F440375

General Info

Members Datasets Scaffolds Average Seq Length
422 244 419 160

Family's Representative Sequence

Representative Sequence 3300047317|Ga0495604_0053403|Ga0495604_0053403_962_1438
Length 158
Sequence MSTMMPKALILYFRFVMAWTFLYAASHQVFVPGWTVVGFLNHTKTFHDFFAIFTTPTMAPITTFFVDHLLIGLSLLAGLMVRVSAAFGVVLMITYWFAHMDWPFIENTNNFIVDYHLVYAGVLVTLIVTRAGHVFGLDAWAENLSFVKQHPALKPLVA

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
3 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.24
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 8.06
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10061382 3300005327 Bacteria 3062
2 Ga0070683_100073289 3300005329 Bacteria 3197
3 Ga0070683_100651290 3300005329 Bacteria 1008
4 Ga0070666_10227945 3300005335 Unclassified 1315
5 Ga0070680_100033874 3300005336 Bacteria 4119
6 Ga0070680_100300316 3300005336 Bacteria 1362
7 Ga0070680_100300357 3300005336 Bacteria 1361
8 Ga0070660_100077466 3300005339 Bacteria 2605
9 Ga0070689_100856447 3300005340 Bacteria 802
10 Ga0070671_100138488 3300005355 Bacteria 2053
11 Ga0070688_100020515 3300005365 Bacteria 3844
12 Ga0070659_101446500 3300005366 Bacteria 612
13 Ga0070667_100511221 3300005367 Bacteria 1102
14 Ga0070709_10098013 3300005434 Bacteria 1947
15 Ga0070714_100044960 3300005435 Bacteria 3740
16 Ga0070714_100089725 3300005435 Bacteria 2691
17 Ga0070713_100112278 3300005436 Unclassified 2378
18 Ga0070710_10014309 3300005437 Bacteria 3991
19 Ga0070710_10017541 3300005437 Plasmid 3666
20 Ga0070710_10108014 3300005437 Bacteria 1667
21 Ga0070710_10455555 3300005437 Bacteria 868
22 Ga0070710_10665534 3300005437 Unclassified 731
23 Ga0070711_101380702 3300005439 Unclassified 613
24 Ga0070663_100039800 3300005455 Bacteria 3288
25 Ga0070678_100090064 3300005456 Unclassified 2350
26 Ga0070678_100557889 3300005456 Bacteria 1018
27 Ga0070662_100117296 3300005457 Bacteria 2036
28 Ga0070662_100603959 3300005457 Bacteria 923
29 Ga0070681_10057453 3300005458 Bacteria 3871
30 Ga0070681_10151611 3300005458 Bacteria 2244
31 Ga0070681_11250076 3300005458 Unclassified 665
32 Ga0070706_100239110 3300005467 Bacteria 1695
33 Ga0070698_100042133 3300005471 Bacteria 4683
34 Ga0070699_100000995 3300005518 Bacteria 26369
35 Ga0070699_100034096 3300005518 Bacteria 4399
36 Ga0070699_100920820 3300005518 Bacteria 801
37 Ga0070679_100102694 3300005530 Bacteria 2845
38 Ga0070679_100675952 3300005530 Bacteria 975
39 Ga0070679_100814555 3300005530 Bacteria 877
40 Ga0070684_100005196 3300005535 Bacteria 9953
41 Ga0070684_100053201 3300005535 Bacteria 3523
42 Ga0070697_100015176 3300005536 Bacteria 6049
43 Ga0068853_100139058 3300005539 Bacteria 2179
44 Ga0070696_100180744 3300005546 Unclassified 1565
45 Ga0070693_100068638 3300005547 Bacteria 2081
46 Ga0070665_100139109 3300005548 Bacteria 2432
47 Ga0068855_100172075 3300005563 Bacteria 2452
48 Ga0068855_100232884 3300005563 Bacteria 2061
49 Ga0068855_101028168 3300005563 Bacteria 864
50 Ga0070664_100182487 3300005564 Unclassified 1866
51 Ga0070664_100555625 3300005564 Bacteria 1062
52 Ga0068857_100217621 3300005577 Bacteria 1744
53 Ga0068854_100069987 3300005578 Bacteria 2563
54 Ga0068859_100534227 3300005617 Unclassified 1267
55 Ga0068864_100826748 3300005618 Unclassified 911
56 Ga0068863_100104836 3300005841 Bacteria 2690
57 Ga0068863_100903922 3300005841 Bacteria 883
58 Ga0081455_10129276 3300005937 Bacteria 1977
59 Ga0081540_1021322 3300005983 Bacteria 3863
60 Ga0070717_10004907 3300006028 Bacteria 9730
61 Ga0070717_10035317 3300006028 Bacteria 4045
62 Ga0070717_10143002 3300006028 Unclassified 2065
63 Ga0070717_10271937 3300006028 Bacteria 1501
64 Ga0070715_10142039 3300006163 Unclassified 1167
65 Ga0070715_10147774 3300006163 Bacteria 1148
66 Ga0070716_100645948 3300006173 Bacteria 802
67 Ga0070712_100015178 3300006175 Bacteria 4954
68 Ga0070712_100026255 3300006175 Bacteria 3878
69 Ga0070712_100563947 3300006175 Unclassified 961
70 Ga0070712_100815699 3300006175 Unclassified 801
71 Ga0070712_101029392 3300006175 Bacteria 713
72 Ga0068871_100102933 3300006358 Bacteria 2394
73 Ga0068871_100147247 3300006358 Bacteria 2006
74 Ga0075433_10127749 3300006852 Bacteria 2258
75 Ga0075434_100058101 3300006871 Bacteria 3845
76 Ga0068865_100507667 3300006881 Unclassified 1006
77 Ga0075436_100269513 3300006914 Bacteria 1216
78 Ga0097620_100534233 3300006931 Unclassified 1267
79 Ga0075435_100214447 3300007076 Unclassified 1634
80 Ga0075435_100539121 3300007076 Bacteria 1010
81 Ga0105251_10032205 3300009011 Bacteria 2615
82 Ga0105240_10037246 3300009093 Bacteria 6252
83 Ga0105240_10108770 3300009093 Bacteria 3358
84 Ga0111539_10268063 3300009094 Bacteria 1988
85 Ga0114129_10028547 3300009147 Bacteria 7906
86 Ga0105243_10120837 3300009148 Unclassified 2208
87 Ga0105243_10338209 3300009148 Bacteria 1378
88 Ga0105241_10644206 3300009174 Unclassified 962
89 Ga0105241_10952875 3300009174 Bacteria 800
90 Ga0105242_10200348 3300009176 Bacteria 1773
91 Ga0105248_10636658 3300009177 Unclassified 1203
92 Ga0105238_10760049 3300009551 Bacteria 983
93 Ga0105246_10077215 3300011119 Bacteria 2362
94 Ga0157373_10053097 3300013100 Bacteria 2882
95 Ga0157373_10160790 3300013100 Bacteria 1580
96 Ga0157373_10665054 3300013100 Bacteria 761
97 Ga0157373_10713604 3300013100 Bacteria 735
98 Ga0157371_10105980 3300013102 Bacteria 1995
99 Ga0157371_10356718 3300013102 Bacteria 1065
100 Ga0157370_10100021 3300013104 Bacteria 2717
101 Ga0157370_10877021 3300013104 Unclassified 815
102 Ga0157369_10076116 3300013105 Bacteria 3597
103 Ga0157369_10924423 3300013105 Bacteria 894
104 Ga0157374_10002982 3300013296 Bacteria 14172
105 Ga0157374_10756784 3300013296 Bacteria 986
106 Ga0157378_10049511 3300013297 Bacteria 3738
107 Ga0157378_10639247 3300013297 Bacteria 1079
108 Ga0163162_10023017 3300013306 Bacteria 6144
109 Ga0163162_11760478 3300013306 Bacteria 708
110 Ga0157372_10090178 3300013307 Bacteria 3484
111 Ga0157372_10398349 3300013307 Bacteria 1604
112 Ga0157372_10765695 3300013307 Bacteria 1122
113 Ga0157375_10069339 3300013308 Bacteria 3532
114 Ga0157375_10889074 3300013308 Bacteria 1035
115 Ga0163163_11193290 3300014325 Bacteria 824
116 Ga0157380_10322837 3300014326 Bacteria 1432
117 Ga0182008_10062914 3300014497 Bacteria 1828
118 Ga0182008_10200031 3300014497 Bacteria 1016
119 Ga0157376_10024378 3300014969 Bacteria 4748
120 Ga0157376_10388846 3300014969 Bacteria 1346
121 Ga0157376_10460340 3300014969 Bacteria 1243
122 Ga0182006_1121307 3300015261 Bacteria 908
123 Ga0213872_10096248 3300021361 Bacteria 1322
124 Ga0207692_10014453 3300025898 Plasmid 3449
125 Ga0207692_10501595 3300025898 Bacteria 770
126 Ga0207680_10235144 3300025903 Unclassified 1260
127 Ga0207685_10273700 3300025905 Unclassified 826
128 Ga0207699_10015268 3300025906 Bacteria 3985
129 Ga0207699_10682051 3300025906 Bacteria 751
130 Ga0207705_10046717 3300025909 Bacteria 3112
131 Ga0207705_10186293 3300025909 Bacteria 1568
132 Ga0207684_10031621 3300025910 Bacteria 4501
133 Ga0207707_10039500 3300025912 Bacteria 4124
134 Ga0207695_10163764 3300025913 Bacteria 2153
135 Ga0207695_10304807 3300025913 Bacteria 1484
136 Ga0207693_10007243 3300025915 Bacteria 9131
137 Ga0207693_10033810 3300025915 Plasmid 4033
138 Ga0207693_10385515 3300025915 Unclassified 1096
139 Ga0207693_10762419 3300025915 Unclassified 747
140 Ga0207663_10142844 3300025916 Bacteria 1670
141 Ga0207660_10387029 3300025917 Bacteria 1125
142 Ga0207657_10713045 3300025919 Bacteria 779
143 Ga0207652_10086948 3300025921 Bacteria 2741
144 Ga0207652_10101678 3300025921 Bacteria 2539
145 Ga0207652_10576893 3300025921 Bacteria 1010
146 Ga0207700_10186342 3300025928 Unclassified 1741
147 Ga0207700_10328580 3300025928 Bacteria 1327
148 Ga0207664_10062494 3300025929 Bacteria 2974
149 Ga0207664_10144812 3300025929 Bacteria 2014
150 Ga0207664_10298220 3300025929 Bacteria 1417
151 Ga0207664_10384371 3300025929 Bacteria 1246
152 Ga0207664_10688402 3300025929 Unclassified 919
153 Ga0207706_11003433 3300025933 Bacteria 701
154 Ga0207670_11079127 3300025936 Unclassified 677
155 Ga0207704_11163917 3300025938 Unclassified 657
156 Ga0207665_10085180 3300025939 Bacteria 2182
157 Ga0207665_10136560 3300025939 Bacteria 1745
158 Ga0207711_10049162 3300025941 Bacteria 3610
159 Ga0207661_10220162 3300025944 Bacteria 1677
160 Ga0207661_10622862 3300025944 Bacteria 991
161 Ga0207667_10153179 3300025949 Bacteria 2372
162 Ga0207667_10335577 3300025949 Bacteria 1543
163 Ga0207640_10554267 3300025981 Bacteria 966
164 Ga0207703_11646885 3300026035 Unclassified 617
165 Ga0207639_10248305 3300026041 Bacteria 1551
166 Ga0207708_11273066 3300026075 Unclassified 644
167 Ga0207702_10925226 3300026078 Bacteria 864
168 Ga0207641_10142056 3300026088 Bacteria 2167
169 Ga0207676_10572685 3300026095 Unclassified 1081
170 Ga0207674_10315218 3300026116 Unclassified 1513
171 Ga0207683_10277182 3300026121 Bacteria 1532
172 Ga0207683_10631077 3300026121 Unclassified 992
173 Ga0268266_10082761 3300028379 Unclassified 2800
174 Ga0268264_10227388 3300028381 Unclassified 1721
175 Ga0265318_10010184 3300028577 Bacteria 4105
176 Ga0265330_10089429 3300031235 Bacteria 1323
177 Ga0265332_10011180 3300031238 Bacteria 3989
178 Ga0265332_10072535 3300031238 Bacteria 1466
179 Ga0265325_10000052 3300031241 Bacteria 78471
180 Ga0265325_10062949 3300031241 Bacteria 1878
181 Ga0265325_10069661 3300031241 Bacteria 1768
182 Ga0265325_10074347 3300031241 Bacteria 1700
183 Ga0265325_10084916 3300031241 Bacteria 1569
184 Ga0265329_10016987 3300031242 Bacteria 2512
185 Ga0265329_10057887 3300031242 Bacteria 1228
186 Ga0265329_10234085 3300031242 Unclassified 610
187 Ga0265340_10021297 3300031247 Bacteria 3325
188 Ga0265340_10021424 3300031247 Bacteria 3316
189 Ga0265340_10028435 3300031247 Bacteria 2812
190 Ga0265340_10097420 3300031247 Bacteria 1369
191 Ga0265340_10119642 3300031247 Bacteria 1212
192 Ga0265339_10011191 3300031249 Bacteria 5537
193 Ga0265339_10030799 3300031249 Bacteria 3035
194 Ga0265331_10017186 3300031250 Bacteria 3779
195 Ga0265331_10051500 3300031250 Bacteria 1970
196 Ga0265316_10173927 3300031344 Bacteria 1605
197 Ga0265316_10450938 3300031344 Bacteria 922
198 Ga0265313_10000008 3300031595 Bacteria 173405
199 Ga0265313_10026117 3300031595 Bacteria 3083
200 Ga0265313_10028804 3300031595 Bacteria 2881
201 Ga0265313_10037828 3300031595 Bacteria 2408
202 Ga0265342_10001784 3300031712 Bacteria 19600
203 Ga0265342_10012513 3300031712 Bacteria 5743
204 Ga0265342_10107319 3300031712 Bacteria 1584
205 Ga0316587_1090471 3300033529 Bacteria 583
206 Ga0373926_0014690 3300035083 Bacteria 2664
207 Ga0373923_0124497 3300035111 Bacteria 1154
208 Ga0373936_0373819 3300035113 Bacteria 651
209 Ga0373939_0302321 3300035114 Bacteria 638
210 Ga0373945_0006206 3300035116 Bacteria 3846
211 Ga0373954_0027909 3300035118 Bacteria 2593
212 Ga0373954_0081967 3300035118 Bacteria 1542
213 Ga0373956_0076598 3300035119 Archaea 1531
214 Ga0373943_0025268 3300035170 Bacteria 2776
215 Ga0373943_0029860 3300035170 Bacteria 2577
216 Ga0373946_0018185 3300035171 Bacteria 2696
217 Ga0373955_0253088 3300035172 Bacteria 1056
218 Ga0373924_0009995 3300035410 Bacteria 3492
219 Ga0373935_0121606 3300035692 Bacteria 1745
220 Ga0373935_0523513 3300035692 Bacteria 862
221 Ga0373935_1119429 3300035692 Bacteria 586
222 Ga0373927_0052016 3300035695 Bacteria 2649
223 Ga0373927_0591905 3300035695 Bacteria 733
224 Ga0373933_0020533 3300035724 Bacteria 3745
225 Ga0373933_0158396 3300035724 Bacteria 1437
226 Ga0373947_0090801 3300035725 Bacteria 1904
227 Ga0373947_0149871 3300035725 Bacteria 1501
228 Ga0373947_0417743 3300035725 Bacteria 906
229 Ga0373937_0052670 3300036401 Bacteria 3732
230 Ga0373925_0017650 3300037068 Bacteria 5178
231 Ga0373925_0133426 3300037068 Bacteria 1938
232 Ga0395899_0026752 3300037312 Bacteria 4352
233 Ga0395900_0040807 3300037418 Bacteria 4784
234 Ga0395900_0081949 3300037418 Bacteria 3314
235 Ga0395900_0090969 3300037418 Bacteria 3136
236 Ga0395900_0301454 3300037418 Bacteria 1588
237 Ga0395898_0145724 3300037466 Bacteria 2266
238 Ga0395901_0040068 3300038443 Bacteria 4850
239 Ga0395901_0043167 3300038443 Bacteria 4677
240 Ga0395901_0079277 3300038443 Bacteria 3429
241 Ga0436361_0544746 3300039447 Bacteria 1587
242 Ga0436361_0993144 3300039447 Bacteria 1155
243 Ga0436362_0365207 3300039453 Unclassified 638
244 Ga0495592_0015735 3300046454 Bacteria 5738
245 Ga0495592_0079538 3300046454 Bacteria 2373
246 Ga0495592_0766523 3300046454 Bacteria 575
247 Ga0495603_0048834 3300046455 Bacteria 2519
248 Ga0495629_0067971 3300046459 Bacteria 2486
249 Ga0495629_0144902 3300046459 Bacteria 1652
250 Ga0495641_0014221 3300046461 Bacteria 4317
251 Ga0495641_0075901 3300046461 Bacteria 1507
252 Ga0495651_0007960 3300046462 Bacteria 8126
253 Ga0495651_0348988 3300046462 Bacteria 978
254 Ga0495653_0033585 3300046463 Bacteria 4063
255 Ga0495653_0134261 3300046463 Bacteria 1747
256 Ga0495580_0032083 3300046472 Bacteria 3792
257 Ga0495580_0307049 3300046472 Bacteria 1080
258 Ga0495582_0025029 3300046473 Bacteria 3269
259 Ga0495639_0028094 3300046475 Bacteria 2492
260 Ga0495662_0007383 3300046476 Bacteria 5430
261 Ga0495662_0035945 3300046476 Bacteria 2391
262 Ga0495664_0014507 3300046477 Bacteria 4468
263 Ga0495664_0204408 3300046477 Bacteria 1196
264 Ga0495584_0307816 3300046491 Unclassified 805
265 Ga0495585_0047456 3300046492 Bacteria 2392
266 Ga0495594_0025889 3300046499 Bacteria 3154
267 Ga0495594_0317004 3300046499 Bacteria 888
268 Ga0495607_0364731 3300046501 Bacteria 664
269 Ga0495608_0001202 3300046511 Bacteria 18375
270 Ga0495608_0089005 3300046511 Bacteria 1998
271 Ga0495618_0022789 3300046514 Bacteria 3868
272 Ga0495618_0028441 3300046514 Bacteria 3483
273 Ga0495618_0242777 3300046514 Bacteria 1132
274 Ga0495630_0024973 3300046517 Bacteria 4417
275 Ga0495630_0039573 3300046517 Bacteria 3525
276 Ga0495630_0706705 3300046517 Bacteria 771
277 Ga0495644_0050151 3300046523 Bacteria 1567
278 Ga0495666_0109722 3300046526 Bacteria 1296
279 Ga0495652_0042798 3300046529 Bacteria 3904
280 Ga0495652_0158436 3300046529 Bacteria 1760
281 Ga0495665_0037217 3300046531 Bacteria 2597
282 Ga0495665_0040734 3300046531 Unclassified 2473
283 Ga0495665_0298721 3300046531 Bacteria 825
284 Ga0495640_0005285 3300046533 Bacteria 10262
285 Ga0495640_0063909 3300046533 Bacteria 2490
286 Ga0495586_0036227 3300046535 Bacteria 2648
287 Ga0495587_0003946 3300046536 Bacteria 9838
288 Ga0495587_0051060 3300046536 Bacteria 2446
289 Ga0495645_0136602 3300046543 Bacteria 1714
290 Ga0495622_0018813 3300046557 Bacteria 3217
291 Ga0495633_0037406 3300046558 Bacteria 2322
292 Ga0495667_0001632 3300046559 Bacteria 14851
293 Ga0495667_0032858 3300046559 Bacteria 3474
294 Ga0495667_0223386 3300046559 Bacteria 1202
295 Ga0495634_0021979 3300046642 Bacteria 4499
296 Ga0495634_0041514 3300046642 Unclassified 3123
297 Ga0495634_0245635 3300046642 Bacteria 1096
298 Ga0495634_0343149 3300046642 Bacteria 895
299 Ga0495635_0034228 3300046663 Bacteria 3523
300 Ga0495661_0606424 3300046665 Bacteria 514
301 Ga0495588_0068722 3300046674 Bacteria 1840
302 Ga0495657_0037585 3300046675 Bacteria 3336
303 Ga0495599_0014038 3300046678 Bacteria 4959
304 Ga0495599_0096624 3300046678 Unclassified 1842
305 Ga0495623_0039434 3300046679 Bacteria 3018
306 Ga0495646_0023391 3300046680 Bacteria 3890
307 Ga0495646_0092307 3300046680 Bacteria 1746
308 Ga0495647_0015063 3300046681 Bacteria 2703
309 Ga0495658_0065839 3300046683 Bacteria 2091
310 Ga0495613_0064917 3300046689 Bacteria 2668
311 Ga0495613_0168700 3300046689 Bacteria 1554
312 Ga0495624_0053165 3300046690 Bacteria 2557
313 Ga0495600_0028328 3300046809 Bacteria 3623
314 Ga0495600_0035604 3300046809 Bacteria 3234
315 Ga0495581_0271431 3300047315 Bacteria 991
316 Ga0495604_0011863 3300047317 Bacteria 6931
317 Ga0495604_0053403 3300047317 Bacteria 3123
318 Ga0495674_0004082 3300047319 Bacteria 14126
319 Ga0495674_0014838 3300047319 Bacteria 7289
320 Ga0495674_1285847 3300047319 Unclassified 549
321 Ga0495676_0078085 3300047321 Bacteria 2522
322 Ga0495676_0249759 3300047321 Bacteria 1210
323 Ga0495676_0694987 3300047321 Bacteria 658
324 Ga0495680_0015838 3300047322 Bacteria 6490
325 Ga0495680_0034361 3300047322 Bacteria 4094
326 Ga0495675_0026881 3300047444 Bacteria 3668
327 Ga0495684_0039229 3300047471 Bacteria 3630
328 Ga0495684_0088401 3300047471 Unclassified 2348
329 Ga0495684_0108427 3300047471 Bacteria 2097
330 Ga0495593_0053675 3300047673 Unclassified 2126
331 Ga0495602_0052740 3300048088 Bacteria 3609
332 Ga0495614_0034888 3300048089 Bacteria 2162
333 Ga0496100_0058615 3300048903 Bacteria 2528
334 Ga0496100_0286981 3300048903 Unclassified 1228
335 Ga0496100_0681631 3300048903 Unclassified 801
336 Ga0496101_0001317 3300048904 Bacteria 14853
337 Ga0496101_0191380 3300048904 Bacteria 1579
338 Ga0496101_0541259 3300048904 Unclassified 920
339 Ga0496101_1128290 3300048904 Bacteria 615
340 Ga0496102_0003389 3300048905 Bacteria 13515
341 Ga0496103_0108308 3300048906 Bacteria 1763
342 Ga0496104_0000656 3300048907 Bacteria 29652
343 Ga0496104_0451553 3300048907 Unclassified 1197
344 Ga0496104_0519141 3300048907 Bacteria 1102
345 Ga0496104_0748108 3300048907 Unclassified 884
346 Ga0496104_1059765 3300048907 Bacteria 714
347 Ga0496105_0000984 3300048908 Bacteria 19611
348 Ga0496105_0003865 3300048908 Bacteria 11195
349 Ga0496105_0167809 3300048908 Bacteria 1800
350 Ga0496105_0737077 3300048908 Unclassified 754
351 Ga0496106_0158762 3300048909 Unclassified 1787
352 Ga0496106_0932915 3300048909 Bacteria 684
353 Ga0496107_0012442 3300048910 Bacteria 5941
354 Ga0496107_0486521 3300048910 Bacteria 915
355 Ga0496108_0022166 3300048911 Bacteria 5221
356 Ga0496108_0044575 3300048911 Bacteria 3701
357 Ga0496110_0022862 3300048913 Bacteria 5312
358 Ga0496111_0002841 3300048914 Bacteria 10564
359 Ga0496112_0402470 3300048915 Bacteria 1308
360 Ga0496113_0003401 3300048916 Bacteria 9520
361 Ga0496113_0328874 3300048916 Unclassified 1225
362 Ga0496114_0396899 3300048917 Bacteria 1221
363 Ga0496114_0825327 3300048917 Unclassified 806
364 Ga0496115_0032561 3300048918 Bacteria 4112
365 Ga0496115_0114078 3300048918 Bacteria 2221
366 Ga0496115_0186209 3300048918 Unclassified 1715
367 Ga0501034_0089063 3300049571 Bacteria 3084
368 Ga0501037_0044060 3300049573 Bacteria 3278
369 Ga0501039_0302604 3300049575 Bacteria 1257
370 Ga0501040_0063995 3300049576 Bacteria 2532
371 Ga0501040_1134153 3300049576 Unclassified 567
372 Ga0501041_0187564 3300049577 Unclassified 1295
373 Ga0501043_0145242 3300049579 Bacteria 1858
374 Ga0501046_0130260 3300049580 Unclassified 1908
375 Ga0501046_0134680 3300049580 Bacteria 1872
376 Ga0501046_0546169 3300049580 Bacteria 826
377 Ga0501047_0322472 3300049581 Bacteria 1384
378 Ga0501070_0030607 3300049586 Bacteria 4510
379 Ga0501073_0333755 3300049589 Bacteria 1047
380 Ga0501074_0092936 3300049590 Bacteria 2160
381 Ga0501074_0137161 3300049590 Bacteria 1750
382 Ga0501075_0062487 3300049591 Bacteria 2807
383 Ga0501075_0102132 3300049591 Bacteria 2178
384 Ga0501076_0508203 3300049592 Unclassified 993
385 Ga0501076_0582286 3300049592 Unclassified 923
386 Ga0501079_0097373 3300049741 Unclassified 2281
387 Ga0501079_0110063 3300049741 Bacteria 2140
388 Ga0501079_0506441 3300049741 Unclassified 949
389 Ga0501080_0510774 3300049742 Bacteria 1073
390 Ga0501081_0054131 3300049743 Bacteria 2772
391 Ga0501081_0064234 3300049743 Bacteria 2549
392 Ga0501083_0041218 3300049744 Bacteria 3131
393 Ga0501083_0147112 3300049744 Bacteria 1543
394 Ga0501035_0331753 3300049822 Bacteria 1276
395 Ga0501044_0834017 3300049823 Bacteria 799
396 nmdc:mga05p37_19716_c1 3300050507 Bacteria 8159
397 nmdc:mga09592_557999_c1 3300050508 Unclassified 983
398 nmdc:mga08y16_351922_c1 3300050511 Bacteria 1513
399 nmdc:mga0n895_195647_c1 3300050512 Bacteria 2053
400 nmdc:mga0n895_68883_c1 3300050512 Bacteria 3505
401 nmdc:mga0rr50_626090_c1 3300050513 Bacteria 918
402 nmdc:mga0rr50_698492_c1 3300050513 Unclassified 866
403 nmdc:mga08x19_323906_c1 3300050514 Bacteria 1073
404 Ga0495601_0001438 3300053077 Bacteria 13118
405 Ga0495601_0004668 3300053077 Bacteria 7931
406 Ga0495601_0136580 3300053077 Bacteria 1598
407 Ga0495612_0015683 3300053078 Bacteria 3037
408 Ga0495612_0017423 3300053078 Bacteria 2877
409 Ga0495595_0000491 3300053084 Bacteria 15085
410 Ga0495595_0011588 3300053084 Bacteria 3690
411 Ga0495619_0013116 3300053085 Bacteria 5222
412 Ga0495619_0106260 3300053085 Bacteria 1914
413 Ga0495619_0156322 3300053085 Bacteria 1573
414 Ga0495619_0524879 3300053085 Bacteria 813
415 Ga0500618_061907 3300053125 Bacteria 842
416 Ga0501084_0013235 3300054114 Bacteria 6827
417 Ga0501084_0352008 3300054114 Bacteria 1244
418 Ga0501082_0025055 3300060353 Bacteria 5139
419 Ga0501082_0169949 3300060353 Bacteria 1895

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035114 Ga0373939_0302321 Ga0373939_0302321_113_547 144
2 3300035692 Ga0373935_0523513 Ga0373935_0523513_418_852 144
3 3300037068 Ga0373925_0133426 Ga0373925_0133426_34_468 144
4 3300046642 Ga0495634_0343149 Ga0495634_0343149_34_468 144
5 3300048903 Ga0496100_0681631 Ga0496100_0681631_14_448 144
6 3300031242 Ga0265329_10057887 Ga0265329_100578872 152
7 3300005437 Ga0070710_10455555 Ga0070710_104555551 155
8 iso_pu_bacteria 2738541317 2738945259 155
9 iso_pu_bacteria 2913308742 2913309961 155
10 3300005841 Ga0068863_100903922 Ga0068863_1009039221 156
11 3300006852 Ga0075433_10127749 Ga0075433_101277493 156
12 3300009011 Ga0105251_10032205 Ga0105251_100322053 156
13 3300009094 Ga0111539_10268063 Ga0111539_102680633 156
14 3300009148 Ga0105243_10120837 Ga0105243_101208373 156
15 3300009174 Ga0105241_10644206 Ga0105241_106442061 156
16 3300009176 Ga0105242_10200348 Ga0105242_102003483 156
17 3300011119 Ga0105246_10077215 Ga0105246_100772151 156
18 3300013104 Ga0157370_10877021 Ga0157370_108770212 156
19 3300013296 Ga0157374_10002982 Ga0157374_1000298219 156
20 3300013297 Ga0157378_10049511 Ga0157378_100495114 156
21 3300013297 Ga0157378_10639247 Ga0157378_106392473 156
22 3300013306 Ga0163162_10023017 Ga0163162_100230172 156
23 3300013306 Ga0163162_11760478 Ga0163162_117604781 156
24 3300013307 Ga0157372_10765695 Ga0157372_107656952 156
25 3300014969 Ga0157376_10388846 Ga0157376_103888461 156
26 3300031241 Ga0265325_10084916 Ga0265325_100849161 156
27 3300047321 Ga0495676_0694987 Ga0495676_0694987_10_480 156
28 3300048903 Ga0496100_0286981 Ga0496100_0286981_679_1149 156
29 3300048904 Ga0496101_0001317 Ga0496101_0001317_9312_9782 156
30 3300048904 Ga0496101_0541259 Ga0496101_0541259_338_808 156
31 3300048904 Ga0496101_1128290 Ga0496101_1128290_133_603 156
32 3300048905 Ga0496102_0003389 Ga0496102_0003389_4659_5129 156
33 3300048906 Ga0496103_0108308 Ga0496103_0108308_46_516 156
34 3300048907 Ga0496104_0000656 Ga0496104_0000656_15959_16429 156
35 3300048907 Ga0496104_0451553 Ga0496104_0451553_293_763 156
36 3300048907 Ga0496104_0748108 Ga0496104_0748108_307_777 156
37 3300048908 Ga0496105_0000984 Ga0496105_0000984_10638_11108 156
38 3300048908 Ga0496105_0003865 Ga0496105_0003865_7399_7869 156
39 3300048908 Ga0496105_0167809 Ga0496105_0167809_279_749 156
40 3300048908 Ga0496105_0737077 Ga0496105_0737077_113_583 156
41 3300048909 Ga0496106_0158762 Ga0496106_0158762_553_1023 156
42 3300048909 Ga0496106_0932915 Ga0496106_0932915_92_562 156
43 3300048910 Ga0496107_0012442 Ga0496107_0012442_4919_5389 156
44 3300048910 Ga0496107_0486521 Ga0496107_0486521_254_724 156
45 3300048911 Ga0496108_0022166 Ga0496108_0022166_4396_4866 156
46 3300048911 Ga0496108_0044575 Ga0496108_0044575_551_1021 156
47 3300048913 Ga0496110_0022862 Ga0496110_0022862_3799_4269 156
48 3300048914 Ga0496111_0002841 Ga0496111_0002841_1218_1688 156
49 3300048915 Ga0496112_0402470 Ga0496112_0402470_160_630 156
50 3300048916 Ga0496113_0003401 Ga0496113_0003401_2679_3149 156
51 3300048916 Ga0496113_0328874 Ga0496113_0328874_477_947 156
52 3300048917 Ga0496114_0825327 Ga0496114_0825327_80_550 156
53 3300048918 Ga0496115_0114078 Ga0496115_0114078_1401_1871 156
54 3300048918 Ga0496115_0186209 Ga0496115_0186209_504_974 156
55 3300050511 nmdc:mga08y16_351922_c1 nmdc:mga08y16_351922_c1_434_904 156
56 3300054114 Ga0501084_0013235 Ga0501084_0013235_3365_3835 156
57 3300060353 Ga0501082_0025055 Ga0501082_0025055_881_1351 156
58 3300035692 Ga0373935_1119429 Ga0373935_1119429_92_565 157
59 3300035695 Ga0373927_0591905 Ga0373927_0591905_154_627 157
60 3300035725 Ga0373947_0149871 Ga0373947_0149871_687_1160 157
61 3300046454 Ga0495592_0766523 Ga0495592_0766523_13_486 157
62 3300046459 Ga0495629_0144902 Ga0495629_0144902_320_793 157
63 3300046461 Ga0495641_0014221 Ga0495641_0014221_3250_3723 157
64 3300046462 Ga0495651_0348988 Ga0495651_0348988_31_504 157
65 3300046472 Ga0495580_0307049 Ga0495580_0307049_151_624 157
66 3300046473 Ga0495582_0025029 Ga0495582_0025029_694_1167 157
67 3300046476 Ga0495662_0035945 Ga0495662_0035945_60_533 157
68 3300046517 Ga0495630_0024973 Ga0495630_0024973_1797_2270 157
69 3300046517 Ga0495630_0706705 Ga0495630_0706705_56_529 157
70 3300046533 Ga0495640_0063909 Ga0495640_0063909_1683_2156 157
71 3300046809 Ga0495600_0028328 Ga0495600_0028328_2371_2844 157
72 3300047319 Ga0495674_1285847 Ga0495674_1285847_42_515 157
73 3300053077 Ga0495601_0004668 Ga0495601_0004668_4252_4725 157
74 3300053078 Ga0495612_0017423 Ga0495612_0017423_237_710 157
75 3300053084 Ga0495595_0011588 Ga0495595_0011588_1651_2124 157
76 3300053085 Ga0495619_0013116 Ga0495619_0013116_2761_3234 157
77 iso_pu_bacteria 2643221547 2643757765 157
78 3300009177 Ga0105248_10636658 Ga0105248_106366582 158
79 3300046499 Ga0495594_0317004 Ga0495594_0317004_263_739 158
80 3300047317 Ga0495604_0053403 Ga0495604_0053403_962_1438 158
81 3300014326 Ga0157380_10322837 Ga0157380_103228372 159
82 3300026075 Ga0207708_11273066 Ga0207708_112730661 159
83 3300049573 Ga0501037_0044060 Ga0501037_0044060_52_567 159
84 3300049575 Ga0501039_0302604 Ga0501039_0302604_765_1244 159
85 3300049581 Ga0501047_0322472 Ga0501047_0322472_105_620 159
86 3300049586 Ga0501070_0030607 Ga0501070_0030607_252_767 159
87 3300049823 Ga0501044_0834017 Ga0501044_0834017_33_512 159
88 3300005329 Ga0070683_100651290 Ga0070683_1006512901 160
89 3300005335 Ga0070666_10227945 Ga0070666_102279452 160
90 3300005340 Ga0070689_100856447 Ga0070689_1008564471 160
91 3300005355 Ga0070671_100138488 Ga0070671_1001384882 160
92 3300005365 Ga0070688_100020515 Ga0070688_1000205153 160
93 3300005367 Ga0070667_100511221 Ga0070667_1005112211 160
94 3300005437 Ga0070710_10665534 Ga0070710_106655342 160
95 3300005439 Ga0070711_101380702 Ga0070711_1013807021 160
96 3300005455 Ga0070663_100039800 Ga0070663_1000398005 160
97 3300005535 Ga0070684_100005196 Ga0070684_10000519614 160
98 3300005548 Ga0070665_100139109 Ga0070665_1001391093 160
99 3300005564 Ga0070664_100182487 Ga0070664_1001824873 160
100 3300005617 Ga0068859_100534227 Ga0068859_1005342273 160
101 3300005618 Ga0068864_100826748 Ga0068864_1008267482 160
102 3300005841 Ga0068863_100104836 Ga0068863_1001048364 160
103 3300005937 Ga0081455_10129276 Ga0081455_101292762 160
104 3300006028 Ga0070717_10143002 Ga0070717_101430023 160
105 3300006028 Ga0070717_10271937 Ga0070717_102719372 160
106 3300006163 Ga0070715_10142039 Ga0070715_101420392 160
107 3300006358 Ga0068871_100102933 Ga0068871_1001029335 160
108 3300006881 Ga0068865_100507667 Ga0068865_1005076671 160
109 3300006931 Ga0097620_100534233 Ga0097620_1005342333 160
110 3300025903 Ga0207680_10235144 Ga0207680_102351442 160
111 3300025906 Ga0207699_10682051 Ga0207699_106820511 160
112 3300025919 Ga0207657_10713045 Ga0207657_107130451 160
113 3300025928 Ga0207700_10186342 Ga0207700_101863422 160
114 3300025928 Ga0207700_10328580 Ga0207700_103285802 160
115 3300025929 Ga0207664_10298220 Ga0207664_102982202 160
116 3300025936 Ga0207670_11079127 Ga0207670_110791271 160
117 3300025938 Ga0207704_11163917 Ga0207704_111639172 160
118 3300025941 Ga0207711_10049162 Ga0207711_100491626 160
119 3300025944 Ga0207661_10622862 Ga0207661_106228622 160
120 3300026035 Ga0207703_11646885 Ga0207703_116468851 160
121 3300026088 Ga0207641_10142056 Ga0207641_101420561 160
122 3300026095 Ga0207676_10572685 Ga0207676_105726852 160
123 3300026121 Ga0207683_10631077 Ga0207683_106310772 160
124 3300028379 Ga0268266_10082761 Ga0268266_100827612 160
125 3300028381 Ga0268264_10227388 Ga0268264_102273881 160
126 3300031242 Ga0265329_10234085 Ga0265329_102340851 160
127 3300031247 Ga0265340_10119642 Ga0265340_101196422 160
128 3300035083 Ga0373926_0014690 Ga0373926_0014690_1242_1724 160
129 3300035116 Ga0373945_0006206 Ga0373945_0006206_2695_3177 160
130 3300035118 Ga0373954_0081967 Ga0373954_0081967_502_984 160
131 3300035119 Ga0373956_0076598 Ga0373956_0076598_790_1272 160
132 3300035170 Ga0373943_0029860 Ga0373943_0029860_1007_1489 160
133 3300035171 Ga0373946_0018185 Ga0373946_0018185_1550_2032 160
134 3300035695 Ga0373927_0052016 Ga0373927_0052016_705_1187 160
135 3300035724 Ga0373933_0158396 Ga0373933_0158396_561_1043 160
136 3300035725 Ga0373947_0090801 Ga0373947_0090801_1198_1680 160
137 3300037068 Ga0373925_0017650 Ga0373925_0017650_2600_3082 160
138 3300037418 Ga0395900_0040807 Ga0395900_0040807_3893_4375 160
139 3300037418 Ga0395900_0081949 Ga0395900_0081949_1757_2239 160
140 3300037418 Ga0395900_0090969 Ga0395900_0090969_1343_1825 160
141 3300037466 Ga0395898_0145724 Ga0395898_0145724_948_1430 160
142 3300038443 Ga0395901_0043167 Ga0395901_0043167_3456_3938 160
143 3300038443 Ga0395901_0079277 Ga0395901_0079277_1411_1893 160
144 3300046454 Ga0495592_0079538 Ga0495592_0079538_642_1124 160
145 3300046455 Ga0495603_0048834 Ga0495603_0048834_1544_2026 160
146 3300046463 Ga0495653_0134261 Ga0495653_0134261_1044_1526 160
147 3300046472 Ga0495580_0032083 Ga0495580_0032083_594_1076 160
148 3300046475 Ga0495639_0028094 Ga0495639_0028094_246_728 160
149 3300046476 Ga0495662_0007383 Ga0495662_0007383_4126_4608 160
150 3300046477 Ga0495664_0204408 Ga0495664_0204408_477_959 160
151 3300046492 Ga0495585_0047456 Ga0495585_0047456_1262_1744 160
152 3300046499 Ga0495594_0025889 Ga0495594_0025889_903_1385 160
153 3300046501 Ga0495607_0364731 Ga0495607_0364731_17_499 160
154 3300046511 Ga0495608_0089005 Ga0495608_0089005_714_1196 160
155 3300046514 Ga0495618_0028441 Ga0495618_0028441_946_1428 160
156 3300046523 Ga0495644_0050151 Ga0495644_0050151_1041_1523 160
157 3300046526 Ga0495666_0109722 Ga0495666_0109722_764_1246 160
158 3300046529 Ga0495652_0158436 Ga0495652_0158436_463_945 160
159 3300046531 Ga0495665_0037217 Ga0495665_0037217_1100_1582 160
160 3300046536 Ga0495587_0051060 Ga0495587_0051060_673_1155 160
161 3300046557 Ga0495622_0018813 Ga0495622_0018813_1248_1730 160
162 3300046558 Ga0495633_0037406 Ga0495633_0037406_1028_1510 160
163 3300046559 Ga0495667_0032858 Ga0495667_0032858_1149_1631 160
164 3300046642 Ga0495634_0041514 Ga0495634_0041514_2149_2631 160
165 3300046663 Ga0495635_0034228 Ga0495635_0034228_752_1234 160
166 3300046665 Ga0495661_0606424 Ga0495661_0606424_22_504 160
167 3300046674 Ga0495588_0068722 Ga0495588_0068722_368_850 160
168 3300046678 Ga0495599_0096624 Ga0495599_0096624_1216_1698 160
169 3300046680 Ga0495646_0092307 Ga0495646_0092307_276_758 160
170 3300046681 Ga0495647_0015063 Ga0495647_0015063_1442_1924 160
171 3300046683 Ga0495658_0065839 Ga0495658_0065839_705_1187 160
172 3300046689 Ga0495613_0064917 Ga0495613_0064917_402_884 160
173 3300046690 Ga0495624_0053165 Ga0495624_0053165_614_1096 160
174 3300047315 Ga0495581_0271431 Ga0495581_0271431_199_681 160
175 3300047319 Ga0495674_0014838 Ga0495674_0014838_6554_7036 160
176 3300047321 Ga0495676_0249759 Ga0495676_0249759_509_991 160
177 3300047322 Ga0495680_0015838 Ga0495680_0015838_4159_4641 160
178 3300047471 Ga0495684_0039229 Ga0495684_0039229_2645_3127 160
179 3300047673 Ga0495593_0053675 Ga0495593_0053675_241_723 160
180 3300048089 Ga0495614_0034888 Ga0495614_0034888_1298_1780 160
181 3300049741 Ga0501079_0506441 Ga0501079_0506441_406_888 160
182 3300053077 Ga0495601_0136580 Ga0495601_0136580_131_613 160
183 3300053085 Ga0495619_0156322 Ga0495619_0156322_131_613 160
184 3300005327 Ga0070658_10061382 Ga0070658_100613825 161
185 3300005329 Ga0070683_100073289 Ga0070683_1000732893 161
186 3300005336 Ga0070680_100033874 Ga0070680_1000338746 161
187 3300005336 Ga0070680_100300316 Ga0070680_1003003162 161
188 3300005336 Ga0070680_100300357 Ga0070680_1003003572 161
189 3300005339 Ga0070660_100077466 Ga0070660_1000774663 161
190 3300005366 Ga0070659_101446500 Ga0070659_1014465001 161
191 3300005434 Ga0070709_10098013 Ga0070709_100980133 161
192 3300005435 Ga0070714_100044960 Ga0070714_1000449602 161
193 3300005435 Ga0070714_100089725 Ga0070714_1000897254 161
194 3300005436 Ga0070713_100112278 Ga0070713_1001122782 161
195 3300005437 Ga0070710_10014309 Ga0070710_100143095 161
196 3300005437 Ga0070710_10017541 Ga0070710_100175413 161
197 3300005437 Ga0070710_10108014 Ga0070710_101080143 161
198 3300005456 Ga0070678_100090064 Ga0070678_1000900641 161
199 3300005456 Ga0070678_100557889 Ga0070678_1005578891 161
200 3300005457 Ga0070662_100117296 Ga0070662_1001172964 161
201 3300005457 Ga0070662_100603959 Ga0070662_1006039591 161
202 3300005458 Ga0070681_10057453 Ga0070681_100574535 161
203 3300005458 Ga0070681_10151611 Ga0070681_101516114 161
204 3300005458 Ga0070681_11250076 Ga0070681_112500761 161
205 3300005467 Ga0070706_100239110 Ga0070706_1002391103 161
206 3300005471 Ga0070698_100042133 Ga0070698_1000421335 161
207 3300005518 Ga0070699_100000995 Ga0070699_10000099529 161
208 3300005518 Ga0070699_100034096 Ga0070699_1000340965 161
209 3300005518 Ga0070699_100920820 Ga0070699_1009208201 161
210 3300005530 Ga0070679_100102694 Ga0070679_1001026942 161
211 3300005530 Ga0070679_100675952 Ga0070679_1006759521 161
212 3300005530 Ga0070679_100814555 Ga0070679_1008145552 161
213 3300005535 Ga0070684_100053201 Ga0070684_1000532014 161
214 3300005536 Ga0070697_100015176 Ga0070697_1000151764 161
215 3300005539 Ga0068853_100139058 Ga0068853_1001390581 161
216 3300005546 Ga0070696_100180744 Ga0070696_1001807442 161
217 3300005547 Ga0070693_100068638 Ga0070693_1000686381 161
218 3300005563 Ga0068855_100172075 Ga0068855_1001720754 161
219 3300005563 Ga0068855_100232884 Ga0068855_1002328843 161
220 3300005563 Ga0068855_101028168 Ga0068855_1010281682 161
221 3300005564 Ga0070664_100555625 Ga0070664_1005556251 161
222 3300005577 Ga0068857_100217621 Ga0068857_1002176211 161
223 3300005578 Ga0068854_100069987 Ga0068854_1000699874 161
224 3300005983 Ga0081540_1021322 Ga0081540_10213225 161
225 3300006028 Ga0070717_10004907 Ga0070717_100049076 161
226 3300006028 Ga0070717_10035317 Ga0070717_100353174 161
227 3300006163 Ga0070715_10147774 Ga0070715_101477742 161
228 3300006173 Ga0070716_100645948 Ga0070716_1006459481 161
229 3300006175 Ga0070712_100015178 Ga0070712_1000151786 161
230 3300006175 Ga0070712_100026255 Ga0070712_1000262556 161
231 3300006175 Ga0070712_100563947 Ga0070712_1005639471 161
232 3300006175 Ga0070712_100815699 Ga0070712_1008156991 161
233 3300006175 Ga0070712_101029392 Ga0070712_1010293922 161
234 3300006358 Ga0068871_100147247 Ga0068871_1001472472 161
235 3300006871 Ga0075434_100058101 Ga0075434_1000581012 161
236 3300006914 Ga0075436_100269513 Ga0075436_1002695132 161
237 3300007076 Ga0075435_100214447 Ga0075435_1002144471 161
238 3300007076 Ga0075435_100539121 Ga0075435_1005391211 161
239 3300009093 Ga0105240_10037246 Ga0105240_100372463 161
240 3300009093 Ga0105240_10108770 Ga0105240_101087703 161
241 3300009147 Ga0114129_10028547 Ga0114129_100285474 161
242 3300009148 Ga0105243_10338209 Ga0105243_103382092 161
243 3300009174 Ga0105241_10952875 Ga0105241_109528751 161
244 3300009551 Ga0105238_10760049 Ga0105238_107600491 161
245 3300013100 Ga0157373_10053097 Ga0157373_100530974 161
246 3300013100 Ga0157373_10160790 Ga0157373_101607901 161
247 3300013100 Ga0157373_10665054 Ga0157373_106650541 161
248 3300013100 Ga0157373_10713604 Ga0157373_107136041 161
249 3300013102 Ga0157371_10105980 Ga0157371_101059802 161
250 3300013102 Ga0157371_10356718 Ga0157371_103567181 161
251 3300013104 Ga0157370_10100021 Ga0157370_101000215 161
252 3300013105 Ga0157369_10076116 Ga0157369_100761163 161
253 3300013105 Ga0157369_10924423 Ga0157369_109244232 161
254 3300013296 Ga0157374_10756784 Ga0157374_107567842 161
255 3300013307 Ga0157372_10090178 Ga0157372_100901783 161
256 3300013307 Ga0157372_10398349 Ga0157372_103983491 161
257 3300013308 Ga0157375_10069339 Ga0157375_100693392 161
258 3300013308 Ga0157375_10889074 Ga0157375_108890742 161
259 3300014325 Ga0163163_11193290 Ga0163163_111932901 161
260 3300014497 Ga0182008_10062914 Ga0182008_100629142 161
261 3300014497 Ga0182008_10200031 Ga0182008_102000311 161
262 3300014969 Ga0157376_10024378 Ga0157376_100243785 161
263 3300014969 Ga0157376_10460340 Ga0157376_104603402 161
264 3300015261 Ga0182006_1121307 Ga0182006_11213072 161
265 3300021361 Ga0213872_10096248 Ga0213872_100962482 161
266 3300025898 Ga0207692_10014453 Ga0207692_100144534 161
267 3300025898 Ga0207692_10501595 Ga0207692_105015951 161
268 3300025905 Ga0207685_10273700 Ga0207685_102737001 161
269 3300025906 Ga0207699_10015268 Ga0207699_100152682 161
270 3300025909 Ga0207705_10046717 Ga0207705_100467172 161
271 3300025909 Ga0207705_10186293 Ga0207705_101862932 161
272 3300025910 Ga0207684_10031621 Ga0207684_100316214 161
273 3300025912 Ga0207707_10039500 Ga0207707_100395005 161
274 3300025913 Ga0207695_10163764 Ga0207695_101637644 161
275 3300025913 Ga0207695_10304807 Ga0207695_103048072 161
276 3300025915 Ga0207693_10007243 Ga0207693_100072438 161
277 3300025915 Ga0207693_10033810 Ga0207693_100338103 161
278 3300025915 Ga0207693_10385515 Ga0207693_103855151 161
279 3300025915 Ga0207693_10762419 Ga0207693_107624191 161
280 3300025916 Ga0207663_10142844 Ga0207663_101428442 161
281 3300025917 Ga0207660_10387029 Ga0207660_103870292 161
282 3300025921 Ga0207652_10086948 Ga0207652_100869484 161
283 3300025921 Ga0207652_10101678 Ga0207652_101016783 161
284 3300025921 Ga0207652_10576893 Ga0207652_105768932 161
285 3300025929 Ga0207664_10062494 Ga0207664_100624944 161
286 3300025929 Ga0207664_10144812 Ga0207664_101448123 161
287 3300025929 Ga0207664_10384371 Ga0207664_103843712 161
288 3300025929 Ga0207664_10688402 Ga0207664_106884021 161
289 3300025933 Ga0207706_11003433 Ga0207706_110034331 161
290 3300025939 Ga0207665_10085180 Ga0207665_100851802 161
291 3300025939 Ga0207665_10136560 Ga0207665_101365602 161
292 3300025944 Ga0207661_10220162 Ga0207661_102201622 161
293 3300025949 Ga0207667_10153179 Ga0207667_101531793 161
294 3300025949 Ga0207667_10335577 Ga0207667_103355773 161
295 3300025981 Ga0207640_10554267 Ga0207640_105542671 161
296 3300026041 Ga0207639_10248305 Ga0207639_102483052 161
297 3300026078 Ga0207702_10925226 Ga0207702_109252261 161
298 3300026116 Ga0207674_10315218 Ga0207674_103152182 161
299 3300026121 Ga0207683_10277182 Ga0207683_102771822 161
300 3300028577 Ga0265318_10010184 Ga0265318_100101842 161
301 3300031235 Ga0265330_10089429 Ga0265330_100894291 161
302 3300031238 Ga0265332_10011180 Ga0265332_100111803 161
303 3300031238 Ga0265332_10072535 Ga0265332_100725351 161
304 3300031241 Ga0265325_10000052 Ga0265325_1000005256 161
305 3300031241 Ga0265325_10062949 Ga0265325_100629493 161
306 3300031241 Ga0265325_10069661 Ga0265325_100696613 161
307 3300031241 Ga0265325_10074347 Ga0265325_100743472 161
308 3300031242 Ga0265329_10016987 Ga0265329_100169872 161
309 3300031247 Ga0265340_10021297 Ga0265340_100212972 161
310 3300031247 Ga0265340_10021424 Ga0265340_100214244 161
311 3300031247 Ga0265340_10028435 Ga0265340_100284352 161
312 3300031247 Ga0265340_10097420 Ga0265340_100974202 161
313 3300031249 Ga0265339_10011191 Ga0265339_100111913 161
314 3300031249 Ga0265339_10030799 Ga0265339_100307994 161
315 3300031250 Ga0265331_10017186 Ga0265331_100171861 161
316 3300031250 Ga0265331_10051500 Ga0265331_100515002 161
317 3300031344 Ga0265316_10173927 Ga0265316_101739271 161
318 3300031344 Ga0265316_10450938 Ga0265316_104509381 161
319 3300031595 Ga0265313_10000008 Ga0265313_100000087 161
320 3300031595 Ga0265313_10026117 Ga0265313_100261175 161
321 3300031595 Ga0265313_10028804 Ga0265313_100288044 161
322 3300031595 Ga0265313_10037828 Ga0265313_100378283 161
323 3300031712 Ga0265342_10001784 Ga0265342_100017845 161
324 3300031712 Ga0265342_10012513 Ga0265342_100125136 161
325 3300031712 Ga0265342_10107319 Ga0265342_101073192 161
326 3300033529 Ga0316587_1090471 Ga0316587_10904711 161
327 3300035111 Ga0373923_0124497 Ga0373923_0124497_459_944 161
328 3300035113 Ga0373936_0373819 Ga0373936_0373819_146_631 161
329 3300035118 Ga0373954_0027909 Ga0373954_0027909_2030_2515 161
330 3300035170 Ga0373943_0025268 Ga0373943_0025268_58_543 161
331 3300035172 Ga0373955_0253088 Ga0373955_0253088_549_1034 161
332 3300035410 Ga0373924_0009995 Ga0373924_0009995_1841_2326 161
333 3300035692 Ga0373935_0121606 Ga0373935_0121606_215_700 161
334 3300035724 Ga0373933_0020533 Ga0373933_0020533_1469_1954 161
335 3300035725 Ga0373947_0417743 Ga0373947_0417743_381_866 161
336 3300036401 Ga0373937_0052670 Ga0373937_0052670_1776_2261 161
337 3300037312 Ga0395899_0026752 Ga0395899_0026752_684_1169 161
338 3300037418 Ga0395900_0301454 Ga0395900_0301454_667_1152 161
339 3300038443 Ga0395901_0040068 Ga0395901_0040068_745_1230 161
340 3300039447 Ga0436361_0544746 Ga0436361_0544746_957_1442 161
341 3300039447 Ga0436361_0993144 Ga0436361_0993144_114_599 161
342 3300039453 Ga0436362_0365207 Ga0436362_0365207_39_536 161
343 3300046454 Ga0495592_0015735 Ga0495592_0015735_2359_2844 161
344 3300046459 Ga0495629_0067971 Ga0495629_0067971_517_1002 161
345 3300046461 Ga0495641_0075901 Ga0495641_0075901_76_561 161
346 3300046462 Ga0495651_0007960 Ga0495651_0007960_7505_7990 161
347 3300046463 Ga0495653_0033585 Ga0495653_0033585_1752_2237 161
348 3300046477 Ga0495664_0014507 Ga0495664_0014507_2416_2901 161
349 3300046491 Ga0495584_0307816 Ga0495584_0307816_65_568 161
350 3300046511 Ga0495608_0001202 Ga0495608_0001202_6839_7324 161
351 3300046514 Ga0495618_0022789 Ga0495618_0022789_1478_1963 161
352 3300046514 Ga0495618_0242777 Ga0495618_0242777_494_991 161
353 3300046517 Ga0495630_0039573 Ga0495630_0039573_1770_2255 161
354 3300046529 Ga0495652_0042798 Ga0495652_0042798_1352_1837 161
355 3300046531 Ga0495665_0040734 Ga0495665_0040734_1470_1967 161
356 3300046531 Ga0495665_0298721 Ga0495665_0298721_102_587 161
357 3300046533 Ga0495640_0005285 Ga0495640_0005285_7445_7930 161
358 3300046535 Ga0495586_0036227 Ga0495586_0036227_234_719 161
359 3300046536 Ga0495587_0003946 Ga0495587_0003946_2097_2582 161
360 3300046543 Ga0495645_0136602 Ga0495645_0136602_1033_1518 161
361 3300046559 Ga0495667_0001632 Ga0495667_0001632_12119_12604 161
362 3300046559 Ga0495667_0223386 Ga0495667_0223386_233_730 161
363 3300046642 Ga0495634_0021979 Ga0495634_0021979_75_572 161
364 3300046642 Ga0495634_0245635 Ga0495634_0245635_205_690 161
365 3300046675 Ga0495657_0037585 Ga0495657_0037585_2439_2924 161
366 3300046678 Ga0495599_0014038 Ga0495599_0014038_2590_3075 161
367 3300046679 Ga0495623_0039434 Ga0495623_0039434_1923_2408 161
368 3300046680 Ga0495646_0023391 Ga0495646_0023391_1764_2249 161
369 3300046689 Ga0495613_0168700 Ga0495613_0168700_168_653 161
370 3300046809 Ga0495600_0035604 Ga0495600_0035604_1580_2065 161
371 3300047317 Ga0495604_0011863 Ga0495604_0011863_129_614 161
372 3300047319 Ga0495674_0004082 Ga0495674_0004082_880_1365 161
373 3300047321 Ga0495676_0078085 Ga0495676_0078085_177_662 161
374 3300047322 Ga0495680_0034361 Ga0495680_0034361_845_1330 161
375 3300047444 Ga0495675_0026881 Ga0495675_0026881_1741_2226 161
376 3300047471 Ga0495684_0088401 Ga0495684_0088401_395_892 161
377 3300047471 Ga0495684_0108427 Ga0495684_0108427_1400_1885 161
378 3300048088 Ga0495602_0052740 Ga0495602_0052740_1688_2173 161
379 3300048903 Ga0496100_0058615 Ga0496100_0058615_1578_2063 161
380 3300048904 Ga0496101_0191380 Ga0496101_0191380_43_528 161
381 3300048907 Ga0496104_0519141 Ga0496104_0519141_189_674 161
382 3300048907 Ga0496104_1059765 Ga0496104_1059765_103_588 161
383 3300048917 Ga0496114_0396899 Ga0496114_0396899_440_925 161
384 3300048918 Ga0496115_0032561 Ga0496115_0032561_1858_2343 161
385 3300049571 Ga0501034_0089063 Ga0501034_0089063_524_1135 161
386 3300049576 Ga0501040_0063995 Ga0501040_0063995_623_1111 161
387 3300049576 Ga0501040_1134153 Ga0501040_1134153_64_552 161
388 3300049577 Ga0501041_0187564 Ga0501041_0187564_378_866 161
389 3300049579 Ga0501043_0145242 Ga0501043_0145242_561_1061 161
390 3300049580 Ga0501046_0130260 Ga0501046_0130260_1407_1895 161
391 3300049580 Ga0501046_0134680 Ga0501046_0134680_1195_1683 161
392 3300049580 Ga0501046_0546169 Ga0501046_0546169_25_522 161
393 3300049589 Ga0501073_0333755 Ga0501073_0333755_540_1025 161
394 3300049590 Ga0501074_0092936 Ga0501074_0092936_193_705 161
395 3300049590 Ga0501074_0137161 Ga0501074_0137161_1076_1564 161
396 3300049591 Ga0501075_0062487 Ga0501075_0062487_1213_1701 161
397 3300049591 Ga0501075_0102132 Ga0501075_0102132_770_1258 161
398 3300049592 Ga0501076_0508203 Ga0501076_0508203_329_817 161
399 3300049592 Ga0501076_0582286 Ga0501076_0582286_172_657 161
400 3300049741 Ga0501079_0097373 Ga0501079_0097373_1128_1616 161
401 3300049741 Ga0501079_0110063 Ga0501079_0110063_689_1177 161
402 3300049742 Ga0501080_0510774 Ga0501080_0510774_287_772 161
403 3300049743 Ga0501081_0054131 Ga0501081_0054131_1135_1623 161
404 3300049743 Ga0501081_0064234 Ga0501081_0064234_1616_2104 161
405 3300049744 Ga0501083_0041218 Ga0501083_0041218_1079_1591 161
406 3300049744 Ga0501083_0147112 Ga0501083_0147112_754_1251 161
407 3300049822 Ga0501035_0331753 Ga0501035_0331753_580_1080 161
408 3300050507 nmdc:mga05p37_19716_c1 nmdc:mga05p37_19716_c1_6588_7097 161
409 3300050508 nmdc:mga09592_557999_c1 nmdc:mga09592_557999_c1_131_640 161
410 3300050512 nmdc:mga0n895_195647_c1 nmdc:mga0n895_195647_c1_617_1114 161
411 3300050512 nmdc:mga0n895_68883_c1 nmdc:mga0n895_68883_c1_1488_1997 161
412 3300050513 nmdc:mga0rr50_626090_c1 nmdc:mga0rr50_626090_c1_346_831 161
413 3300050513 nmdc:mga0rr50_698492_c1 nmdc:mga0rr50_698492_c1_168_677 161
414 3300050514 nmdc:mga08x19_323906_c1 nmdc:mga08x19_323906_c1_373_858 161
415 3300053077 Ga0495601_0001438 Ga0495601_0001438_1499_1984 161
416 3300053078 Ga0495612_0015683 Ga0495612_0015683_588_1073 161
417 3300053084 Ga0495595_0000491 Ga0495595_0000491_1834_2319 161
418 3300053085 Ga0495619_0106260 Ga0495619_0106260_949_1434 161
419 3300053085 Ga0495619_0524879 Ga0495619_0524879_265_750 161
420 3300053125 Ga0500618_061907 Ga0500618_061907_239_724 161
421 3300054114 Ga0501084_0352008 Ga0501084_0352008_159_647 161
422 3300060353 Ga0501082_0169949 Ga0501082_0169949_344_829 161

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ysl-assembly1.cif.gz_G structure of the flagellar motab stator complex from bacillus subtilis 0.3371 50 160
6tyi-assembly1.cif.gz_D exbb-exbd complex in msp1e3d1 nanodisc 0.2851 18 160
8bri-assembly1.cif.gz_C vapomab msp1d1 nanodisc 0.2767 85 161
3jrt-assembly1.cif.gz_A-2 structure from the mobile metagenome of v. paracholerae: integron cassette protein vpc_cass2 0.2585 1 158
6ysl-assembly1.cif.gz_G structure of the flagellar motab stator complex from bacillus subtilis 0.2488 50 160
ID Description Score Start End Superfamily
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6459 9 157 1.20.120.550
af_I1LYI2_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6408 12 131 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6137 10 133 1.10.10.1740
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6125 8 133 1.20.120.550
af_Q9LSW5_1_134_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6054 10 135 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1Q3KP91-F1-model_v4 deleted 0.9648 3 161
AF-A0A1Q3KP91-F1-model_v4 deleted 0.9589 3 161
AF-A0A525I9V7-F1-model_v4 DoxX family protein 0.9442 8 161 GO:0016020
AF-A0A355WPB5-F1-model_v4 DoxX family protein 0.9422 1 161 GO:0005886
AF-A0A1H4KGD2-F1-model_v4 Thiosulfate dehydrogenase [quinone] large subunit 0.9389 7 144 GO:0005886

Feature Viewer

pLDDT pTM Quality
89.08 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map