0070662_100196026 3300005457 Unclassified 1600
74 Ga0070681_10051007 3300005458 Bacteria 4127
75 Ga0070681_10055637 3300005458 Bacteria 3939
76 Ga0070681_10363037 3300005458 Bacteria 1358
77 Ga0070679_100079237 3300005530 Bacteria 3274
78 Ga0070679_100105409 3300005530 Bacteria 2805
79 Ga0070679_100489036 3300005530 Bacteria 1175
80 Ga0070684_100003789 3300005535 Bacteria 11418
81 Ga0070684_100068831 3300005535 Bacteria 3112
82 Ga0068853_100000409 3300005539 Bacteria 29517
83 Ga0068853_100006570 3300005539 Bacteria 9260
84 Ga0068853_100048013 3300005539 Bacteria 3665
85 Ga0068853_100080030 3300005539 Bacteria 2858
86 Ga0068853_100098900 3300005539 Bacteria 2576
87 Ga0068853_100132939 3300005539 Bacteria 2228
88 Ga0070672_100015815 3300005543 Bacteria 5387
89 Ga0070695_100040097 3300005545 Bacteria 2963
90 Ga0070693_100000322 3300005547 Bacteria 22033
91 Ga0070693_100110238 3300005547 Bacteria 1692
92 Ga0070665_100321676 3300005548 Bacteria 1551
93 Ga0068855_100018982 3300005563 Bacteria 8268
94 Ga0068855_100049492 3300005563 Bacteria 4956
95 Ga0068855_100060316 3300005563 Bacteria 4437
96 Ga0068855_100089424 3300005563 Bacteria 3555
97 Ga0068855_100108367 3300005563 Bacteria 3190
98 Ga0068855_100315842 3300005563 Bacteria 1728
99 Ga0070664_100000025 3300005564 Bacteria 93173
100 Ga0070664_100002857 3300005564 Bacteria 13980
101 Ga0070664_100013803 3300005564 Bacteria 6586
102 Ga0068857_100103752 3300005577 Bacteria 2553
103 Ga0068857_100105827 3300005577 Bacteria 2526
104 Ga0068857_100121043 3300005577 Bacteria 2356
105 Ga0068857_100227368 3300005577 Bacteria 1705
106 Ga0068854_100017451 3300005578 Bacteria 4802
107 Ga0068854_100035016 3300005578 Bacteria 3512
108 Ga0068854_100042911 3300005578 Bacteria 3204
109 Ga0068856_100000219 3300005614 Bacteria 61699
110 Ga0068856_100028999 3300005614 Bacteria 5408
111 Ga0068856_100078201 3300005614 Bacteria 3279
112 Ga0068856_100085381 3300005614 Bacteria 3135
113 Ga0068856_100165202 3300005614 Bacteria 2224
114 Ga0068852_100001450 3300005616 Bacteria 16008
115 Ga0068852_100011960 3300005616 Bacteria 6564
116 Ga0068852_100021551 3300005616 Bacteria 5148
117 Ga0068852_100031305 3300005616 Bacteria 4388
118 Ga0068852_100120524 3300005616 Bacteria 2401
119 Ga0068852_100390962 3300005616 Bacteria 1366
120 Ga0068859_100007663 3300005617 Bacteria 10972
121 Ga0068859_100017405 3300005617 Bacteria 7222
122 Ga0068859_100101529 3300005617 Bacteria 2934
123 Ga0068864_100000078 3300005618 Bacteria 103622
124 Ga0068864_100024144 3300005618 Bacteria 5112
125 Ga0068864_100063522 3300005618 Bacteria 3200
126 Ga0068864_100090555 3300005618 Bacteria 2697
127 Ga0068864_100233947 3300005618 Bacteria 1700
128 Ga0068851_10052238 3300005834 Bacteria 2078
129 Ga0068851_10126360 3300005834 Bacteria 1379
130 Ga0068851_10169725 3300005834 Unclassified 1203
131 Ga0068863_100000882 3300005841 Bacteria 30167
132 Ga0068863_100006447 3300005841 Bacteria 11509
133 Ga0068863_100048676 3300005841 Bacteria 4019
134 Ga0068863_100534684 3300005841 Unclassified 1156
135 Ga0068863_100694951 3300005841 Bacteria 1011
136 Ga0068858_100000874 3300005842 Bacteria 31179
137 Ga0068858_100023548 3300005842 Bacteria 5736
138 Ga0068858_100044667 3300005842 Bacteria 4106
139 Ga0068858_100045644 3300005842 Bacteria 4061
140 Ga0068860_100024087 3300005843 Bacteria 5884
141 Ga0068860_100066609 3300005843 Bacteria 3421
142 Ga0068860_100531165 3300005843 Bacteria 1177
143 Ga0068862_100021164 3300005844 Bacteria 5437
144 Ga0068862_100064993 3300005844 Bacteria 3141
145 Ga0068862_100122106 3300005844 Bacteria 2297
146 Ga0097621_100193826 3300006237 Bacteria 1761
147 Ga0068871_100750413 3300006358 Bacteria 897
148 Ga0075433_10008933 3300006852 Bacteria 8001
149 Ga0097620_100007663 3300006931 Bacteria 10972
150 Ga0097620_100017404 3300006931 Bacteria 7222
151 Ga0097620_100101529 3300006931 Bacteria 2934
152 Ga0105250_10100126 3300009092 Bacteria 1182
153 Ga0105240_10091846 3300009093 Bacteria 3708
154 Ga0105243_10637563 3300009148 Bacteria 1031
155 Ga0105241_10444437 3300009174 Bacteria 1146
156 Ga0105248_10000163 3300009177 Bacteria 77658
157 Ga0105248_10000413 3300009177 Bacteria 49136
158 Ga0105248_10026996 3300009177 Bacteria 6387
159 Ga0105248_10080318 3300009177 Bacteria 3665
160 Ga0105237_10044914 3300009545 Bacteria 4448
161 Ga0105237_10088467 3300009545 Bacteria 3087
162 Ga0105237_10599944 3300009545 Bacteria 1108
163 Ga0105238_10095659 3300009551 Bacteria 2957
164 Ga0105238_10232828 3300009551 Bacteria 1819
165 Ga0105249_10056595 3300009553 Bacteria 3590
166 Ga0105249_10064714 3300009553 Bacteria 3362
167 Ga0105239_10095795 3300010375 Bacteria 3278
168 Ga0105246_10026790 3300011119 Bacteria 3771
169 Ga0157373_10055844 3300013100 Bacteria 2805
170 Ga0157373_10180067 3300013100 Bacteria 1488
171 Ga0157373_10260308 3300013100 Unclassified 1228
172 Ga0157373_10314042 3300013100 Bacteria 1114
173 Ga0157371_10007968 3300013102 Bacteria 8502
174 Ga0157371_10019838 3300013102 Bacteria 4953
175 Ga0157371_10055890 3300013102 Bacteria 2800
176 Ga0157371_10206228 3300013102 Bacteria 1410
177 Ga0157369_10007970 3300013105 Bacteria 12172
178 Ga0157369_10072618 3300013105 Bacteria 3693
179 Ga0157369_10153154 3300013105 Bacteria 2436
180 Ga0157374_10064082 3300013296 Bacteria 3448
181 Ga0163162_10438837 3300013306 Bacteria 1438
182 Ga0157372_10059716 3300013307 Bacteria 4266
183 Ga0157372_10156824 3300013307 Bacteria 2630
184 Ga0157372_10171840 3300013307 Bacteria 2507
185 Ga0157372_10467804 3300013307 Bacteria 1469
186 Ga0157372_10782537 3300013307 Bacteria 1109
187 Ga0157375_10565720 3300013308 Bacteria 1298
188 Ga0163163_10000173 3300014325 Bacteria 67717
189 Ga0163163_10000355 3300014325 Bacteria 44183
190 Ga0182008_10188872 3300014497 Bacteria 1045
191 Ga0157377_10012534 3300014745 Bacteria 4267
192 Ga0157379_10008315 3300014968 Bacteria 9019
193 Ga0157379_10014034 3300014968 Bacteria 7021
194 Ga0157379_10141139 3300014968 Bacteria 2172
195 Ga0157379_10142749 3300014968 Unclassified 2159
196 Ga0207682_10187649 3300025893 Unclassified 946
197 Ga0207680_10005228 3300025903 Bacteria 6191
198 Ga0207647_10001281 3300025904 Bacteria 19328
199 Ga0207647_10012877 3300025904 Bacteria 5812
200 Ga0207647_10047954 3300025904 Bacteria 2654
201 Ga0207705_10000114 3300025909 Bacteria 90132
202 Ga0207705_10002195 3300025909 Bacteria 15094
203 Ga0207705_10005360 3300025909 Bacteria 9588
204 Ga0207705_10007800 3300025909 Bacteria 7858
205 Ga0207705_10014756 3300025909 Bacteria 5617
206 Ga0207654_10266390 3300025911 Bacteria 1154
207 Ga0207707_10016384 3300025912 Bacteria 6464
208 Ga0207707_10232709 3300025912 Bacteria 1603
209 Ga0207695_10566151 3300025913 Bacteria 1018
210 Ga0207660_10000241 3300025917 Bacteria 35515
211 Ga0207660_10011187 3300025917 Bacteria 5833
212 Ga0207660_10013631 3300025917 Bacteria 5330
213 Ga0207660_10100253 3300025917 Bacteria 2162
214 Ga0207660_10284549 3300025917 Bacteria 1313
215 Ga0207662_10188781 3300025918 Bacteria 1329
216 Ga0207657_10000071 3300025919 Bacteria 93725
217 Ga0207657_10006001 3300025919 Bacteria 12639
218 Ga0207657_10007218 3300025919 Bacteria 11410
219 Ga0207657_10021172 3300025919 Bacteria 6125
220 Ga0207657_10048808 3300025919 Bacteria 3694
221 Ga0207657_10068405 3300025919 Bacteria 3017
222 Ga0207657_10219099 3300025919 Bacteria 1525
223 Ga0207649_10000436 3300025920 Bacteria 30088
224 Ga0207649_10008855 3300025920 Bacteria 5496
225 Ga0207649_10234954 3300025920 Bacteria 1313
226 Ga0207652_10012703 3300025921 Bacteria 6811
227 Ga0207652_10043041 3300025921 Bacteria 3845
228 Ga0207652_10135236 3300025921 Bacteria 2201
229 Ga0207652_10144646 3300025921 Bacteria 2127
230 Ga0207652_10579719 3300025921 Bacteria 1007
231 Ga0207681_10018532 3300025923 Bacteria 4386
232 Ga0207694_10161236 3300025924 Bacteria 1811
233 Ga0207694_10192163 3300025924 Bacteria 1659
234 Ga0207664_10058136 3300025929 Bacteria 3076
235 Ga0207664_10400661 3300025929 Bacteria 1220
236 Ga0207644_10011048 3300025931 Bacteria 5965
237 Ga0207644_10023724 3300025931 Bacteria 4205
238 Ga0207690_10000045 3300025932 Bacteria 116965
239 Ga0207690_10001514 3300025932 Bacteria 14537
240 Ga0207690_10004549 3300025932 Bacteria 8192
241 Ga0207690_10007377 3300025932 Bacteria 6527
242 Ga0207690_10016977 3300025932 Bacteria 4438
243 Ga0207690_10085434 3300025932 Bacteria 2215
244 Ga0207690_10160091 3300025932 Bacteria 1677
245 Ga0207706_10000086 3300025933 Bacteria 95284
246 Ga0207706_10009166 3300025933 Bacteria 9100
247 Ga0207706_10035106 3300025933 Bacteria 4460
248 Ga0207706_10615083 3300025933 Bacteria 932
249 Ga0207691_10024700 3300025940 Bacteria 5651
250 Ga0207691_10243738 3300025940 Bacteria 1553
251 Ga0207711_10000218 3300025941 Bacteria 61467
252 Ga0207711_10002330 3300025941 Bacteria 17013
253 Ga0207711_10026803 3300025941 Bacteria 4837
254 Ga0207711_10031671 3300025941 Bacteria 4466
255 Ga0207711_10038776 3300025941 Bacteria 4051
256 Ga0207689_10004458 3300025942 Bacteria 12697
257 Ga0207689_10081410 3300025942 Bacteria 2661
258 Ga0207661_10008191 3300025944 Bacteria 7461
259 Ga0207661_10012980 3300025944 Bacteria 6079
260 Ga0207661_10124759 3300025944 Bacteria 2198
261 Ga0207661_10324631 3300025944 Bacteria 1384
262 Ga0207679_10003696 3300025945 Bacteria 9483
263 Ga0207679_10008987 3300025945 Bacteria 6385
264 Ga0207667_10002712 3300025949 Bacteria 21894
265 Ga0207667_10110739 3300025949 Bacteria 2832
266 Ga0207667_10462642 3300025949 Bacteria 1288
267 Ga0207651_10060187 3300025960 Bacteria 2635
268 Ga0207651_10118925 3300025960 Bacteria 2000
269 Ga0207712_10001363 3300025961 Bacteria 16740
270 Ga0207668_10165495 3300025972 Bacteria 1728
271 Ga0207668_10223183 3300025972 Bacteria 1514
272 Ga0207668_10297682 3300025972 Bacteria 1330
273 Ga0207640_10031822 3300025981 Bacteria 3265
274 Ga0207640_10081337 3300025981 Unclassified 2214
275 Ga0207640_10117565 3300025981 Bacteria 1898
276 Ga0207640_10241724 3300025981 Bacteria 1395
277 Ga0207640_10469319 3300025981 Bacteria 1041
278 Ga0207658_10004488 3300025986 Bacteria 9699
279 Ga0207658_10234601 3300025986 Bacteria 1550
280 Ga0207677_10048633 3300026023 Bacteria 2856
281 Ga0207703_10006561 3300026035 Bacteria 9282
282 Ga0207703_10018365 3300026035 Bacteria 5460
283 Ga0207703_10053446 3300026035 Bacteria 3283
284 Ga0207639_10000776 3300026041 Bacteria 21757
285 Ga0207639_10016918 3300026041 Bacteria 5166
286 Ga0207639_10018830 3300026041 Bacteria 4913
287 Ga0207639_10027911 3300026041 Bacteria 4116
288 Ga0207639_10030652 3300026041 Bacteria 3946
289 Ga0207639_10087058 3300026041 Bacteria 2489
290 Ga0207639_10241473 3300026041 Bacteria 1571
291 Ga0207639_10298397 3300026041 Bacteria 1423
292 Ga0207678_10005970 3300026067 Bacteria 10843
293 Ga0207678_10030453 3300026067 Bacteria 4711
294 Ga0207678_10063498 3300026067 Bacteria 3173
295 Ga0207678_10084499 3300026067 Bacteria 2714
296 Ga0207702_10016856 3300026078 Bacteria 6048
297 Ga0207702_10175407 3300026078 Unclassified 1969
298 Ga0207641_10000573 3300026088 Bacteria 40695
299 Ga0207641_10075309 3300026088 Bacteria 2914
300 Ga0207641_10089990 3300026088 Bacteria 2683
301 Ga0207641_10182237 3300026088 Bacteria 1924
302 Ga0207641_10654466 3300026088 Bacteria 1032
303 Ga0207676_10000783 3300026095 Bacteria 24809
304 Ga0207676_10077821 3300026095 Bacteria 2684
305 Ga0207674_10002909 3300026116 Bacteria 21260
306 Ga0207674_10007642 3300026116 Bacteria 12590
307 Ga0207674_10008283 3300026116 Bacteria 12040
308 Ga0207674_10127881 3300026116 Bacteria 2505
309 Ga0207674_10127882 3300026116 Bacteria 2505
310 Ga0207674_10327356 3300026116 Bacteria 1482
311 Ga0207698_10007632 3300026142 Bacteria 6782
312 Ga0207698_10009654 3300026142 Bacteria 6163
313 Ga0207698_10012706 3300026142 Bacteria 5523
314 Ga0207698_10039755 3300026142 Bacteria 3487
315 Ga0207698_10220050 3300026142 Bacteria 1715
316 Ga0268266_10069307 3300028379 Bacteria 3055
317 Ga0268265_10013521 3300028380 Bacteria 5547
318 Ga0268265_10093299 3300028380 Bacteria 2411
319 Ga0268265_10108108 3300028380 Bacteria 2263
320 Ga0268264_10011766 3300028381 Bacteria 7215
321 Ga0268264_10046256 3300028381 Bacteria 3614
322 Ga0268264_10232547 3300028381 Bacteria 1703
323 Ga0307405_10030201 3300031731 Bacteria 3176
324 Ga0307413_10038214 3300031824 Bacteria 2780
325 Ga0307410_10017304 3300031852 Bacteria 4325
326 Ga0307409_100014042 3300031995 Bacteria 5188
327 Ga0307409_100023457 3300031995 Bacteria 4276
328 Ga0307409_100124362 3300031995 Bacteria 2191
329 Ga0307416_100063936 3300032002 Bacteria 3016
330 Ga0307416_100233828 3300032002 Bacteria 1774
331 Ga0307414_10014721 3300032004 Bacteria 4700
332 Ga0307411_10235567 3300032005 Unclassified 1430
333 Ga0307415_100003904 3300032126 Bacteria 7662
334 Ga0307415_100007479 3300032126 Bacteria 5980
335 Ga0373961_0029110 3300035241 Bacteria 1528
336 Ga0373931_0027827 3300035691 Bacteria 2889
337 Ga0395899_0025226 3300037312 Bacteria 4488
338 Ga0395899_0097936 3300037312 Unclassified 2119
339 Ga0395899_0108828 3300037312 Bacteria 1994
340 Ga0395899_0253925 3300037312 Bacteria 1205
341 Ga0395900_0000803 3300037418 Bacteria 41506
342 Ga0395900_0032977 3300037418 Bacteria 5329
343 Ga0395900_0041332 3300037418 Bacteria 4753
344 Ga0395900_0045057 3300037418 Bacteria 4543
345 Ga0395900_0185808 3300037418 Bacteria 2110
346 Ga0395900_0503363 3300037418 Bacteria 1161
347 Ga0395898_0062064 3300037466 Bacteria 3630
348 Ga0395898_0079411 3300037466 Bacteria 3165
349 Ga0395898_0096020 3300037466 Bacteria 2847
350 Ga0395898_0472733 3300037466 Bacteria 1193
351 Ga0395905_0036895 3300037471 Bacteria 4591
352 Ga0395905_0045854 3300037471 Bacteria 4100
353 Ga0395905_0057463 3300037471 Bacteria 3639
354 Ga0395905_0063882 3300037471 Bacteria 3445
355 Ga0395905_0078129 3300037471 Bacteria 3101
356 Ga0395905_0090698 3300037471 Bacteria 2865
357 Ga0395905_0103037 3300037471 Unclassified 2679
358 Ga0395905_0123116 3300037471 Bacteria 2438
359 Ga0395905_0179832 3300037471 Bacteria 1985
360 Ga0395905_0333244 3300037471 Unclassified 1408
361 Ga0395905_0429696 3300037471 Bacteria 1217
362 Ga0395905_0834431 3300037471 Bacteria 824
363 Ga0395901_0001141 3300038443 Bacteria 28157
364 Ga0395901_0011748 3300038443 Bacteria 8875
365 Ga0395901_0081711 3300038443 Bacteria 3375
366 Ga0395901_0220712 3300038443 Bacteria 1981
367 Ga0395901_0288324 3300038443 Unclassified 1704
368 Ga0395901_0369751 3300038443 Bacteria 1477
369 Ga0395901_0395776 3300038443 Bacteria 1420
370 Ga0395901_0448089 3300038443 Bacteria 1320
371 Ga0395901_0598867 3300038443 Bacteria 1111
372 Ga0439455_0001571 3300042012 Bacteria 3878
373 Ga0450905_003146 3300042142 Bacteria 2159
374 Ga0450889_000555 3300042144 Bacteria 4182
375 Ga0439458_0000646 3300042157 Bacteria 8999
376 Ga0466963_0018115 3300044694 Bacteria 4397
377 Ga0466963_0022767 3300044694 Bacteria 3971
378 Ga0466963_0037146 3300044694 Bacteria 3179
379 Ga0466963_0043627 3300044694 Bacteria 2950
380 Ga0466963_0124855 3300044694 Bacteria 1774
381 Ga0466971_0160339 3300044719 Bacteria 1053
382 Ga0466957_0053985 3300044842 Bacteria 2451
383 Ga0466957_0068825 3300044842 Bacteria 2186
384 Ga0466957_0109371 3300044842 Unclassified 1751
385 Ga0466958_0094742 3300045836 Bacteria 1850
386 Ga0466967_0000192 3300045976 Bacteria 25501
387 Ga0466967_0019084 3300045976 Bacteria 5504
388 Ga0466967_0026614 3300045976 Bacteria 4793
389 Ga0466967_0065879 3300045976 Bacteria 3226
390 Ga0466967_0071636 3300045976 Bacteria 3104
391 Ga0466967_0555545 3300045976 Bacteria 1130
392 Ga0495642_0111663 3300046528 Bacteria 1169
393 Ga0495669_0052242 3300046684 Bacteria 1835
394 Ga0495669_0232287 3300046684 Unclassified 885
395 Ga0496100_0535038 3300048903 Bacteria 905
396 Ga0496101_0030116 3300048904 Bacteria 3803
397 Ga0496102_0011737 3300048905 Bacteria 7561
398 Ga0496103_0111485 3300048906 Bacteria 1738
399 Ga0496104_0047452 3300048907 Bacteria 4048
400 Ga0496105_0447173 3300048908 Unclassified 1020
401 Ga0496106_0007667 3300048909 Bacteria 7985
402 Ga0496107_0022021 3300048910 Bacteria 4501
403 Ga0496107_0023077 3300048910 Bacteria 4397
404 Ga0496108_0000676 3300048911 Bacteria 26369
405 Ga0496108_0102628 3300048911 Bacteria 2440
406 Ga0496109_0043079 3300048912 Bacteria 4091
407 Ga0496109_0301409 3300048912 Unclassified 1511
408 Ga0496110_0033042 3300048913 Bacteria 4473
409 Ga0496110_0056491 3300048913 Bacteria 3454
410 Ga0496110_0274692 3300048913 Unclassified 1534
411 Ga0496111_0053156 3300048914 Bacteria 2926
412 Ga0496111_0270382 3300048914 Bacteria 1261
413 Ga0496112_0033810 3300048915 Bacteria 4972
414 Ga0496112_0165214 3300048915 Bacteria 2179
415 Ga0496112_0433715 3300048915 Bacteria 1252
416 Ga0496113_0009478 3300048916 Bacteria 6387
417 Ga0496113_0343471 3300048916 Bacteria 1197
418 Ga0501067_0010483 3300049583 Bacteria 5131
419 Ga0501068_0139816 3300049584 Bacteria 1518
420 nmdc:mga09592_630493_c1 3300050508 Bacteria 916
421 nmdc:mga0a205_2631_c1 3300050515 Bacteria 15859
422 Ga0466962_0032656 3300061719 Bacteria 2492
423 Ga0439448_0004558
424 JGI24741J21665_1000971
425 JGI24740J21852_10006193
426 JGI24740J21852_10027945
427 JGI24740J21852_10028535
428 JGI24739J22299_10016108
429 JGI24737J22298_10004113
430 JGI24737J22298_10026247
431 JGI24735J21928_10012073
432 JGI24735J21928_10017481
433 JGI24735J21928_10023994
434 JGI24735J21928_10031895
435 JGI24735J21928_10076665
436 JGI24738J21930_10002211
437 JGI24738J21930_10041185
438 Ga0065712_10263473
439 Ga0070658_10001347
440 Ga0070658_10012460
441 Ga0070658_10379242
442 Ga0070683_100005771
443 Ga0070683_100005789
444 Ga0070683_100268923
445 Ga0070690_100031790
446 Ga0070670_100001836
447 Ga0068869_100073637
448 Ga0070666_10000168
449 Ga0070680_100003062
450 Ga0070680_100073538
451 Ga0068868_100264469
452 Ga0070660_100000009
453 Ga0070660_100022816
454 Ga0070660_100077346
455 Ga0070660_100085639
456 Ga0070660_100442725
457 Ga0070660_100589872
458 Ga0070687_100305988
459 Ga0070661_100000100
460 Ga0070661_100089202
461 Ga0070661_100111399
462 Ga0070692_10009633
463 Ga0070692_10491897
464 Ga0070668_100027417
465 Ga0070668_100031969
466 Ga0070671_100006764
467 Ga0070671_100012914
468 Ga0070671_100057522
469 Ga0070673_100077404
470 Ga0070673_100150489
471 Ga0070673_100248561
472 Ga0070659_100000981
473 Ga0070659_100009507
474 Ga0070659_100015805
475 Ga0070659_100054107
476 Ga0070659_100109335
477 Ga0070659_100119759
478 Ga0070659_100132384
479 Ga0070659_100144457
480 Ga0070659_100150974
481 Ga0070659_100176280
482 Ga0070667_100000836
483 Ga0070667_100006655
484 Ga0070667_100023527
485 Ga0070714_100042221
486 Ga0070714_100638840
487 Ga0070694_100011864
488 Ga0070663_100004141
489 Ga0070663_100004583
490 Ga0070663_100074548
491 Ga0070663_100582026
492 Ga0070662_100000035
493 Ga0070662_100039429
494 Ga0070662_100098623
495 Ga0070662_100196026
496 Ga0070681_10051007
497 Ga0070681_10055637
498 Ga0070681_10363037
499 Ga0070679_100079237
500 Ga0070679_100105409
501 Ga0070679_100489036
502 Ga0070684_100003789
503 Ga0070684_100068831
504 Ga0068853_100000409
505 Ga0068853_100006570
506 Ga0068853_100048013
507 Ga0068853_100080030
508 Ga0068853_100098900
509 Ga0068853_100132939
510 Ga0070672_100015815
511 Ga0070695_100040097
512 Ga0070693_100000322
513 Ga0070693_100110238
514 Ga0070665_100321676
515 Ga0068855_100018982
516 Ga0068855_100049492
517 Ga0068855_100060316
518 Ga0068855_100089424
519 Ga0068855_100108367
520 Ga0068855_100315842
521 Ga0070664_100000025
522 Ga0070664_100002857
523 Ga0070664_100013803
524 Ga0068857_100103752
525 Ga0068857_100105827
526 Ga0068857_100121043
527 Ga0068857_100227368
528 Ga0068854_100017451
529 Ga0068854_100035016
530 Ga0068854_100042911
531 Ga0068856_100000219
532 Ga0068856_100028999
533 Ga0068856_100078201
534 Ga0068856_100085381
535 Ga0068856_100165202
536 Ga0068852_100001450
537 Ga0068852_100011960
538 Ga0068852_100021551
539 Ga0068852_100031305
540 Ga0068852_100120524
541 Ga0068852_100390962
542 Ga0068859_100007663
543 Ga0068859_100017405
544 Ga0068859_100101529
545 Ga0068864_100000078
546 Ga0068864_100024144
547 Ga0068864_100063522
548 Ga0068864_100090555
549 Ga0068864_100233947
550 Ga0068851_10052238
551 Ga0068851_10126360
552 Ga0068851_10169725
553 Ga0068863_100000882
554 Ga0068863_100006447
555 Ga0068863_100048676
556 Ga0068863_100534684
557 Ga0068863_100694951
558 Ga0068858_100000874
559 Ga0068858_100023548
560 Ga0068858_100044667
561 Ga0068858_100045644
562 Ga0068860_100024087
563 Ga0068860_100066609
564 Ga0068860_100531165
565 Ga0068862_100021164
566 Ga0068862_100064993
567 Ga0068862_100122106
568 Ga0097621_100193826
569 Ga0068871_100750413
570 Ga0075433_10008933
571 Ga0097620_100007663
572 Ga0097620_100017404
573 Ga0097620_100101529
574 Ga0105250_10100126
575 Ga0105240_10091846
576 Ga0105243_10637563
577 Ga0105241_10444437
578 Ga0105248_10000163
579 Ga0105248_10000413
580 Ga0105248_10026996
581 Ga0105248_10080318
582 Ga0105237_10044914
583 Ga0105237_10088467
584 Ga0105237_10599944
585 Ga0105238_10095659
586 Ga0105238_10232828
587 Ga0105249_10056595
588 Ga0105249_10064714
589 Ga0105239_10095795
590 Ga0105246_10026790
591 Ga0157373_10055844
592 Ga0157373_10180067
593 Ga0157373_10260308
594 Ga0157373_10314042
595 Ga0157371_10007968
596 Ga0157371_10019838
597 Ga0157371_10055890
598 Ga0157371_10206228
599 Ga0157369_10007970
600 Ga0157369_10072618
601 Ga0157369_10153154
602 Ga0157374_10064082
603 Ga0163162_10438837
604 Ga0157372_10059716
605 Ga0157372_10156824
606 Ga0157372_10171840
607 Ga0157372_10467804
608 Ga0157372_10782537
609 Ga0157375_10565720
610 Ga0163163_10000173
611 Ga0163163_10000355
612 Ga0182008_10188872
613 Ga0157377_10012534
614 Ga0157379_10008315
615 Ga0157379_10014034
616 Ga0157379_10141139
617 Ga0157379_10142749
618 Ga0207682_10187649
619 Ga0207680_10005228
620 Ga0207647_10001281
621 Ga0207647_10012877
622 Ga0207647_10047954
623 Ga0207705_10000114
624 Ga0207705_10002195
625 Ga0207705_10005360
626 Ga0207705_10007800
627 Ga0207705_10014756
628 Ga0207654_10266390
629 Ga0207707_10016384
630 Ga0207707_10232709
631 Ga0207695_10566151
632 Ga0207660_10000241
633 Ga0207660_10011187
634 Ga0207660_10013631
635 Ga0207660_10100253
636 Ga0207660_10284549
637 Ga0207662_10188781
638 Ga0207657_10000071
639 Ga0207657_10006001
640 Ga0207657_10007218
641 Ga0207657_10021172
642 Ga0207657_10048808
643 Ga0207657_10068405
644 Ga0207657_10219099
645 Ga0207649_10000436
646 Ga0207649_10008855
647 Ga0207649_10234954
648 Ga0207652_10012703
649 Ga0207652_10043041
650 Ga0207652_10135236
651 Ga0207652_10144646
652 Ga0207652_10579719
653 Ga0207681_10018532
654 Ga0207694_10161236
655 Ga0207694_10192163
656 Ga0207664_10058136
657 Ga0207664_10400661
658 Ga0207644_10011048
659 Ga0207644_10023724
660 Ga0207690_10000045
661 Ga0207690_10001514
662 Ga0207690_10004549
663 Ga0207690_10007377
664 Ga0207690_10016977
665 Ga0207690_10085434
666 Ga0207690_10160091
667 Ga0207706_10000086
668 Ga0207706_10009166
669 Ga0207706_10035106
670 Ga0207706_10615083
671 Ga0207691_10024700
672 Ga0207691_10243738
673 Ga0207711_10000218
674 Ga0207711_10002330
675 Ga0207711_10026803
676 Ga0207711_10031671
677 Ga0207711_10038776
678 Ga0207689_10004458
679 Ga0207689_10081410
680 Ga0207661_10008191
681 Ga0207661_10012980
682 Ga0207661_10124759
683 Ga0207661_10324631
684 Ga0207679_10003696
685 Ga0207679_10008987
686 Ga0207667_10002712
687 Ga0207667_10110739
688 Ga0207667_10462642
689 Ga0207651_10060187
690 Ga0207651_10118925
691 Ga0207712_10001363
692 Ga0207668_10165495
693 Ga0207668_10223183
694 Ga0207668_10297682
695 Ga0207640_10031822
696 Ga0207640_10081337
697 Ga0207640_10117565
698 Ga0207640_10241724
699 Ga0207640_10469319
700 Ga0207658_10004488
701 Ga0207658_10234601
702 Ga0207677_10048633
703 Ga0207703_10006561
704 Ga0207703_10018365
705 Ga0207703_10053446
706 Ga0207639_10000776
707 Ga0207639_10016918
708 Ga0207639_10018830
709 Ga0207639_10027911
710 Ga0207639_10030652
711 Ga0207639_10087058
712 Ga0207639_10241473
713 Ga0207639_10298397
714 Ga0207678_10005970
715 Ga0207678_10030453
716 Ga0207678_10063498
717 Ga0207678_10084499
718 Ga0207702_10016856
719 Ga0207702_10175407
720 Ga0207641_10000573
721 Ga0207641_10075309
722 Ga0207641_10089990
723 Ga0207641_10182237
724 Ga0207641_10654466
725 Ga0207676_10000783
726 Ga0207676_10077821
727 Ga0207674_10002909
728 Ga0207674_10007642
729 Ga0207674_10008283
730 Ga0207674_10127881
731 Ga0207674_10127882
732 Ga0207674_10327356
733 Ga0207698_10007632
734 Ga0207698_10009654
735 Ga0207698_10012706
736 Ga0207698_10039755
737 Ga0207698_10220050
738 Ga0268266_10069307
739 Ga0268265_10013521
740 Ga0268265_10093299
741 Ga0268265_10108108
742 Ga0268264_10011766
743 Ga0268264_10046256
744 Ga0268264_10232547
745 Ga0307405_10030201
746 Ga0307413_10038214
747 Ga0307410_10017304
748 Ga0307409_100014042
749 Ga0307409_100023457
750 Ga0307409_100124362
751 Ga0307416_100063936
752 Ga0307416_100233828
753 Ga0307414_10014721
754 Ga0307411_10235567
755 Ga0307415_100003904
756 Ga0307415_100007479
757 Ga0373961_0029110
758 Ga0373931_0027827
759 Ga0395899_0025226
760 Ga0395899_0097936
761 Ga0395899_0108828
762 Ga0395899_0253925
763 Ga0395900_0000803
764 Ga0395900_0032977
765 Ga0395900_0041332
766 Ga0395900_0045057
767 Ga0395900_0185808
768 Ga0395900_0503363
769 Ga0395898_0062064
770 Ga0395898_0079411
771 Ga0395898_0096020
772 Ga0395898_0472733
773 Ga0395905_0036895
774 Ga0395905_0045854
775 Ga0395905_0057463
776 Ga0395905_0063882
777 Ga0395905_0078129
778 Ga0395905_0090698
779 Ga0395905_0103037
780 Ga0395905_0123116
781 Ga0395905_0179832
782 Ga0395905_0333244
783 Ga0395905_0429696
784 Ga0395905_0834431
785 Ga0395901_0001141
786 Ga0395901_0011748
787 Ga0395901_0081711
788 Ga0395901_0220712
789 Ga0395901_0288324
790 Ga0395901_0369751
791 Ga0395901_0395776
792 Ga0395901_0448089
793 Ga0395901_0598867
794 Ga0439455_0001571
795 Ga0450905_003146
796 Ga0450889_000555
797 Ga0439458_0000646
798 Ga0466963_0018115
799 Ga0466963_0022767
800 Ga0466963_0037146
801 Ga0466963_0043627
802 Ga0466963_0124855
803 Ga0466971_0160339
804 Ga0466957_0053985
805 Ga0466957_0068825
806 Ga0466957_0109371
807 Ga0466958_0094742
808 Ga0466967_0000192
809 Ga0466967_0019084
810 Ga0466967_0026614
811 Ga0466967_0065879
812 Ga0466967_0071636
813 Ga0466967_0555545
814 Ga0495642_0111663
815 Ga0495669_0052242
816 Ga0495669_0232287
817 Ga0496100_0535038
818 Ga0496101_0030116
819 Ga0496102_0011737
820 Ga0496103_0111485
821 Ga0496104_0047452
822 Ga0496105_0447173
823 Ga0496106_0007667
824 Ga0496107_0022021
825 Ga0496107_0023077
826 Ga0496108_0000676
827 Ga0496108_0102628
828 Ga0496109_0043079
829 Ga0496109_0301409
830 Ga0496110_0033042
831 Ga0496110_0056491
832 Ga0496110_0274692
833 Ga0496111_0053156
834 Ga0496111_0270382
835 Ga0496112_0033810
836 Ga0496112_0165214
837 Ga0496112_0433715
838 Ga0496113_0009478
839 Ga0496113_0343471
840 Ga0501067_0010483
841 Ga0501068_0139816
842 nmdc:mga09592_630493_c1
843 nmdc:mga0a205_2631_c1
844 Ga0466962_0032656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

5

188

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

11

229

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ztu-assembly1.cif.gz_B t190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+ 0.9054 9 228
4pn3-assembly2.cif.gz_F crystal structure of 3-hydroxyacyl-coa-dehydrogenase from brucella melitensis 0.897 4 227
3uxy-assembly1.cif.gz_D the crystal structure of short chain dehydrogenase from rhodobacter sphaeroides 0.8955 5 228
8sbw-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (apo, orthorhombic form) 0.895 5 231
5tgd-assembly1.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp 0.8946 1 239
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9323 5 40 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9185 3 170 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9076 5 175 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.907 4 181 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9054 9 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5AXY7-F1-model_v4 Short-chain dehydrogenase/reductase 0.9164 2 177 GO:0016020
GO:0016491
AF-A0A7Y2CF42-F1-model_v4 SDR family oxidoreductase 0.9108 4 235
AF-A0A352EDY6-F1-model_v4 3-oxoacyl-ACP reductase 0.9095 5 177 GO:0016491
AF-A0A6J7ELQ4-F1-model_v4 Unannotated protein 0.9041 4 228 GO:0016616
AF-A0A850KZY5-F1-model_v4 SDR family oxidoreductase 0.9039 5 229

Map