F440375
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 422 | 244 | 419 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300047317|Ga0495604_0053403|Ga0495604_0053403_962_1438 |
| Length | 158 |
| Sequence | MSTMMPKALILYFRFVMAWTFLYAASHQVFVPGWTVVGFLNHTKTFHDFFAIFTTPTMAPITTFFVDHLLIGLSLLAGLMVRVSAAFGVVLMITYWFAHMDWPFIENTNNFIVDYHLVYAGVLVTLIVTRAGHVFGLDAWAENLSFVKQHPALKPLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 3 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 124 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 126 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 127 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 146 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 243 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.05 |
| Metatranscriptomes | 0.24 |
| Isolates | 0.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 8.06 |
| Rhizosphere | 91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10061382 | 3300005327 | Bacteria | 3062 |
| 2 | Ga0070683_100073289 | 3300005329 | Bacteria | 3197 |
| 3 | Ga0070683_100651290 | 3300005329 | Bacteria | 1008 |
| 4 | Ga0070666_10227945 | 3300005335 | Unclassified | 1315 |
| 5 | Ga0070680_100033874 | 3300005336 | Bacteria | 4119 |
| 6 | Ga0070680_100300316 | 3300005336 | Bacteria | 1362 |
| 7 | Ga0070680_100300357 | 3300005336 | Bacteria | 1361 |
| 8 | Ga0070660_100077466 | 3300005339 | Bacteria | 2605 |
| 9 | Ga0070689_100856447 | 3300005340 | Bacteria | 802 |
| 10 | Ga0070671_100138488 | 3300005355 | Bacteria | 2053 |
| 11 | Ga0070688_100020515 | 3300005365 | Bacteria | 3844 |
| 12 | Ga0070659_101446500 | 3300005366 | Bacteria | 612 |
| 13 | Ga0070667_100511221 | 3300005367 | Bacteria | 1102 |
| 14 | Ga0070709_10098013 | 3300005434 | Bacteria | 1947 |
| 15 | Ga0070714_100044960 | 3300005435 | Bacteria | 3740 |
| 16 | Ga0070714_100089725 | 3300005435 | Bacteria | 2691 |
| 17 | Ga0070713_100112278 | 3300005436 | Unclassified | 2378 |
| 18 | Ga0070710_10014309 | 3300005437 | Bacteria | 3991 |
| 19 | Ga0070710_10017541 | 3300005437 | Plasmid | 3666 |
| 20 | Ga0070710_10108014 | 3300005437 | Bacteria | 1667 |
| 21 | Ga0070710_10455555 | 3300005437 | Bacteria | 868 |
| 22 | Ga0070710_10665534 | 3300005437 | Unclassified | 731 |
| 23 | Ga0070711_101380702 | 3300005439 | Unclassified | 613 |
| 24 | Ga0070663_100039800 | 3300005455 | Bacteria | 3288 |
| 25 | Ga0070678_100090064 | 3300005456 | Unclassified | 2350 |
| 26 | Ga0070678_100557889 | 3300005456 | Bacteria | 1018 |
| 27 | Ga0070662_100117296 | 3300005457 | Bacteria | 2036 |
| 28 | Ga0070662_100603959 | 3300005457 | Bacteria | 923 |
| 29 | Ga0070681_10057453 | 3300005458 | Bacteria | 3871 |
| 30 | Ga0070681_10151611 | 3300005458 | Bacteria | 2244 |
| 31 | Ga0070681_11250076 | 3300005458 | Unclassified | 665 |
| 32 | Ga0070706_100239110 | 3300005467 | Bacteria | 1695 |
| 33 | Ga0070698_100042133 | 3300005471 | Bacteria | 4683 |
| 34 | Ga0070699_100000995 | 3300005518 | Bacteria | 26369 |
| 35 | Ga0070699_100034096 | 3300005518 | Bacteria | 4399 |
| 36 | Ga0070699_100920820 | 3300005518 | Bacteria | 801 |
| 37 | Ga0070679_100102694 | 3300005530 | Bacteria | 2845 |
| 38 | Ga0070679_100675952 | 3300005530 | Bacteria | 975 |
| 39 | Ga0070679_100814555 | 3300005530 | Bacteria | 877 |
| 40 | Ga0070684_100005196 | 3300005535 | Bacteria | 9953 |
| 41 | Ga0070684_100053201 | 3300005535 | Bacteria | 3523 |
| 42 | Ga0070697_100015176 | 3300005536 | Bacteria | 6049 |
| 43 | Ga0068853_100139058 | 3300005539 | Bacteria | 2179 |
| 44 | Ga0070696_100180744 | 3300005546 | Unclassified | 1565 |
| 45 | Ga0070693_100068638 | 3300005547 | Bacteria | 2081 |
| 46 | Ga0070665_100139109 | 3300005548 | Bacteria | 2432 |
| 47 | Ga0068855_100172075 | 3300005563 | Bacteria | 2452 |
| 48 | Ga0068855_100232884 | 3300005563 | Bacteria | 2061 |
| 49 | Ga0068855_101028168 | 3300005563 | Bacteria | 864 |
| 50 | Ga0070664_100182487 | 3300005564 | Unclassified | 1866 |
| 51 | Ga0070664_100555625 | 3300005564 | Bacteria | 1062 |
| 52 | Ga0068857_100217621 | 3300005577 | Bacteria | 1744 |
| 53 | Ga0068854_100069987 | 3300005578 | Bacteria | 2563 |
| 54 | Ga0068859_100534227 | 3300005617 | Unclassified | 1267 |
| 55 | Ga0068864_100826748 | 3300005618 | Unclassified | 911 |
| 56 | Ga0068863_100104836 | 3300005841 | Bacteria | 2690 |
| 57 | Ga0068863_100903922 | 3300005841 | Bacteria | 883 |
| 58 | Ga0081455_10129276 | 3300005937 | Bacteria | 1977 |
| 59 | Ga0081540_1021322 | 3300005983 | Bacteria | 3863 |
| 60 | Ga0070717_10004907 | 3300006028 | Bacteria | 9730 |
| 61 | Ga0070717_10035317 | 3300006028 | Bacteria | 4045 |
| 62 | Ga0070717_10143002 | 3300006028 | Unclassified | 2065 |
| 63 | Ga0070717_10271937 | 3300006028 | Bacteria | 1501 |
| 64 | Ga0070715_10142039 | 3300006163 | Unclassified | 1167 |
| 65 | Ga0070715_10147774 | 3300006163 | Bacteria | 1148 |
| 66 | Ga0070716_100645948 | 3300006173 | Bacteria | 802 |
| 67 | Ga0070712_100015178 | 3300006175 | Bacteria | 4954 |
| 68 | Ga0070712_100026255 | 3300006175 | Bacteria | 3878 |
| 69 | Ga0070712_100563947 | 3300006175 | Unclassified | 961 |
| 70 | Ga0070712_100815699 | 3300006175 | Unclassified | 801 |
| 71 | Ga0070712_101029392 | 3300006175 | Bacteria | 713 |
| 72 | Ga0068871_100102933 | 3300006358 | Bacteria | 2394 |
| 73 | Ga0068871_100147247 | 3300006358 | Bacteria | 2006 |
| 74 | Ga0075433_10127749 | 3300006852 | Bacteria | 2258 |
| 75 | Ga0075434_100058101 | 3300006871 | Bacteria | 3845 |
| 76 | Ga0068865_100507667 | 3300006881 | Unclassified | 1006 |
| 77 | Ga0075436_100269513 | 3300006914 | Bacteria | 1216 |
| 78 | Ga0097620_100534233 | 3300006931 | Unclassified | 1267 |
| 79 | Ga0075435_100214447 | 3300007076 | Unclassified | 1634 |
| 80 | Ga0075435_100539121 | 3300007076 | Bacteria | 1010 |
| 81 | Ga0105251_10032205 | 3300009011 | Bacteria | 2615 |
| 82 | Ga0105240_10037246 | 3300009093 | Bacteria | 6252 |
| 83 | Ga0105240_10108770 | 3300009093 | Bacteria | 3358 |
| 84 | Ga0111539_10268063 | 3300009094 | Bacteria | 1988 |
| 85 | Ga0114129_10028547 | 3300009147 | Bacteria | 7906 |
| 86 | Ga0105243_10120837 | 3300009148 | Unclassified | 2208 |
| 87 | Ga0105243_10338209 | 3300009148 | Bacteria | 1378 |
| 88 | Ga0105241_10644206 | 3300009174 | Unclassified | 962 |
| 89 | Ga0105241_10952875 | 3300009174 | Bacteria | 800 |
| 90 | Ga0105242_10200348 | 3300009176 | Bacteria | 1773 |
| 91 | Ga0105248_10636658 | 3300009177 | Unclassified | 1203 |
| 92 | Ga0105238_10760049 | 3300009551 | Bacteria | 983 |
| 93 | Ga0105246_10077215 | 3300011119 | Bacteria | 2362 |
| 94 | Ga0157373_10053097 | 3300013100 | Bacteria | 2882 |
| 95 | Ga0157373_10160790 | 3300013100 | Bacteria | 1580 |
| 96 | Ga0157373_10665054 | 3300013100 | Bacteria | 761 |
| 97 | Ga0157373_10713604 | 3300013100 | Bacteria | 735 |
| 98 | Ga0157371_10105980 | 3300013102 | Bacteria | 1995 |
| 99 | Ga0157371_10356718 | 3300013102 | Bacteria | 1065 |
| 100 | Ga0157370_10100021 | 3300013104 | Bacteria | 2717 |
| 101 | Ga0157370_10877021 | 3300013104 | Unclassified | 815 |
| 102 | Ga0157369_10076116 | 3300013105 | Bacteria | 3597 |
| 103 | Ga0157369_10924423 | 3300013105 | Bacteria | 894 |
| 104 | Ga0157374_10002982 | 3300013296 | Bacteria | 14172 |
| 105 | Ga0157374_10756784 | 3300013296 | Bacteria | 986 |
| 106 | Ga0157378_10049511 | 3300013297 | Bacteria | 3738 |
| 107 | Ga0157378_10639247 | 3300013297 | Bacteria | 1079 |
| 108 | Ga0163162_10023017 | 3300013306 | Bacteria | 6144 |
| 109 | Ga0163162_11760478 | 3300013306 | Bacteria | 708 |
| 110 | Ga0157372_10090178 | 3300013307 | Bacteria | 3484 |
| 111 | Ga0157372_10398349 | 3300013307 | Bacteria | 1604 |
| 112 | Ga0157372_10765695 | 3300013307 | Bacteria | 1122 |
| 113 | Ga0157375_10069339 | 3300013308 | Bacteria | 3532 |
| 114 | Ga0157375_10889074 | 3300013308 | Bacteria | 1035 |
| 115 | Ga0163163_11193290 | 3300014325 | Bacteria | 824 |
| 116 | Ga0157380_10322837 | 3300014326 | Bacteria | 1432 |
| 117 | Ga0182008_10062914 | 3300014497 | Bacteria | 1828 |
| 118 | Ga0182008_10200031 | 3300014497 | Bacteria | 1016 |
| 119 | Ga0157376_10024378 | 3300014969 | Bacteria | 4748 |
| 120 | Ga0157376_10388846 | 3300014969 | Bacteria | 1346 |
| 121 | Ga0157376_10460340 | 3300014969 | Bacteria | 1243 |
| 122 | Ga0182006_1121307 | 3300015261 | Bacteria | 908 |
| 123 | Ga0213872_10096248 | 3300021361 | Bacteria | 1322 |
| 124 | Ga0207692_10014453 | 3300025898 | Plasmid | 3449 |
| 125 | Ga0207692_10501595 | 3300025898 | Bacteria | 770 |
| 126 | Ga0207680_10235144 | 3300025903 | Unclassified | 1260 |
| 127 | Ga0207685_10273700 | 3300025905 | Unclassified | 826 |
| 128 | Ga0207699_10015268 | 3300025906 | Bacteria | 3985 |
| 129 | Ga0207699_10682051 | 3300025906 | Bacteria | 751 |
| 130 | Ga0207705_10046717 | 3300025909 | Bacteria | 3112 |
| 131 | Ga0207705_10186293 | 3300025909 | Bacteria | 1568 |
| 132 | Ga0207684_10031621 | 3300025910 | Bacteria | 4501 |
| 133 | Ga0207707_10039500 | 3300025912 | Bacteria | 4124 |
| 134 | Ga0207695_10163764 | 3300025913 | Bacteria | 2153 |
| 135 | Ga0207695_10304807 | 3300025913 | Bacteria | 1484 |
| 136 | Ga0207693_10007243 | 3300025915 | Bacteria | 9131 |
| 137 | Ga0207693_10033810 | 3300025915 | Plasmid | 4033 |
| 138 | Ga0207693_10385515 | 3300025915 | Unclassified | 1096 |
| 139 | Ga0207693_10762419 | 3300025915 | Unclassified | 747 |
| 140 | Ga0207663_10142844 | 3300025916 | Bacteria | 1670 |
| 141 | Ga0207660_10387029 | 3300025917 | Bacteria | 1125 |
| 142 | Ga0207657_10713045 | 3300025919 | Bacteria | 779 |
| 143 | Ga0207652_10086948 | 3300025921 | Bacteria | 2741 |
| 144 | Ga0207652_10101678 | 3300025921 | Bacteria | 2539 |
| 145 | Ga0207652_10576893 | 3300025921 | Bacteria | 1010 |
| 146 | Ga0207700_10186342 | 3300025928 | Unclassified | 1741 |
| 147 | Ga0207700_10328580 | 3300025928 | Bacteria | 1327 |
| 148 | Ga0207664_10062494 | 3300025929 | Bacteria | 2974 |
| 149 | Ga0207664_10144812 | 3300025929 | Bacteria | 2014 |
| 150 | Ga0207664_10298220 | 3300025929 | Bacteria | 1417 |
| 151 | Ga0207664_10384371 | 3300025929 | Bacteria | 1246 |
| 152 | Ga0207664_10688402 | 3300025929 | Unclassified | 919 |
| 153 | Ga0207706_11003433 | 3300025933 | Bacteria | 701 |
| 154 | Ga0207670_11079127 | 3300025936 | Unclassified | 677 |
| 155 | Ga0207704_11163917 | 3300025938 | Unclassified | 657 |
| 156 | Ga0207665_10085180 | 3300025939 | Bacteria | 2182 |
| 157 | Ga0207665_10136560 | 3300025939 | Bacteria | 1745 |
| 158 | Ga0207711_10049162 | 3300025941 | Bacteria | 3610 |
| 159 | Ga0207661_10220162 | 3300025944 | Bacteria | 1677 |
| 160 | Ga0207661_10622862 | 3300025944 | Bacteria | 991 |
| 161 | Ga0207667_10153179 | 3300025949 | Bacteria | 2372 |
| 162 | Ga0207667_10335577 | 3300025949 | Bacteria | 1543 |
| 163 | Ga0207640_10554267 | 3300025981 | Bacteria | 966 |
| 164 | Ga0207703_11646885 | 3300026035 | Unclassified | 617 |
| 165 | Ga0207639_10248305 | 3300026041 | Bacteria | 1551 |
| 166 | Ga0207708_11273066 | 3300026075 | Unclassified | 644 |
| 167 | Ga0207702_10925226 | 3300026078 | Bacteria | 864 |
| 168 | Ga0207641_10142056 | 3300026088 | Bacteria | 2167 |
| 169 | Ga0207676_10572685 | 3300026095 | Unclassified | 1081 |
| 170 | Ga0207674_10315218 | 3300026116 | Unclassified | 1513 |
| 171 | Ga0207683_10277182 | 3300026121 | Bacteria | 1532 |
| 172 | Ga0207683_10631077 | 3300026121 | Unclassified | 992 |
| 173 | Ga0268266_10082761 | 3300028379 | Unclassified | 2800 |
| 174 | Ga0268264_10227388 | 3300028381 | Unclassified | 1721 |
| 175 | Ga0265318_10010184 | 3300028577 | Bacteria | 4105 |
| 176 | Ga0265330_10089429 | 3300031235 | Bacteria | 1323 |
| 177 | Ga0265332_10011180 | 3300031238 | Bacteria | 3989 |
| 178 | Ga0265332_10072535 | 3300031238 | Bacteria | 1466 |
| 179 | Ga0265325_10000052 | 3300031241 | Bacteria | 78471 |
| 180 | Ga0265325_10062949 | 3300031241 | Bacteria | 1878 |
| 181 | Ga0265325_10069661 | 3300031241 | Bacteria | 1768 |
| 182 | Ga0265325_10074347 | 3300031241 | Bacteria | 1700 |
| 183 | Ga0265325_10084916 | 3300031241 | Bacteria | 1569 |
| 184 | Ga0265329_10016987 | 3300031242 | Bacteria | 2512 |
| 185 | Ga0265329_10057887 | 3300031242 | Bacteria | 1228 |
| 186 | Ga0265329_10234085 | 3300031242 | Unclassified | 610 |
| 187 | Ga0265340_10021297 | 3300031247 | Bacteria | 3325 |
| 188 | Ga0265340_10021424 | 3300031247 | Bacteria | 3316 |
| 189 | Ga0265340_10028435 | 3300031247 | Bacteria | 2812 |
| 190 | Ga0265340_10097420 | 3300031247 | Bacteria | 1369 |
| 191 | Ga0265340_10119642 | 3300031247 | Bacteria | 1212 |
| 192 | Ga0265339_10011191 | 3300031249 | Bacteria | 5537 |
| 193 | Ga0265339_10030799 | 3300031249 | Bacteria | 3035 |
| 194 | Ga0265331_10017186 | 3300031250 | Bacteria | 3779 |
| 195 | Ga0265331_10051500 | 3300031250 | Bacteria | 1970 |
| 196 | Ga0265316_10173927 | 3300031344 | Bacteria | 1605 |
| 197 | Ga0265316_10450938 | 3300031344 | Bacteria | 922 |
| 198 | Ga0265313_10000008 | 3300031595 | Bacteria | 173405 |
| 199 | Ga0265313_10026117 | 3300031595 | Bacteria | 3083 |
| 200 | Ga0265313_10028804 | 3300031595 | Bacteria | 2881 |
| 201 | Ga0265313_10037828 | 3300031595 | Bacteria | 2408 |
| 202 | Ga0265342_10001784 | 3300031712 | Bacteria | 19600 |
| 203 | Ga0265342_10012513 | 3300031712 | Bacteria | 5743 |
| 204 | Ga0265342_10107319 | 3300031712 | Bacteria | 1584 |
| 205 | Ga0316587_1090471 | 3300033529 | Bacteria | 583 |
| 206 | Ga0373926_0014690 | 3300035083 | Bacteria | 2664 |
| 207 | Ga0373923_0124497 | 3300035111 | Bacteria | 1154 |
| 208 | Ga0373936_0373819 | 3300035113 | Bacteria | 651 |
| 209 | Ga0373939_0302321 | 3300035114 | Bacteria | 638 |
| 210 | Ga0373945_0006206 | 3300035116 | Bacteria | 3846 |
| 211 | Ga0373954_0027909 | 3300035118 | Bacteria | 2593 |
| 212 | Ga0373954_0081967 | 3300035118 | Bacteria | 1542 |
| 213 | Ga0373956_0076598 | 3300035119 | Archaea | 1531 |
| 214 | Ga0373943_0025268 | 3300035170 | Bacteria | 2776 |
| 215 | Ga0373943_0029860 | 3300035170 | Bacteria | 2577 |
| 216 | Ga0373946_0018185 | 3300035171 | Bacteria | 2696 |
| 217 | Ga0373955_0253088 | 3300035172 | Bacteria | 1056 |
| 218 | Ga0373924_0009995 | 3300035410 | Bacteria | 3492 |
| 219 | Ga0373935_0121606 | 3300035692 | Bacteria | 1745 |
| 220 | Ga0373935_0523513 | 3300035692 | Bacteria | 862 |
| 221 | Ga0373935_1119429 | 3300035692 | Bacteria | 586 |
| 222 | Ga0373927_0052016 | 3300035695 | Bacteria | 2649 |
| 223 | Ga0373927_0591905 | 3300035695 | Bacteria | 733 |
| 224 | Ga0373933_0020533 | 3300035724 | Bacteria | 3745 |
| 225 | Ga0373933_0158396 | 3300035724 | Bacteria | 1437 |
| 226 | Ga0373947_0090801 | 3300035725 | Bacteria | 1904 |
| 227 | Ga0373947_0149871 | 3300035725 | Bacteria | 1501 |
| 228 | Ga0373947_0417743 | 3300035725 | Bacteria | 906 |
| 229 | Ga0373937_0052670 | 3300036401 | Bacteria | 3732 |
| 230 | Ga0373925_0017650 | 3300037068 | Bacteria | 5178 |
| 231 | Ga0373925_0133426 | 3300037068 | Bacteria | 1938 |
| 232 | Ga0395899_0026752 | 3300037312 | Bacteria | 4352 |
| 233 | Ga0395900_0040807 | 3300037418 | Bacteria | 4784 |
| 234 | Ga0395900_0081949 | 3300037418 | Bacteria | 3314 |
| 235 | Ga0395900_0090969 | 3300037418 | Bacteria | 3136 |
| 236 | Ga0395900_0301454 | 3300037418 | Bacteria | 1588 |
| 237 | Ga0395898_0145724 | 3300037466 | Bacteria | 2266 |
| 238 | Ga0395901_0040068 | 3300038443 | Bacteria | 4850 |
| 239 | Ga0395901_0043167 | 3300038443 | Bacteria | 4677 |
| 240 | Ga0395901_0079277 | 3300038443 | Bacteria | 3429 |
| 241 | Ga0436361_0544746 | 3300039447 | Bacteria | 1587 |
| 242 | Ga0436361_0993144 | 3300039447 | Bacteria | 1155 |
| 243 | Ga0436362_0365207 | 3300039453 | Unclassified | 638 |
| 244 | Ga0495592_0015735 | 3300046454 | Bacteria | 5738 |
| 245 | Ga0495592_0079538 | 3300046454 | Bacteria | 2373 |
| 246 | Ga0495592_0766523 | 3300046454 | Bacteria | 575 |
| 247 | Ga0495603_0048834 | 3300046455 | Bacteria | 2519 |
| 248 | Ga0495629_0067971 | 3300046459 | Bacteria | 2486 |
| 249 | Ga0495629_0144902 | 3300046459 | Bacteria | 1652 |
| 250 | Ga0495641_0014221 | 3300046461 | Bacteria | 4317 |
| 251 | Ga0495641_0075901 | 3300046461 | Bacteria | 1507 |
| 252 | Ga0495651_0007960 | 3300046462 | Bacteria | 8126 |
| 253 | Ga0495651_0348988 | 3300046462 | Bacteria | 978 |
| 254 | Ga0495653_0033585 | 3300046463 | Bacteria | 4063 |
| 255 | Ga0495653_0134261 | 3300046463 | Bacteria | 1747 |
| 256 | Ga0495580_0032083 | 3300046472 | Bacteria | 3792 |
| 257 | Ga0495580_0307049 | 3300046472 | Bacteria | 1080 |
| 258 | Ga0495582_0025029 | 3300046473 | Bacteria | 3269 |
| 259 | Ga0495639_0028094 | 3300046475 | Bacteria | 2492 |
| 260 | Ga0495662_0007383 | 3300046476 | Bacteria | 5430 |
| 261 | Ga0495662_0035945 | 3300046476 | Bacteria | 2391 |
| 262 | Ga0495664_0014507 | 3300046477 | Bacteria | 4468 |
| 263 | Ga0495664_0204408 | 3300046477 | Bacteria | 1196 |
| 264 | Ga0495584_0307816 | 3300046491 | Unclassified | 805 |
| 265 | Ga0495585_0047456 | 3300046492 | Bacteria | 2392 |
| 266 | Ga0495594_0025889 | 3300046499 | Bacteria | 3154 |
| 267 | Ga0495594_0317004 | 3300046499 | Bacteria | 888 |
| 268 | Ga0495607_0364731 | 3300046501 | Bacteria | 664 |
| 269 | Ga0495608_0001202 | 3300046511 | Bacteria | 18375 |
| 270 | Ga0495608_0089005 | 3300046511 | Bacteria | 1998 |
| 271 | Ga0495618_0022789 | 3300046514 | Bacteria | 3868 |
| 272 | Ga0495618_0028441 | 3300046514 | Bacteria | 3483 |
| 273 | Ga0495618_0242777 | 3300046514 | Bacteria | 1132 |
| 274 | Ga0495630_0024973 | 3300046517 | Bacteria | 4417 |
| 275 | Ga0495630_0039573 | 3300046517 | Bacteria | 3525 |
| 276 | Ga0495630_0706705 | 3300046517 | Bacteria | 771 |
| 277 | Ga0495644_0050151 | 3300046523 | Bacteria | 1567 |
| 278 | Ga0495666_0109722 | 3300046526 | Bacteria | 1296 |
| 279 | Ga0495652_0042798 | 3300046529 | Bacteria | 3904 |
| 280 | Ga0495652_0158436 | 3300046529 | Bacteria | 1760 |
| 281 | Ga0495665_0037217 | 3300046531 | Bacteria | 2597 |
| 282 | Ga0495665_0040734 | 3300046531 | Unclassified | 2473 |
| 283 | Ga0495665_0298721 | 3300046531 | Bacteria | 825 |
| 284 | Ga0495640_0005285 | 3300046533 | Bacteria | 10262 |
| 285 | Ga0495640_0063909 | 3300046533 | Bacteria | 2490 |
| 286 | Ga0495586_0036227 | 3300046535 | Bacteria | 2648 |
| 287 | Ga0495587_0003946 | 3300046536 | Bacteria | 9838 |
| 288 | Ga0495587_0051060 | 3300046536 | Bacteria | 2446 |
| 289 | Ga0495645_0136602 | 3300046543 | Bacteria | 1714 |
| 290 | Ga0495622_0018813 | 3300046557 | Bacteria | 3217 |
| 291 | Ga0495633_0037406 | 3300046558 | Bacteria | 2322 |
| 292 | Ga0495667_0001632 | 3300046559 | Bacteria | 14851 |
| 293 | Ga0495667_0032858 | 3300046559 | Bacteria | 3474 |
| 294 | Ga0495667_0223386 | 3300046559 | Bacteria | 1202 |
| 295 | Ga0495634_0021979 | 3300046642 | Bacteria | 4499 |
| 296 | Ga0495634_0041514 | 3300046642 | Unclassified | 3123 |
| 297 | Ga0495634_0245635 | 3300046642 | Bacteria | 1096 |
| 298 | Ga0495634_0343149 | 3300046642 | Bacteria | 895 |
| 299 | Ga0495635_0034228 | 3300046663 | Bacteria | 3523 |
| 300 | Ga0495661_0606424 | 3300046665 | Bacteria | 514 |
| 301 | Ga0495588_0068722 | 3300046674 | Bacteria | 1840 |
| 302 | Ga0495657_0037585 | 3300046675 | Bacteria | 3336 |
| 303 | Ga0495599_0014038 | 3300046678 | Bacteria | 4959 |
| 304 | Ga0495599_0096624 | 3300046678 | Unclassified | 1842 |
| 305 | Ga0495623_0039434 | 3300046679 | Bacteria | 3018 |
| 306 | Ga0495646_0023391 | 3300046680 | Bacteria | 3890 |
| 307 | Ga0495646_0092307 | 3300046680 | Bacteria | 1746 |
| 308 | Ga0495647_0015063 | 3300046681 | Bacteria | 2703 |
| 309 | Ga0495658_0065839 | 3300046683 | Bacteria | 2091 |
| 310 | Ga0495613_0064917 | 3300046689 | Bacteria | 2668 |
| 311 | Ga0495613_0168700 | 3300046689 | Bacteria | 1554 |
| 312 | Ga0495624_0053165 | 3300046690 | Bacteria | 2557 |
| 313 | Ga0495600_0028328 | 3300046809 | Bacteria | 3623 |
| 314 | Ga0495600_0035604 | 3300046809 | Bacteria | 3234 |
| 315 | Ga0495581_0271431 | 3300047315 | Bacteria | 991 |
| 316 | Ga0495604_0011863 | 3300047317 | Bacteria | 6931 |
| 317 | Ga0495604_0053403 | 3300047317 | Bacteria | 3123 |
| 318 | Ga0495674_0004082 | 3300047319 | Bacteria | 14126 |
| 319 | Ga0495674_0014838 | 3300047319 | Bacteria | 7289 |
| 320 | Ga0495674_1285847 | 3300047319 | Unclassified | 549 |
| 321 | Ga0495676_0078085 | 3300047321 | Bacteria | 2522 |
| 322 | Ga0495676_0249759 | 3300047321 | Bacteria | 1210 |
| 323 | Ga0495676_0694987 | 3300047321 | Bacteria | 658 |
| 324 | Ga0495680_0015838 | 3300047322 | Bacteria | 6490 |
| 325 | Ga0495680_0034361 | 3300047322 | Bacteria | 4094 |
| 326 | Ga0495675_0026881 | 3300047444 | Bacteria | 3668 |
| 327 | Ga0495684_0039229 | 3300047471 | Bacteria | 3630 |
| 328 | Ga0495684_0088401 | 3300047471 | Unclassified | 2348 |
| 329 | Ga0495684_0108427 | 3300047471 | Bacteria | 2097 |
| 330 | Ga0495593_0053675 | 3300047673 | Unclassified | 2126 |
| 331 | Ga0495602_0052740 | 3300048088 | Bacteria | 3609 |
| 332 | Ga0495614_0034888 | 3300048089 | Bacteria | 2162 |
| 333 | Ga0496100_0058615 | 3300048903 | Bacteria | 2528 |
| 334 | Ga0496100_0286981 | 3300048903 | Unclassified | 1228 |
| 335 | Ga0496100_0681631 | 3300048903 | Unclassified | 801 |
| 336 | Ga0496101_0001317 | 3300048904 | Bacteria | 14853 |
| 337 | Ga0496101_0191380 | 3300048904 | Bacteria | 1579 |
| 338 | Ga0496101_0541259 | 3300048904 | Unclassified | 920 |
| 339 | Ga0496101_1128290 | 3300048904 | Bacteria | 615 |
| 340 | Ga0496102_0003389 | 3300048905 | Bacteria | 13515 |
| 341 | Ga0496103_0108308 | 3300048906 | Bacteria | 1763 |
| 342 | Ga0496104_0000656 | 3300048907 | Bacteria | 29652 |
| 343 | Ga0496104_0451553 | 3300048907 | Unclassified | 1197 |
| 344 | Ga0496104_0519141 | 3300048907 | Bacteria | 1102 |
| 345 | Ga0496104_0748108 | 3300048907 | Unclassified | 884 |
| 346 | Ga0496104_1059765 | 3300048907 | Bacteria | 714 |
| 347 | Ga0496105_0000984 | 3300048908 | Bacteria | 19611 |
| 348 | Ga0496105_0003865 | 3300048908 | Bacteria | 11195 |
| 349 | Ga0496105_0167809 | 3300048908 | Bacteria | 1800 |
| 350 | Ga0496105_0737077 | 3300048908 | Unclassified | 754 |
| 351 | Ga0496106_0158762 | 3300048909 | Unclassified | 1787 |
| 352 | Ga0496106_0932915 | 3300048909 | Bacteria | 684 |
| 353 | Ga0496107_0012442 | 3300048910 | Bacteria | 5941 |
| 354 | Ga0496107_0486521 | 3300048910 | Bacteria | 915 |
| 355 | Ga0496108_0022166 | 3300048911 | Bacteria | 5221 |
| 356 | Ga0496108_0044575 | 3300048911 | Bacteria | 3701 |
| 357 | Ga0496110_0022862 | 3300048913 | Bacteria | 5312 |
| 358 | Ga0496111_0002841 | 3300048914 | Bacteria | 10564 |
| 359 | Ga0496112_0402470 | 3300048915 | Bacteria | 1308 |
| 360 | Ga0496113_0003401 | 3300048916 | Bacteria | 9520 |
| 361 | Ga0496113_0328874 | 3300048916 | Unclassified | 1225 |
| 362 | Ga0496114_0396899 | 3300048917 | Bacteria | 1221 |
| 363 | Ga0496114_0825327 | 3300048917 | Unclassified | 806 |
| 364 | Ga0496115_0032561 | 3300048918 | Bacteria | 4112 |
| 365 | Ga0496115_0114078 | 3300048918 | Bacteria | 2221 |
| 366 | Ga0496115_0186209 | 3300048918 | Unclassified | 1715 |
| 367 | Ga0501034_0089063 | 3300049571 | Bacteria | 3084 |
| 368 | Ga0501037_0044060 | 3300049573 | Bacteria | 3278 |
| 369 | Ga0501039_0302604 | 3300049575 | Bacteria | 1257 |
| 370 | Ga0501040_0063995 | 3300049576 | Bacteria | 2532 |
| 371 | Ga0501040_1134153 | 3300049576 | Unclassified | 567 |
| 372 | Ga0501041_0187564 | 3300049577 | Unclassified | 1295 |
| 373 | Ga0501043_0145242 | 3300049579 | Bacteria | 1858 |
| 374 | Ga0501046_0130260 | 3300049580 | Unclassified | 1908 |
| 375 | Ga0501046_0134680 | 3300049580 | Bacteria | 1872 |
| 376 | Ga0501046_0546169 | 3300049580 | Bacteria | 826 |
| 377 | Ga0501047_0322472 | 3300049581 | Bacteria | 1384 |
| 378 | Ga0501070_0030607 | 3300049586 | Bacteria | 4510 |
| 379 | Ga0501073_0333755 | 3300049589 | Bacteria | 1047 |
| 380 | Ga0501074_0092936 | 3300049590 | Bacteria | 2160 |
| 381 | Ga0501074_0137161 | 3300049590 | Bacteria | 1750 |
| 382 | Ga0501075_0062487 | 3300049591 | Bacteria | 2807 |
| 383 | Ga0501075_0102132 | 3300049591 | Bacteria | 2178 |
| 384 | Ga0501076_0508203 | 3300049592 | Unclassified | 993 |
| 385 | Ga0501076_0582286 | 3300049592 | Unclassified | 923 |
| 386 | Ga0501079_0097373 | 3300049741 | Unclassified | 2281 |
| 387 | Ga0501079_0110063 | 3300049741 | Bacteria | 2140 |
| 388 | Ga0501079_0506441 | 3300049741 | Unclassified | 949 |
| 389 | Ga0501080_0510774 | 3300049742 | Bacteria | 1073 |
| 390 | Ga0501081_0054131 | 3300049743 | Bacteria | 2772 |
| 391 | Ga0501081_0064234 | 3300049743 | Bacteria | 2549 |
| 392 | Ga0501083_0041218 | 3300049744 | Bacteria | 3131 |
| 393 | Ga0501083_0147112 | 3300049744 | Bacteria | 1543 |
| 394 | Ga0501035_0331753 | 3300049822 | Bacteria | 1276 |
| 395 | Ga0501044_0834017 | 3300049823 | Bacteria | 799 |
| 396 | nmdc:mga05p37_19716_c1 | 3300050507 | Bacteria | 8159 |
| 397 | nmdc:mga09592_557999_c1 | 3300050508 | Unclassified | 983 |
| 398 | nmdc:mga08y16_351922_c1 | 3300050511 | Bacteria | 1513 |
| 399 | nmdc:mga0n895_195647_c1 | 3300050512 | Bacteria | 2053 |
| 400 | nmdc:mga0n895_68883_c1 | 3300050512 | Bacteria | 3505 |
| 401 | nmdc:mga0rr50_626090_c1 | 3300050513 | Bacteria | 918 |
| 402 | nmdc:mga0rr50_698492_c1 | 3300050513 | Unclassified | 866 |
| 403 | nmdc:mga08x19_323906_c1 | 3300050514 | Bacteria | 1073 |
| 404 | Ga0495601_0001438 | 3300053077 | Bacteria | 13118 |
| 405 | Ga0495601_0004668 | 3300053077 | Bacteria | 7931 |
| 406 | Ga0495601_0136580 | 3300053077 | Bacteria | 1598 |
| 407 | Ga0495612_0015683 | 3300053078 | Bacteria | 3037 |
| 408 | Ga0495612_0017423 | 3300053078 | Bacteria | 2877 |
| 409 | Ga0495595_0000491 | 3300053084 | Bacteria | 15085 |
| 410 | Ga0495595_0011588 | 3300053084 | Bacteria | 3690 |
| 411 | Ga0495619_0013116 | 3300053085 | Bacteria | 5222 |
| 412 | Ga0495619_0106260 | 3300053085 | Bacteria | 1914 |
| 413 | Ga0495619_0156322 | 3300053085 | Bacteria | 1573 |
| 414 | Ga0495619_0524879 | 3300053085 | Bacteria | 813 |
| 415 | Ga0500618_061907 | 3300053125 | Bacteria | 842 |
| 416 | Ga0501084_0013235 | 3300054114 | Bacteria | 6827 |
| 417 | Ga0501084_0352008 | 3300054114 | Bacteria | 1244 |
| 418 | Ga0501082_0025055 | 3300060353 | Bacteria | 5139 |
| 419 | Ga0501082_0169949 | 3300060353 | Bacteria | 1895 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035114 | Ga0373939_0302321 | Ga0373939_0302321_113_547 | 144 |
| 2 | 3300035692 | Ga0373935_0523513 | Ga0373935_0523513_418_852 | 144 |
| 3 | 3300037068 | Ga0373925_0133426 | Ga0373925_0133426_34_468 | 144 |
| 4 | 3300046642 | Ga0495634_0343149 | Ga0495634_0343149_34_468 | 144 |
| 5 | 3300048903 | Ga0496100_0681631 | Ga0496100_0681631_14_448 | 144 |
| 6 | 3300031242 | Ga0265329_10057887 | Ga0265329_100578872 | 152 |
| 7 | 3300005437 | Ga0070710_10455555 | Ga0070710_104555551 | 155 |
| 8 | iso_pu_bacteria | 2738541317 | 2738945259 | 155 |
| 9 | iso_pu_bacteria | 2913308742 | 2913309961 | 155 |
| 10 | 3300005841 | Ga0068863_100903922 | Ga0068863_1009039221 | 156 |
| 11 | 3300006852 | Ga0075433_10127749 | Ga0075433_101277493 | 156 |
| 12 | 3300009011 | Ga0105251_10032205 | Ga0105251_100322053 | 156 |
| 13 | 3300009094 | Ga0111539_10268063 | Ga0111539_102680633 | 156 |
| 14 | 3300009148 | Ga0105243_10120837 | Ga0105243_101208373 | 156 |
| 15 | 3300009174 | Ga0105241_10644206 | Ga0105241_106442061 | 156 |
| 16 | 3300009176 | Ga0105242_10200348 | Ga0105242_102003483 | 156 |
| 17 | 3300011119 | Ga0105246_10077215 | Ga0105246_100772151 | 156 |
| 18 | 3300013104 | Ga0157370_10877021 | Ga0157370_108770212 | 156 |
| 19 | 3300013296 | Ga0157374_10002982 | Ga0157374_1000298219 | 156 |
| 20 | 3300013297 | Ga0157378_10049511 | Ga0157378_100495114 | 156 |
| 21 | 3300013297 | Ga0157378_10639247 | Ga0157378_106392473 | 156 |
| 22 | 3300013306 | Ga0163162_10023017 | Ga0163162_100230172 | 156 |
| 23 | 3300013306 | Ga0163162_11760478 | Ga0163162_117604781 | 156 |
| 24 | 3300013307 | Ga0157372_10765695 | Ga0157372_107656952 | 156 |
| 25 | 3300014969 | Ga0157376_10388846 | Ga0157376_103888461 | 156 |
| 26 | 3300031241 | Ga0265325_10084916 | Ga0265325_100849161 | 156 |
| 27 | 3300047321 | Ga0495676_0694987 | Ga0495676_0694987_10_480 | 156 |
| 28 | 3300048903 | Ga0496100_0286981 | Ga0496100_0286981_679_1149 | 156 |
| 29 | 3300048904 | Ga0496101_0001317 | Ga0496101_0001317_9312_9782 | 156 |
| 30 | 3300048904 | Ga0496101_0541259 | Ga0496101_0541259_338_808 | 156 |
| 31 | 3300048904 | Ga0496101_1128290 | Ga0496101_1128290_133_603 | 156 |
| 32 | 3300048905 | Ga0496102_0003389 | Ga0496102_0003389_4659_5129 | 156 |
| 33 | 3300048906 | Ga0496103_0108308 | Ga0496103_0108308_46_516 | 156 |
| 34 | 3300048907 | Ga0496104_0000656 | Ga0496104_0000656_15959_16429 | 156 |
| 35 | 3300048907 | Ga0496104_0451553 | Ga0496104_0451553_293_763 | 156 |
| 36 | 3300048907 | Ga0496104_0748108 | Ga0496104_0748108_307_777 | 156 |
| 37 | 3300048908 | Ga0496105_0000984 | Ga0496105_0000984_10638_11108 | 156 |
| 38 | 3300048908 | Ga0496105_0003865 | Ga0496105_0003865_7399_7869 | 156 |
| 39 | 3300048908 | Ga0496105_0167809 | Ga0496105_0167809_279_749 | 156 |
| 40 | 3300048908 | Ga0496105_0737077 | Ga0496105_0737077_113_583 | 156 |
| 41 | 3300048909 | Ga0496106_0158762 | Ga0496106_0158762_553_1023 | 156 |
| 42 | 3300048909 | Ga0496106_0932915 | Ga0496106_0932915_92_562 | 156 |
| 43 | 3300048910 | Ga0496107_0012442 | Ga0496107_0012442_4919_5389 | 156 |
| 44 | 3300048910 | Ga0496107_0486521 | Ga0496107_0486521_254_724 | 156 |
| 45 | 3300048911 | Ga0496108_0022166 | Ga0496108_0022166_4396_4866 | 156 |
| 46 | 3300048911 | Ga0496108_0044575 | Ga0496108_0044575_551_1021 | 156 |
| 47 | 3300048913 | Ga0496110_0022862 | Ga0496110_0022862_3799_4269 | 156 |
| 48 | 3300048914 | Ga0496111_0002841 | Ga0496111_0002841_1218_1688 | 156 |
| 49 | 3300048915 | Ga0496112_0402470 | Ga0496112_0402470_160_630 | 156 |
| 50 | 3300048916 | Ga0496113_0003401 | Ga0496113_0003401_2679_3149 | 156 |
| 51 | 3300048916 | Ga0496113_0328874 | Ga0496113_0328874_477_947 | 156 |
| 52 | 3300048917 | Ga0496114_0825327 | Ga0496114_0825327_80_550 | 156 |
| 53 | 3300048918 | Ga0496115_0114078 | Ga0496115_0114078_1401_1871 | 156 |
| 54 | 3300048918 | Ga0496115_0186209 | Ga0496115_0186209_504_974 | 156 |
| 55 | 3300050511 | nmdc:mga08y16_351922_c1 | nmdc:mga08y16_351922_c1_434_904 | 156 |
| 56 | 3300054114 | Ga0501084_0013235 | Ga0501084_0013235_3365_3835 | 156 |
| 57 | 3300060353 | Ga0501082_0025055 | Ga0501082_0025055_881_1351 | 156 |
| 58 | 3300035692 | Ga0373935_1119429 | Ga0373935_1119429_92_565 | 157 |
| 59 | 3300035695 | Ga0373927_0591905 | Ga0373927_0591905_154_627 | 157 |
| 60 | 3300035725 | Ga0373947_0149871 | Ga0373947_0149871_687_1160 | 157 |
| 61 | 3300046454 | Ga0495592_0766523 | Ga0495592_0766523_13_486 | 157 |
| 62 | 3300046459 | Ga0495629_0144902 | Ga0495629_0144902_320_793 | 157 |
| 63 | 3300046461 | Ga0495641_0014221 | Ga0495641_0014221_3250_3723 | 157 |
| 64 | 3300046462 | Ga0495651_0348988 | Ga0495651_0348988_31_504 | 157 |
| 65 | 3300046472 | Ga0495580_0307049 | Ga0495580_0307049_151_624 | 157 |
| 66 | 3300046473 | Ga0495582_0025029 | Ga0495582_0025029_694_1167 | 157 |
| 67 | 3300046476 | Ga0495662_0035945 | Ga0495662_0035945_60_533 | 157 |
| 68 | 3300046517 | Ga0495630_0024973 | Ga0495630_0024973_1797_2270 | 157 |
| 69 | 3300046517 | Ga0495630_0706705 | Ga0495630_0706705_56_529 | 157 |
| 70 | 3300046533 | Ga0495640_0063909 | Ga0495640_0063909_1683_2156 | 157 |
| 71 | 3300046809 | Ga0495600_0028328 | Ga0495600_0028328_2371_2844 | 157 |
| 72 | 3300047319 | Ga0495674_1285847 | Ga0495674_1285847_42_515 | 157 |
| 73 | 3300053077 | Ga0495601_0004668 | Ga0495601_0004668_4252_4725 | 157 |
| 74 | 3300053078 | Ga0495612_0017423 | Ga0495612_0017423_237_710 | 157 |
| 75 | 3300053084 | Ga0495595_0011588 | Ga0495595_0011588_1651_2124 | 157 |
| 76 | 3300053085 | Ga0495619_0013116 | Ga0495619_0013116_2761_3234 | 157 |
| 77 | iso_pu_bacteria | 2643221547 | 2643757765 | 157 |
| 78 | 3300009177 | Ga0105248_10636658 | Ga0105248_106366582 | 158 |
| 79 | 3300046499 | Ga0495594_0317004 | Ga0495594_0317004_263_739 | 158 |
| 80 | 3300047317 | Ga0495604_0053403 | Ga0495604_0053403_962_1438 | 158 |
| 81 | 3300014326 | Ga0157380_10322837 | Ga0157380_103228372 | 159 |
| 82 | 3300026075 | Ga0207708_11273066 | Ga0207708_112730661 | 159 |
| 83 | 3300049573 | Ga0501037_0044060 | Ga0501037_0044060_52_567 | 159 |
| 84 | 3300049575 | Ga0501039_0302604 | Ga0501039_0302604_765_1244 | 159 |
| 85 | 3300049581 | Ga0501047_0322472 | Ga0501047_0322472_105_620 | 159 |
| 86 | 3300049586 | Ga0501070_0030607 | Ga0501070_0030607_252_767 | 159 |
| 87 | 3300049823 | Ga0501044_0834017 | Ga0501044_0834017_33_512 | 159 |
| 88 | 3300005329 | Ga0070683_100651290 | Ga0070683_1006512901 | 160 |
| 89 | 3300005335 | Ga0070666_10227945 | Ga0070666_102279452 | 160 |
| 90 | 3300005340 | Ga0070689_100856447 | Ga0070689_1008564471 | 160 |
| 91 | 3300005355 | Ga0070671_100138488 | Ga0070671_1001384882 | 160 |
| 92 | 3300005365 | Ga0070688_100020515 | Ga0070688_1000205153 | 160 |
| 93 | 3300005367 | Ga0070667_100511221 | Ga0070667_1005112211 | 160 |
| 94 | 3300005437 | Ga0070710_10665534 | Ga0070710_106655342 | 160 |
| 95 | 3300005439 | Ga0070711_101380702 | Ga0070711_1013807021 | 160 |
| 96 | 3300005455 | Ga0070663_100039800 | Ga0070663_1000398005 | 160 |
| 97 | 3300005535 | Ga0070684_100005196 | Ga0070684_10000519614 | 160 |
| 98 | 3300005548 | Ga0070665_100139109 | Ga0070665_1001391093 | 160 |
| 99 | 3300005564 | Ga0070664_100182487 | Ga0070664_1001824873 | 160 |
| 100 | 3300005617 | Ga0068859_100534227 | Ga0068859_1005342273 | 160 |
| 101 | 3300005618 | Ga0068864_100826748 | Ga0068864_1008267482 | 160 |
| 102 | 3300005841 | Ga0068863_100104836 | Ga0068863_1001048364 | 160 |
| 103 | 3300005937 | Ga0081455_10129276 | Ga0081455_101292762 | 160 |
| 104 | 3300006028 | Ga0070717_10143002 | Ga0070717_101430023 | 160 |
| 105 | 3300006028 | Ga0070717_10271937 | Ga0070717_102719372 | 160 |
| 106 | 3300006163 | Ga0070715_10142039 | Ga0070715_101420392 | 160 |
| 107 | 3300006358 | Ga0068871_100102933 | Ga0068871_1001029335 | 160 |
| 108 | 3300006881 | Ga0068865_100507667 | Ga0068865_1005076671 | 160 |
| 109 | 3300006931 | Ga0097620_100534233 | Ga0097620_1005342333 | 160 |
| 110 | 3300025903 | Ga0207680_10235144 | Ga0207680_102351442 | 160 |
| 111 | 3300025906 | Ga0207699_10682051 | Ga0207699_106820511 | 160 |
| 112 | 3300025919 | Ga0207657_10713045 | Ga0207657_107130451 | 160 |
| 113 | 3300025928 | Ga0207700_10186342 | Ga0207700_101863422 | 160 |
| 114 | 3300025928 | Ga0207700_10328580 | Ga0207700_103285802 | 160 |
| 115 | 3300025929 | Ga0207664_10298220 | Ga0207664_102982202 | 160 |
| 116 | 3300025936 | Ga0207670_11079127 | Ga0207670_110791271 | 160 |
| 117 | 3300025938 | Ga0207704_11163917 | Ga0207704_111639172 | 160 |
| 118 | 3300025941 | Ga0207711_10049162 | Ga0207711_100491626 | 160 |
| 119 | 3300025944 | Ga0207661_10622862 | Ga0207661_106228622 | 160 |
| 120 | 3300026035 | Ga0207703_11646885 | Ga0207703_116468851 | 160 |
| 121 | 3300026088 | Ga0207641_10142056 | Ga0207641_101420561 | 160 |
| 122 | 3300026095 | Ga0207676_10572685 | Ga0207676_105726852 | 160 |
| 123 | 3300026121 | Ga0207683_10631077 | Ga0207683_106310772 | 160 |
| 124 | 3300028379 | Ga0268266_10082761 | Ga0268266_100827612 | 160 |
| 125 | 3300028381 | Ga0268264_10227388 | Ga0268264_102273881 | 160 |
| 126 | 3300031242 | Ga0265329_10234085 | Ga0265329_102340851 | 160 |
| 127 | 3300031247 | Ga0265340_10119642 | Ga0265340_101196422 | 160 |
| 128 | 3300035083 | Ga0373926_0014690 | Ga0373926_0014690_1242_1724 | 160 |
| 129 | 3300035116 | Ga0373945_0006206 | Ga0373945_0006206_2695_3177 | 160 |
| 130 | 3300035118 | Ga0373954_0081967 | Ga0373954_0081967_502_984 | 160 |
| 131 | 3300035119 | Ga0373956_0076598 | Ga0373956_0076598_790_1272 | 160 |
| 132 | 3300035170 | Ga0373943_0029860 | Ga0373943_0029860_1007_1489 | 160 |
| 133 | 3300035171 | Ga0373946_0018185 | Ga0373946_0018185_1550_2032 | 160 |
| 134 | 3300035695 | Ga0373927_0052016 | Ga0373927_0052016_705_1187 | 160 |
| 135 | 3300035724 | Ga0373933_0158396 | Ga0373933_0158396_561_1043 | 160 |
| 136 | 3300035725 | Ga0373947_0090801 | Ga0373947_0090801_1198_1680 | 160 |
| 137 | 3300037068 | Ga0373925_0017650 | Ga0373925_0017650_2600_3082 | 160 |
| 138 | 3300037418 | Ga0395900_0040807 | Ga0395900_0040807_3893_4375 | 160 |
| 139 | 3300037418 | Ga0395900_0081949 | Ga0395900_0081949_1757_2239 | 160 |
| 140 | 3300037418 | Ga0395900_0090969 | Ga0395900_0090969_1343_1825 | 160 |
| 141 | 3300037466 | Ga0395898_0145724 | Ga0395898_0145724_948_1430 | 160 |
| 142 | 3300038443 | Ga0395901_0043167 | Ga0395901_0043167_3456_3938 | 160 |
| 143 | 3300038443 | Ga0395901_0079277 | Ga0395901_0079277_1411_1893 | 160 |
| 144 | 3300046454 | Ga0495592_0079538 | Ga0495592_0079538_642_1124 | 160 |
| 145 | 3300046455 | Ga0495603_0048834 | Ga0495603_0048834_1544_2026 | 160 |
| 146 | 3300046463 | Ga0495653_0134261 | Ga0495653_0134261_1044_1526 | 160 |
| 147 | 3300046472 | Ga0495580_0032083 | Ga0495580_0032083_594_1076 | 160 |
| 148 | 3300046475 | Ga0495639_0028094 | Ga0495639_0028094_246_728 | 160 |
| 149 | 3300046476 | Ga0495662_0007383 | Ga0495662_0007383_4126_4608 | 160 |
| 150 | 3300046477 | Ga0495664_0204408 | Ga0495664_0204408_477_959 | 160 |
| 151 | 3300046492 | Ga0495585_0047456 | Ga0495585_0047456_1262_1744 | 160 |
| 152 | 3300046499 | Ga0495594_0025889 | Ga0495594_0025889_903_1385 | 160 |
| 153 | 3300046501 | Ga0495607_0364731 | Ga0495607_0364731_17_499 | 160 |
| 154 | 3300046511 | Ga0495608_0089005 | Ga0495608_0089005_714_1196 | 160 |
| 155 | 3300046514 | Ga0495618_0028441 | Ga0495618_0028441_946_1428 | 160 |
| 156 | 3300046523 | Ga0495644_0050151 | Ga0495644_0050151_1041_1523 | 160 |
| 157 | 3300046526 | Ga0495666_0109722 | Ga0495666_0109722_764_1246 | 160 |
| 158 | 3300046529 | Ga0495652_0158436 | Ga0495652_0158436_463_945 | 160 |
| 159 | 3300046531 | Ga0495665_0037217 | Ga0495665_0037217_1100_1582 | 160 |
| 160 | 3300046536 | Ga0495587_0051060 | Ga0495587_0051060_673_1155 | 160 |
| 161 | 3300046557 | Ga0495622_0018813 | Ga0495622_0018813_1248_1730 | 160 |
| 162 | 3300046558 | Ga0495633_0037406 | Ga0495633_0037406_1028_1510 | 160 |
| 163 | 3300046559 | Ga0495667_0032858 | Ga0495667_0032858_1149_1631 | 160 |
| 164 | 3300046642 | Ga0495634_0041514 | Ga0495634_0041514_2149_2631 | 160 |
| 165 | 3300046663 | Ga0495635_0034228 | Ga0495635_0034228_752_1234 | 160 |
| 166 | 3300046665 | Ga0495661_0606424 | Ga0495661_0606424_22_504 | 160 |
| 167 | 3300046674 | Ga0495588_0068722 | Ga0495588_0068722_368_850 | 160 |
| 168 | 3300046678 | Ga0495599_0096624 | Ga0495599_0096624_1216_1698 | 160 |
| 169 | 3300046680 | Ga0495646_0092307 | Ga0495646_0092307_276_758 | 160 |
| 170 | 3300046681 | Ga0495647_0015063 | Ga0495647_0015063_1442_1924 | 160 |
| 171 | 3300046683 | Ga0495658_0065839 | Ga0495658_0065839_705_1187 | 160 |
| 172 | 3300046689 | Ga0495613_0064917 | Ga0495613_0064917_402_884 | 160 |
| 173 | 3300046690 | Ga0495624_0053165 | Ga0495624_0053165_614_1096 | 160 |
| 174 | 3300047315 | Ga0495581_0271431 | Ga0495581_0271431_199_681 | 160 |
| 175 | 3300047319 | Ga0495674_0014838 | Ga0495674_0014838_6554_7036 | 160 |
| 176 | 3300047321 | Ga0495676_0249759 | Ga0495676_0249759_509_991 | 160 |
| 177 | 3300047322 | Ga0495680_0015838 | Ga0495680_0015838_4159_4641 | 160 |
| 178 | 3300047471 | Ga0495684_0039229 | Ga0495684_0039229_2645_3127 | 160 |
| 179 | 3300047673 | Ga0495593_0053675 | Ga0495593_0053675_241_723 | 160 |
| 180 | 3300048089 | Ga0495614_0034888 | Ga0495614_0034888_1298_1780 | 160 |
| 181 | 3300049741 | Ga0501079_0506441 | Ga0501079_0506441_406_888 | 160 |
| 182 | 3300053077 | Ga0495601_0136580 | Ga0495601_0136580_131_613 | 160 |
| 183 | 3300053085 | Ga0495619_0156322 | Ga0495619_0156322_131_613 | 160 |
| 184 | 3300005327 | Ga0070658_10061382 | Ga0070658_100613825 | 161 |
| 185 | 3300005329 | Ga0070683_100073289 | Ga0070683_1000732893 | 161 |
| 186 | 3300005336 | Ga0070680_100033874 | Ga0070680_1000338746 | 161 |
| 187 | 3300005336 | Ga0070680_100300316 | Ga0070680_1003003162 | 161 |
| 188 | 3300005336 | Ga0070680_100300357 | Ga0070680_1003003572 | 161 |
| 189 | 3300005339 | Ga0070660_100077466 | Ga0070660_1000774663 | 161 |
| 190 | 3300005366 | Ga0070659_101446500 | Ga0070659_1014465001 | 161 |
| 191 | 3300005434 | Ga0070709_10098013 | Ga0070709_100980133 | 161 |
| 192 | 3300005435 | Ga0070714_100044960 | Ga0070714_1000449602 | 161 |
| 193 | 3300005435 | Ga0070714_100089725 | Ga0070714_1000897254 | 161 |
| 194 | 3300005436 | Ga0070713_100112278 | Ga0070713_1001122782 | 161 |
| 195 | 3300005437 | Ga0070710_10014309 | Ga0070710_100143095 | 161 |
| 196 | 3300005437 | Ga0070710_10017541 | Ga0070710_100175413 | 161 |
| 197 | 3300005437 | Ga0070710_10108014 | Ga0070710_101080143 | 161 |
| 198 | 3300005456 | Ga0070678_100090064 | Ga0070678_1000900641 | 161 |
| 199 | 3300005456 | Ga0070678_100557889 | Ga0070678_1005578891 | 161 |
| 200 | 3300005457 | Ga0070662_100117296 | Ga0070662_1001172964 | 161 |
| 201 | 3300005457 | Ga0070662_100603959 | Ga0070662_1006039591 | 161 |
| 202 | 3300005458 | Ga0070681_10057453 | Ga0070681_100574535 | 161 |
| 203 | 3300005458 | Ga0070681_10151611 | Ga0070681_101516114 | 161 |
| 204 | 3300005458 | Ga0070681_11250076 | Ga0070681_112500761 | 161 |
| 205 | 3300005467 | Ga0070706_100239110 | Ga0070706_1002391103 | 161 |
| 206 | 3300005471 | Ga0070698_100042133 | Ga0070698_1000421335 | 161 |
| 207 | 3300005518 | Ga0070699_100000995 | Ga0070699_10000099529 | 161 |
| 208 | 3300005518 | Ga0070699_100034096 | Ga0070699_1000340965 | 161 |
| 209 | 3300005518 | Ga0070699_100920820 | Ga0070699_1009208201 | 161 |
| 210 | 3300005530 | Ga0070679_100102694 | Ga0070679_1001026942 | 161 |
| 211 | 3300005530 | Ga0070679_100675952 | Ga0070679_1006759521 | 161 |
| 212 | 3300005530 | Ga0070679_100814555 | Ga0070679_1008145552 | 161 |
| 213 | 3300005535 | Ga0070684_100053201 | Ga0070684_1000532014 | 161 |
| 214 | 3300005536 | Ga0070697_100015176 | Ga0070697_1000151764 | 161 |
| 215 | 3300005539 | Ga0068853_100139058 | Ga0068853_1001390581 | 161 |
| 216 | 3300005546 | Ga0070696_100180744 | Ga0070696_1001807442 | 161 |
| 217 | 3300005547 | Ga0070693_100068638 | Ga0070693_1000686381 | 161 |
| 218 | 3300005563 | Ga0068855_100172075 | Ga0068855_1001720754 | 161 |
| 219 | 3300005563 | Ga0068855_100232884 | Ga0068855_1002328843 | 161 |
| 220 | 3300005563 | Ga0068855_101028168 | Ga0068855_1010281682 | 161 |
| 221 | 3300005564 | Ga0070664_100555625 | Ga0070664_1005556251 | 161 |
| 222 | 3300005577 | Ga0068857_100217621 | Ga0068857_1002176211 | 161 |
| 223 | 3300005578 | Ga0068854_100069987 | Ga0068854_1000699874 | 161 |
| 224 | 3300005983 | Ga0081540_1021322 | Ga0081540_10213225 | 161 |
| 225 | 3300006028 | Ga0070717_10004907 | Ga0070717_100049076 | 161 |
| 226 | 3300006028 | Ga0070717_10035317 | Ga0070717_100353174 | 161 |
| 227 | 3300006163 | Ga0070715_10147774 | Ga0070715_101477742 | 161 |
| 228 | 3300006173 | Ga0070716_100645948 | Ga0070716_1006459481 | 161 |
| 229 | 3300006175 | Ga0070712_100015178 | Ga0070712_1000151786 | 161 |
| 230 | 3300006175 | Ga0070712_100026255 | Ga0070712_1000262556 | 161 |
| 231 | 3300006175 | Ga0070712_100563947 | Ga0070712_1005639471 | 161 |
| 232 | 3300006175 | Ga0070712_100815699 | Ga0070712_1008156991 | 161 |
| 233 | 3300006175 | Ga0070712_101029392 | Ga0070712_1010293922 | 161 |
| 234 | 3300006358 | Ga0068871_100147247 | Ga0068871_1001472472 | 161 |
| 235 | 3300006871 | Ga0075434_100058101 | Ga0075434_1000581012 | 161 |
| 236 | 3300006914 | Ga0075436_100269513 | Ga0075436_1002695132 | 161 |
| 237 | 3300007076 | Ga0075435_100214447 | Ga0075435_1002144471 | 161 |
| 238 | 3300007076 | Ga0075435_100539121 | Ga0075435_1005391211 | 161 |
| 239 | 3300009093 | Ga0105240_10037246 | Ga0105240_100372463 | 161 |
| 240 | 3300009093 | Ga0105240_10108770 | Ga0105240_101087703 | 161 |
| 241 | 3300009147 | Ga0114129_10028547 | Ga0114129_100285474 | 161 |
| 242 | 3300009148 | Ga0105243_10338209 | Ga0105243_103382092 | 161 |
| 243 | 3300009174 | Ga0105241_10952875 | Ga0105241_109528751 | 161 |
| 244 | 3300009551 | Ga0105238_10760049 | Ga0105238_107600491 | 161 |
| 245 | 3300013100 | Ga0157373_10053097 | Ga0157373_100530974 | 161 |
| 246 | 3300013100 | Ga0157373_10160790 | Ga0157373_101607901 | 161 |
| 247 | 3300013100 | Ga0157373_10665054 | Ga0157373_106650541 | 161 |
| 248 | 3300013100 | Ga0157373_10713604 | Ga0157373_107136041 | 161 |
| 249 | 3300013102 | Ga0157371_10105980 | Ga0157371_101059802 | 161 |
| 250 | 3300013102 | Ga0157371_10356718 | Ga0157371_103567181 | 161 |
| 251 | 3300013104 | Ga0157370_10100021 | Ga0157370_101000215 | 161 |
| 252 | 3300013105 | Ga0157369_10076116 | Ga0157369_100761163 | 161 |
| 253 | 3300013105 | Ga0157369_10924423 | Ga0157369_109244232 | 161 |
| 254 | 3300013296 | Ga0157374_10756784 | Ga0157374_107567842 | 161 |
| 255 | 3300013307 | Ga0157372_10090178 | Ga0157372_100901783 | 161 |
| 256 | 3300013307 | Ga0157372_10398349 | Ga0157372_103983491 | 161 |
| 257 | 3300013308 | Ga0157375_10069339 | Ga0157375_100693392 | 161 |
| 258 | 3300013308 | Ga0157375_10889074 | Ga0157375_108890742 | 161 |
| 259 | 3300014325 | Ga0163163_11193290 | Ga0163163_111932901 | 161 |
| 260 | 3300014497 | Ga0182008_10062914 | Ga0182008_100629142 | 161 |
| 261 | 3300014497 | Ga0182008_10200031 | Ga0182008_102000311 | 161 |
| 262 | 3300014969 | Ga0157376_10024378 | Ga0157376_100243785 | 161 |
| 263 | 3300014969 | Ga0157376_10460340 | Ga0157376_104603402 | 161 |
| 264 | 3300015261 | Ga0182006_1121307 | Ga0182006_11213072 | 161 |
| 265 | 3300021361 | Ga0213872_10096248 | Ga0213872_100962482 | 161 |
| 266 | 3300025898 | Ga0207692_10014453 | Ga0207692_100144534 | 161 |
| 267 | 3300025898 | Ga0207692_10501595 | Ga0207692_105015951 | 161 |
| 268 | 3300025905 | Ga0207685_10273700 | Ga0207685_102737001 | 161 |
| 269 | 3300025906 | Ga0207699_10015268 | Ga0207699_100152682 | 161 |
| 270 | 3300025909 | Ga0207705_10046717 | Ga0207705_100467172 | 161 |
| 271 | 3300025909 | Ga0207705_10186293 | Ga0207705_101862932 | 161 |
| 272 | 3300025910 | Ga0207684_10031621 | Ga0207684_100316214 | 161 |
| 273 | 3300025912 | Ga0207707_10039500 | Ga0207707_100395005 | 161 |
| 274 | 3300025913 | Ga0207695_10163764 | Ga0207695_101637644 | 161 |
| 275 | 3300025913 | Ga0207695_10304807 | Ga0207695_103048072 | 161 |
| 276 | 3300025915 | Ga0207693_10007243 | Ga0207693_100072438 | 161 |
| 277 | 3300025915 | Ga0207693_10033810 | Ga0207693_100338103 | 161 |
| 278 | 3300025915 | Ga0207693_10385515 | Ga0207693_103855151 | 161 |
| 279 | 3300025915 | Ga0207693_10762419 | Ga0207693_107624191 | 161 |
| 280 | 3300025916 | Ga0207663_10142844 | Ga0207663_101428442 | 161 |
| 281 | 3300025917 | Ga0207660_10387029 | Ga0207660_103870292 | 161 |
| 282 | 3300025921 | Ga0207652_10086948 | Ga0207652_100869484 | 161 |
| 283 | 3300025921 | Ga0207652_10101678 | Ga0207652_101016783 | 161 |
| 284 | 3300025921 | Ga0207652_10576893 | Ga0207652_105768932 | 161 |
| 285 | 3300025929 | Ga0207664_10062494 | Ga0207664_100624944 | 161 |
| 286 | 3300025929 | Ga0207664_10144812 | Ga0207664_101448123 | 161 |
| 287 | 3300025929 | Ga0207664_10384371 | Ga0207664_103843712 | 161 |
| 288 | 3300025929 | Ga0207664_10688402 | Ga0207664_106884021 | 161 |
| 289 | 3300025933 | Ga0207706_11003433 | Ga0207706_110034331 | 161 |
| 290 | 3300025939 | Ga0207665_10085180 | Ga0207665_100851802 | 161 |
| 291 | 3300025939 | Ga0207665_10136560 | Ga0207665_101365602 | 161 |
| 292 | 3300025944 | Ga0207661_10220162 | Ga0207661_102201622 | 161 |
| 293 | 3300025949 | Ga0207667_10153179 | Ga0207667_101531793 | 161 |
| 294 | 3300025949 | Ga0207667_10335577 | Ga0207667_103355773 | 161 |
| 295 | 3300025981 | Ga0207640_10554267 | Ga0207640_105542671 | 161 |
| 296 | 3300026041 | Ga0207639_10248305 | Ga0207639_102483052 | 161 |
| 297 | 3300026078 | Ga0207702_10925226 | Ga0207702_109252261 | 161 |
| 298 | 3300026116 | Ga0207674_10315218 | Ga0207674_103152182 | 161 |
| 299 | 3300026121 | Ga0207683_10277182 | Ga0207683_102771822 | 161 |
| 300 | 3300028577 | Ga0265318_10010184 | Ga0265318_100101842 | 161 |
| 301 | 3300031235 | Ga0265330_10089429 | Ga0265330_100894291 | 161 |
| 302 | 3300031238 | Ga0265332_10011180 | Ga0265332_100111803 | 161 |
| 303 | 3300031238 | Ga0265332_10072535 | Ga0265332_100725351 | 161 |
| 304 | 3300031241 | Ga0265325_10000052 | Ga0265325_1000005256 | 161 |
| 305 | 3300031241 | Ga0265325_10062949 | Ga0265325_100629493 | 161 |
| 306 | 3300031241 | Ga0265325_10069661 | Ga0265325_100696613 | 161 |
| 307 | 3300031241 | Ga0265325_10074347 | Ga0265325_100743472 | 161 |
| 308 | 3300031242 | Ga0265329_10016987 | Ga0265329_100169872 | 161 |
| 309 | 3300031247 | Ga0265340_10021297 | Ga0265340_100212972 | 161 |
| 310 | 3300031247 | Ga0265340_10021424 | Ga0265340_100214244 | 161 |
| 311 | 3300031247 | Ga0265340_10028435 | Ga0265340_100284352 | 161 |
| 312 | 3300031247 | Ga0265340_10097420 | Ga0265340_100974202 | 161 |
| 313 | 3300031249 | Ga0265339_10011191 | Ga0265339_100111913 | 161 |
| 314 | 3300031249 | Ga0265339_10030799 | Ga0265339_100307994 | 161 |
| 315 | 3300031250 | Ga0265331_10017186 | Ga0265331_100171861 | 161 |
| 316 | 3300031250 | Ga0265331_10051500 | Ga0265331_100515002 | 161 |
| 317 | 3300031344 | Ga0265316_10173927 | Ga0265316_101739271 | 161 |
| 318 | 3300031344 | Ga0265316_10450938 | Ga0265316_104509381 | 161 |
| 319 | 3300031595 | Ga0265313_10000008 | Ga0265313_100000087 | 161 |
| 320 | 3300031595 | Ga0265313_10026117 | Ga0265313_100261175 | 161 |
| 321 | 3300031595 | Ga0265313_10028804 | Ga0265313_100288044 | 161 |
| 322 | 3300031595 | Ga0265313_10037828 | Ga0265313_100378283 | 161 |
| 323 | 3300031712 | Ga0265342_10001784 | Ga0265342_100017845 | 161 |
| 324 | 3300031712 | Ga0265342_10012513 | Ga0265342_100125136 | 161 |
| 325 | 3300031712 | Ga0265342_10107319 | Ga0265342_101073192 | 161 |
| 326 | 3300033529 | Ga0316587_1090471 | Ga0316587_10904711 | 161 |
| 327 | 3300035111 | Ga0373923_0124497 | Ga0373923_0124497_459_944 | 161 |
| 328 | 3300035113 | Ga0373936_0373819 | Ga0373936_0373819_146_631 | 161 |
| 329 | 3300035118 | Ga0373954_0027909 | Ga0373954_0027909_2030_2515 | 161 |
| 330 | 3300035170 | Ga0373943_0025268 | Ga0373943_0025268_58_543 | 161 |
| 331 | 3300035172 | Ga0373955_0253088 | Ga0373955_0253088_549_1034 | 161 |
| 332 | 3300035410 | Ga0373924_0009995 | Ga0373924_0009995_1841_2326 | 161 |
| 333 | 3300035692 | Ga0373935_0121606 | Ga0373935_0121606_215_700 | 161 |
| 334 | 3300035724 | Ga0373933_0020533 | Ga0373933_0020533_1469_1954 | 161 |
| 335 | 3300035725 | Ga0373947_0417743 | Ga0373947_0417743_381_866 | 161 |
| 336 | 3300036401 | Ga0373937_0052670 | Ga0373937_0052670_1776_2261 | 161 |
| 337 | 3300037312 | Ga0395899_0026752 | Ga0395899_0026752_684_1169 | 161 |
| 338 | 3300037418 | Ga0395900_0301454 | Ga0395900_0301454_667_1152 | 161 |
| 339 | 3300038443 | Ga0395901_0040068 | Ga0395901_0040068_745_1230 | 161 |
| 340 | 3300039447 | Ga0436361_0544746 | Ga0436361_0544746_957_1442 | 161 |
| 341 | 3300039447 | Ga0436361_0993144 | Ga0436361_0993144_114_599 | 161 |
| 342 | 3300039453 | Ga0436362_0365207 | Ga0436362_0365207_39_536 | 161 |
| 343 | 3300046454 | Ga0495592_0015735 | Ga0495592_0015735_2359_2844 | 161 |
| 344 | 3300046459 | Ga0495629_0067971 | Ga0495629_0067971_517_1002 | 161 |
| 345 | 3300046461 | Ga0495641_0075901 | Ga0495641_0075901_76_561 | 161 |
| 346 | 3300046462 | Ga0495651_0007960 | Ga0495651_0007960_7505_7990 | 161 |
| 347 | 3300046463 | Ga0495653_0033585 | Ga0495653_0033585_1752_2237 | 161 |
| 348 | 3300046477 | Ga0495664_0014507 | Ga0495664_0014507_2416_2901 | 161 |
| 349 | 3300046491 | Ga0495584_0307816 | Ga0495584_0307816_65_568 | 161 |
| 350 | 3300046511 | Ga0495608_0001202 | Ga0495608_0001202_6839_7324 | 161 |
| 351 | 3300046514 | Ga0495618_0022789 | Ga0495618_0022789_1478_1963 | 161 |
| 352 | 3300046514 | Ga0495618_0242777 | Ga0495618_0242777_494_991 | 161 |
| 353 | 3300046517 | Ga0495630_0039573 | Ga0495630_0039573_1770_2255 | 161 |
| 354 | 3300046529 | Ga0495652_0042798 | Ga0495652_0042798_1352_1837 | 161 |
| 355 | 3300046531 | Ga0495665_0040734 | Ga0495665_0040734_1470_1967 | 161 |
| 356 | 3300046531 | Ga0495665_0298721 | Ga0495665_0298721_102_587 | 161 |
| 357 | 3300046533 | Ga0495640_0005285 | Ga0495640_0005285_7445_7930 | 161 |
| 358 | 3300046535 | Ga0495586_0036227 | Ga0495586_0036227_234_719 | 161 |
| 359 | 3300046536 | Ga0495587_0003946 | Ga0495587_0003946_2097_2582 | 161 |
| 360 | 3300046543 | Ga0495645_0136602 | Ga0495645_0136602_1033_1518 | 161 |
| 361 | 3300046559 | Ga0495667_0001632 | Ga0495667_0001632_12119_12604 | 161 |
| 362 | 3300046559 | Ga0495667_0223386 | Ga0495667_0223386_233_730 | 161 |
| 363 | 3300046642 | Ga0495634_0021979 | Ga0495634_0021979_75_572 | 161 |
| 364 | 3300046642 | Ga0495634_0245635 | Ga0495634_0245635_205_690 | 161 |
| 365 | 3300046675 | Ga0495657_0037585 | Ga0495657_0037585_2439_2924 | 161 |
| 366 | 3300046678 | Ga0495599_0014038 | Ga0495599_0014038_2590_3075 | 161 |
| 367 | 3300046679 | Ga0495623_0039434 | Ga0495623_0039434_1923_2408 | 161 |
| 368 | 3300046680 | Ga0495646_0023391 | Ga0495646_0023391_1764_2249 | 161 |
| 369 | 3300046689 | Ga0495613_0168700 | Ga0495613_0168700_168_653 | 161 |
| 370 | 3300046809 | Ga0495600_0035604 | Ga0495600_0035604_1580_2065 | 161 |
| 371 | 3300047317 | Ga0495604_0011863 | Ga0495604_0011863_129_614 | 161 |
| 372 | 3300047319 | Ga0495674_0004082 | Ga0495674_0004082_880_1365 | 161 |
| 373 | 3300047321 | Ga0495676_0078085 | Ga0495676_0078085_177_662 | 161 |
| 374 | 3300047322 | Ga0495680_0034361 | Ga0495680_0034361_845_1330 | 161 |
| 375 | 3300047444 | Ga0495675_0026881 | Ga0495675_0026881_1741_2226 | 161 |
| 376 | 3300047471 | Ga0495684_0088401 | Ga0495684_0088401_395_892 | 161 |
| 377 | 3300047471 | Ga0495684_0108427 | Ga0495684_0108427_1400_1885 | 161 |
| 378 | 3300048088 | Ga0495602_0052740 | Ga0495602_0052740_1688_2173 | 161 |
| 379 | 3300048903 | Ga0496100_0058615 | Ga0496100_0058615_1578_2063 | 161 |
| 380 | 3300048904 | Ga0496101_0191380 | Ga0496101_0191380_43_528 | 161 |
| 381 | 3300048907 | Ga0496104_0519141 | Ga0496104_0519141_189_674 | 161 |
| 382 | 3300048907 | Ga0496104_1059765 | Ga0496104_1059765_103_588 | 161 |
| 383 | 3300048917 | Ga0496114_0396899 | Ga0496114_0396899_440_925 | 161 |
| 384 | 3300048918 | Ga0496115_0032561 | Ga0496115_0032561_1858_2343 | 161 |
| 385 | 3300049571 | Ga0501034_0089063 | Ga0501034_0089063_524_1135 | 161 |
| 386 | 3300049576 | Ga0501040_0063995 | Ga0501040_0063995_623_1111 | 161 |
| 387 | 3300049576 | Ga0501040_1134153 | Ga0501040_1134153_64_552 | 161 |
| 388 | 3300049577 | Ga0501041_0187564 | Ga0501041_0187564_378_866 | 161 |
| 389 | 3300049579 | Ga0501043_0145242 | Ga0501043_0145242_561_1061 | 161 |
| 390 | 3300049580 | Ga0501046_0130260 | Ga0501046_0130260_1407_1895 | 161 |
| 391 | 3300049580 | Ga0501046_0134680 | Ga0501046_0134680_1195_1683 | 161 |
| 392 | 3300049580 | Ga0501046_0546169 | Ga0501046_0546169_25_522 | 161 |
| 393 | 3300049589 | Ga0501073_0333755 | Ga0501073_0333755_540_1025 | 161 |
| 394 | 3300049590 | Ga0501074_0092936 | Ga0501074_0092936_193_705 | 161 |
| 395 | 3300049590 | Ga0501074_0137161 | Ga0501074_0137161_1076_1564 | 161 |
| 396 | 3300049591 | Ga0501075_0062487 | Ga0501075_0062487_1213_1701 | 161 |
| 397 | 3300049591 | Ga0501075_0102132 | Ga0501075_0102132_770_1258 | 161 |
| 398 | 3300049592 | Ga0501076_0508203 | Ga0501076_0508203_329_817 | 161 |
| 399 | 3300049592 | Ga0501076_0582286 | Ga0501076_0582286_172_657 | 161 |
| 400 | 3300049741 | Ga0501079_0097373 | Ga0501079_0097373_1128_1616 | 161 |
| 401 | 3300049741 | Ga0501079_0110063 | Ga0501079_0110063_689_1177 | 161 |
| 402 | 3300049742 | Ga0501080_0510774 | Ga0501080_0510774_287_772 | 161 |
| 403 | 3300049743 | Ga0501081_0054131 | Ga0501081_0054131_1135_1623 | 161 |
| 404 | 3300049743 | Ga0501081_0064234 | Ga0501081_0064234_1616_2104 | 161 |
| 405 | 3300049744 | Ga0501083_0041218 | Ga0501083_0041218_1079_1591 | 161 |
| 406 | 3300049744 | Ga0501083_0147112 | Ga0501083_0147112_754_1251 | 161 |
| 407 | 3300049822 | Ga0501035_0331753 | Ga0501035_0331753_580_1080 | 161 |
| 408 | 3300050507 | nmdc:mga05p37_19716_c1 | nmdc:mga05p37_19716_c1_6588_7097 | 161 |
| 409 | 3300050508 | nmdc:mga09592_557999_c1 | nmdc:mga09592_557999_c1_131_640 | 161 |
| 410 | 3300050512 | nmdc:mga0n895_195647_c1 | nmdc:mga0n895_195647_c1_617_1114 | 161 |
| 411 | 3300050512 | nmdc:mga0n895_68883_c1 | nmdc:mga0n895_68883_c1_1488_1997 | 161 |
| 412 | 3300050513 | nmdc:mga0rr50_626090_c1 | nmdc:mga0rr50_626090_c1_346_831 | 161 |
| 413 | 3300050513 | nmdc:mga0rr50_698492_c1 | nmdc:mga0rr50_698492_c1_168_677 | 161 |
| 414 | 3300050514 | nmdc:mga08x19_323906_c1 | nmdc:mga08x19_323906_c1_373_858 | 161 |
| 415 | 3300053077 | Ga0495601_0001438 | Ga0495601_0001438_1499_1984 | 161 |
| 416 | 3300053078 | Ga0495612_0015683 | Ga0495612_0015683_588_1073 | 161 |
| 417 | 3300053084 | Ga0495595_0000491 | Ga0495595_0000491_1834_2319 | 161 |
| 418 | 3300053085 | Ga0495619_0106260 | Ga0495619_0106260_949_1434 | 161 |
| 419 | 3300053085 | Ga0495619_0524879 | Ga0495619_0524879_265_750 | 161 |
| 420 | 3300053125 | Ga0500618_061907 | Ga0500618_061907_239_724 | 161 |
| 421 | 3300054114 | Ga0501084_0352008 | Ga0501084_0352008_159_647 | 161 |
| 422 | 3300060353 | Ga0501082_0169949 | Ga0501082_0169949_344_829 | 161 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ysl-assembly1.cif.gz_G | structure of the flagellar motab stator complex from bacillus subtilis | 0.3371 | 50 | 160 |
| 6tyi-assembly1.cif.gz_D | exbb-exbd complex in msp1e3d1 nanodisc | 0.2851 | 18 | 160 |
| 8bri-assembly1.cif.gz_C | vapomab msp1d1 nanodisc | 0.2767 | 85 | 161 |
| 3jrt-assembly1.cif.gz_A-2 | structure from the mobile metagenome of v. paracholerae: integron cassette protein vpc_cass2 | 0.2585 | 1 | 158 |
| 6ysl-assembly1.cif.gz_G | structure of the flagellar motab stator complex from bacillus subtilis | 0.2488 | 50 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E5C0_1_157_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6459 | 9 | 157 | 1.20.120.550 |
| af_I1LYI2_1_138_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6408 | 12 | 131 | 1.20.120.550 |
| af_Q2FUV7_1_119_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.6137 | 10 | 133 | 1.10.10.1740 |
| af_A4IAM6_1_156_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6125 | 8 | 133 | 1.20.120.550 |
| af_Q9LSW5_1_134_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6054 | 10 | 135 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3KP91-F1-model_v4 | deleted | 0.9648 | 3 | 161 |
|
| AF-A0A1Q3KP91-F1-model_v4 | deleted | 0.9589 | 3 | 161 |
|
| AF-A0A525I9V7-F1-model_v4 | DoxX family protein | 0.9442 | 8 | 161 |
GO:0016020
|
| AF-A0A355WPB5-F1-model_v4 | DoxX family protein | 0.9422 | 1 | 161 |
GO:0005886
|
| AF-A0A1H4KGD2-F1-model_v4 | Thiosulfate dehydrogenase [quinone] large subunit | 0.9389 | 7 | 144 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar