F440449

General Info

Members Datasets Scaffolds Average Seq Length
423 233 846 444

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100015197|Ga0070683_1000151972
Length 516
Sequence MASLDSSPTALKLIAALRLPVTSHAHRVLRRYILGFRNTALKTICFQLEIQVNYPRSVRGAIAICVGALFLVAAALPAQQWKAPTSMKKLSNGLTVVVSEDHSAPTFGVCVSYGIGFRLEPEGRTGFAHLFEHLMFEGTPNAPKGVLDRVIEGGGGANNGDTRYDYTEYIETAPISALDPVLWIEADRMKTLDFSPKNLDNQRNVVEEEVRVNVLNQPYGLFFAIDLPGKAFDTYPNAHNFYGDFKDLDAAKIEDVKAFYEKYYTPGNAVMAIVGDVKPEEVFAKVEKYFGQIPSRSTPPKPKVDEPPQKAERRSSETDKLARVPGLAIGYRMPPHKSPDALAAAVTGELLHNGQASRLYQALVKDKQVALSVDGGVNWPLGTPFEYAGPTLMVSFIVYPPNVTEDQVLAAYDGAVKELAENGPTQQDLDRIVAKMRSDMYGNLEIPINRASALSHAVLFDGNFDSVYQIPEELSKVTAAQVKAFAAKYLVITNRTIINRTPAAAPAGGKEKGAGQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 2.36
Rhizosphere 95.51
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100015197 3300005329 Bacteria 6758
2 rootH1_10299149 3300003323 Bacteria 2157
3 Ga0065707_10147442 3300005295 Bacteria 1697
4 Ga0070658_10173365 3300005327 Bacteria 1813
5 Ga0070683_100040158 3300005329 Bacteria 4300
6 Ga0070690_100023148 3300005330 Bacteria 3808
7 Ga0068869_100005534 3300005334 Bacteria 7952
8 Ga0070689_100038444 3300005340 Bacteria 3661
9 Ga0070661_100089450 3300005344 Bacteria 2280
10 Ga0070692_10082414 3300005345 Bacteria 1734
11 Ga0070668_100042940 3300005347 Bacteria 3465
12 Ga0070675_100044861 3300005354 Bacteria 3616
13 Ga0070671_100053593 3300005355 Bacteria 3353
14 Ga0070673_100099274 3300005364 Bacteria 2395
15 Ga0070688_100007957 3300005365 Bacteria 5733
16 Ga0070709_10014128 3300005434 Bacteria 4510
17 Ga0070709_10048932 3300005434 Bacteria 2640
18 Ga0070709_10110937 3300005434 Bacteria 1844
19 Ga0070713_100011478 3300005436 Bacteria 6454
20 Ga0070713_100028597 3300005436 Bacteria 4403
21 Ga0070713_100056102 3300005436 Bacteria 3276
22 Ga0070713_100152929 3300005436 Bacteria 2054
23 Ga0070701_10001278 3300005438 Bacteria 9249
24 Ga0070711_100001258 3300005439 Bacteria 13746
25 Ga0070711_100085982 3300005439 Bacteria 2254
26 Ga0070705_100006004 3300005440 Bacteria 5942
27 Ga0070700_100012078 3300005441 Bacteria 4803
28 Ga0070694_100168330 3300005444 Bacteria 1613
29 Ga0070708_100069836 3300005445 Bacteria 3159
30 Ga0070678_100011351 3300005456 Bacteria 5491
31 Ga0068867_100018651 3300005459 Bacteria 4933
32 Ga0070706_100050476 3300005467 Bacteria 3839
33 Ga0070707_100002393 3300005468 Bacteria 17911
34 Ga0070698_100004510 3300005471 Bacteria 15307
35 Ga0070698_100010239 3300005471 Bacteria 10013
36 Ga0070699_100045521 3300005518 Bacteria 3798
37 Ga0070699_100064773 3300005518 Bacteria 3170
38 Ga0070684_100051680 3300005535 Bacteria 3571
39 Ga0070684_100080876 3300005535 Bacteria 2875
40 Ga0070697_100007778 3300005536 Bacteria 8343
41 Ga0070697_100086567 3300005536 Bacteria 2586
42 Ga0068853_100000025 3300005539 Bacteria 136123
43 Ga0070672_100103390 3300005543 Bacteria 2313
44 Ga0070696_100000576 3300005546 Bacteria 23446
45 Ga0070696_100129117 3300005546 Bacteria 1837
46 Ga0070693_100000336 3300005547 Bacteria 21418
47 Ga0070665_100000666 3300005548 Bacteria 46257
48 Ga0070665_100036975 3300005548 Bacteria 4910
49 Ga0070704_100002079 3300005549 Bacteria 11127
50 Ga0068855_100006377 3300005563 Bacteria 14375
51 Ga0068855_100008541 3300005563 Bacteria 12380
52 Ga0068855_100097082 3300005563 Bacteria 3394
53 Ga0068857_100008401 3300005577 Bacteria 8919
54 Ga0068857_100119644 3300005577 Bacteria 2371
55 Ga0068857_100146156 3300005577 Bacteria 2139
56 Ga0068854_100035619 3300005578 Bacteria 3484
57 Ga0068856_100005089 3300005614 Bacteria 12998
58 Ga0068856_100021896 3300005614 Bacteria 6214
59 Ga0068856_100108778 3300005614 Bacteria 2768
60 Ga0068852_100000085 3300005616 Bacteria 65171
61 Ga0068852_100000098 3300005616 Bacteria 58711
62 Ga0068852_100065459 3300005616 Bacteria 3171
63 Ga0068859_100040309 3300005617 Bacteria 4687
64 Ga0068866_10020220 3300005718 Bacteria 3047
65 Ga0068851_10041304 3300005834 Bacteria 2319
66 Ga0068870_10016452 3300005840 Bacteria 3533
67 Ga0068863_100005665 3300005841 Bacteria 12267
68 Ga0068863_100020760 3300005841 Bacteria 6273
69 Ga0068858_100028483 3300005842 Bacteria 5189
70 Ga0068860_100002880 3300005843 Bacteria 17851
71 Ga0068860_100309203 3300005843 Bacteria 1549
72 Ga0070717_10001437 3300006028 Bacteria 16415
73 Ga0070717_10108725 3300006028 Bacteria 2363
74 Ga0070716_100000045 3300006173 Bacteria 50223
75 Ga0070716_100000212 3300006173 Bacteria 23181
76 Ga0070716_100005481 3300006173 Bacteria 6152
77 Ga0070716_100018198 3300006173 Bacteria 3655
78 Ga0070712_100012776 3300006175 Bacteria 5344
79 Ga0070712_100021509 3300006175 Bacteria 4238
80 Ga0070712_100036506 3300006175 Bacteria 3345
81 Ga0070712_100062182 3300006175 Bacteria 2639
82 Ga0070712_100102560 3300006175 Bacteria 2119
83 Ga0075367_10002310 3300006178 Bacteria 8660
84 Ga0097621_100003819 3300006237 Bacteria 10439
85 Ga0097621_100005776 3300006237 Bacteria 8735
86 Ga0075370_10048282 3300006353 Bacteria 2411
87 Ga0068871_100041106 3300006358 Bacteria 3706
88 Ga0068871_100068873 3300006358 Bacteria 2905
89 Ga0075431_100011609 3300006847 Bacteria 8882
90 Ga0075434_100006006 3300006871 Bacteria 11111
91 Ga0068865_100008799 3300006881 Bacteria 6242
92 Ga0075436_100006168 3300006914 Bacteria 8227
93 Ga0075436_100044653 3300006914 Bacteria 3056
94 Ga0097620_100040310 3300006931 Bacteria 4687
95 Ga0099794_10003279 3300007265 Bacteria 6145
96 Ga0099794_10009858 3300007265 Bacteria 4037
97 Ga0099794_10010248 3300007265 Bacteria 3973
98 Ga0099794_10012946 3300007265 Bacteria 3618
99 Ga0099794_10027383 3300007265 Bacteria 2642
100 Ga0099794_10067132 3300007265 Bacteria 1751
101 Ga0105240_10000300 3300009093 Bacteria 96455
102 Ga0105240_10004749 3300009093 Bacteria 20519
103 Ga0105240_10005664 3300009093 Bacteria 18540
104 Ga0105240_10031190 3300009093 Bacteria 6916
105 Ga0105240_10055458 3300009093 Bacteria 4961
106 Ga0105240_10061880 3300009093 Bacteria 4662
107 Ga0105240_10064553 3300009093 Bacteria 4549
108 Ga0105240_10126743 3300009093 Unclassified 3067
109 Ga0111539_10001822 3300009094 Bacteria 28383
110 Ga0105245_10001710 3300009098 Bacteria 20004
111 Ga0105245_10007268 3300009098 Bacteria 9697
112 Ga0105245_10039011 3300009098 Bacteria 4227
113 Ga0105245_10058740 3300009098 Bacteria 3462
114 Ga0114129_10031013 3300009147 Bacteria 7561
115 Ga0105243_10015155 3300009148 Bacteria 5833
116 Ga0105243_10066581 3300009148 Bacteria 2898
117 Ga0105241_10001586 3300009174 Bacteria 17380
118 Ga0105241_10002333 3300009174 Bacteria 14257
119 Ga0105241_10011368 3300009174 Bacteria 6526
120 Ga0105241_10035572 3300009174 Bacteria 3746
121 Ga0105241_10048348 3300009174 Bacteria 3237
122 Ga0105241_10068245 3300009174 Bacteria 2754
123 Ga0105242_10015472 3300009176 Bacteria 5925
124 Ga0105242_10025284 3300009176 Bacteria 4698
125 Ga0105248_10016127 3300009177 Bacteria 8220
126 Ga0105248_10022628 3300009177 Bacteria 6974
127 Ga0105237_10019659 3300009545 Bacteria 6974
128 Ga0105237_10160684 3300009545 Bacteria 2245
129 Ga0105237_10194158 3300009545 Bacteria 2030
130 Ga0105238_10001515 3300009551 Bacteria 23266
131 Ga0105238_10021603 3300009551 Bacteria 6555
132 Ga0105238_10044071 3300009551 Bacteria 4513
133 Ga0105238_10055425 3300009551 Bacteria 3979
134 Ga0099796_10005383 3300010159 Bacteria 3191
135 Ga0099796_10052351 3300010159 Bacteria 1421
136 Ga0105239_10001364 3300010375 Bacteria 32808
137 Ga0105239_10277498 3300010375 Bacteria 1886
138 Ga0157370_10000105 3300013104 Bacteria 96436
139 Ga0157370_10084735 3300013104 Bacteria 2978
140 Ga0157369_10000155 3300013105 Bacteria 96658
141 Ga0157369_10002037 3300013105 Bacteria 24356
142 Ga0157369_10005647 3300013105 Bacteria 14535
143 Ga0157369_10010413 3300013105 Bacteria 10597
144 Ga0157374_10014956 3300013296 Bacteria 6800
145 Ga0157374_10022861 3300013296 Bacteria 5584
146 Ga0157374_10054472 3300013296 Bacteria 3731
147 Ga0157378_10000053 3300013297 Bacteria 99982
148 Ga0157378_10000203 3300013297 Bacteria 57992
149 Ga0157378_10001919 3300013297 Bacteria 18662
150 Ga0157378_10002000 3300013297 Bacteria 18229
151 Ga0163162_10059054 3300013306 Bacteria 3866
152 Ga0163162_10103916 3300013306 Bacteria 2935
153 Ga0163162_10263384 3300013306 Bacteria 1855
154 Ga0157372_10000803 3300013307 Bacteria 34107
155 Ga0157372_10011871 3300013307 Bacteria 9280
156 Ga0157372_10038296 3300013307 Bacteria 5291
157 Ga0157372_10055193 3300013307 Bacteria 4436
158 Ga0157380_10015364 3300014326 Bacteria 5627
159 Ga0157377_10119606 3300014745 Bacteria 1595
160 Ga0157379_10005527 3300014968 Bacteria 10860
161 Ga0157376_10000029 3300014969 Bacteria 201828
162 Ga0163161_10135455 3300017792 Bacteria 1862
163 Ga0213876_10011521 3300021384 Bacteria 4719
164 Ga0207653_10021279 3300025885 Bacteria 2057
165 Ga0207699_10077451 3300025906 Bacteria 2051
166 Ga0207643_10012039 3300025908 Bacteria 4672
167 Ga0207684_10024365 3300025910 Bacteria 5160
168 Ga0207654_10000025 3300025911 Bacteria 143807
169 Ga0207654_10000035 3300025911 Bacteria 112494
170 Ga0207654_10000958 3300025911 Bacteria 15857
171 Ga0207695_10000389 3300025913 Bacteria 99477
172 Ga0207695_10000782 3300025913 Bacteria 60213
173 Ga0207695_10002523 3300025913 Bacteria 26894
174 Ga0207695_10029810 3300025913 Bacteria 6019
175 Ga0207695_10070359 3300025913 Bacteria 3577
176 Ga0207695_10096252 3300025913 Bacteria 2962
177 Ga0207671_10000355 3300025914 Bacteria 65854
178 Ga0207693_10004521 3300025915 Bacteria 11760
179 Ga0207693_10106856 3300025915 Bacteria 2195
180 Ga0207663_10004900 3300025916 Bacteria 6700
181 Ga0207663_10032058 3300025916 Bacteria 3116
182 Ga0207649_10030484 3300025920 Bacteria 3195
183 Ga0207646_10000927 3300025922 Bacteria 37748
184 Ga0207646_10003326 3300025922 Bacteria 18279
185 Ga0207646_10080281 3300025922 Bacteria 2916
186 Ga0207694_10003212 3300025924 Bacteria 13034
187 Ga0207694_10015939 3300025924 Bacteria 5672
188 Ga0207659_10116564 3300025926 Bacteria 2039
189 Ga0207687_10012484 3300025927 Bacteria 5548
190 Ga0207687_10021493 3300025927 Bacteria 4288
191 Ga0207700_10029542 3300025928 Bacteria 3869
192 Ga0207700_10041210 3300025928 Bacteria 3377
193 Ga0207700_10065608 3300025928 Bacteria 2771
194 Ga0207664_10149976 3300025929 Bacteria 1980
195 Ga0207644_10014531 3300025931 Bacteria 5268
196 Ga0207706_10029002 3300025933 Bacteria 4941
197 Ga0207686_10033903 3300025934 Bacteria 3050
198 Ga0207686_10040329 3300025934 Bacteria 2838
199 Ga0207709_10060768 3300025935 Bacteria 2358
200 Ga0207709_10068629 3300025935 Bacteria 2241
201 Ga0207670_10016797 3300025936 Bacteria 4409
202 Ga0207704_10011845 3300025938 Bacteria 4310
203 Ga0207704_10146108 3300025938 Bacteria 1661
204 Ga0207665_10000089 3300025939 Bacteria 59318
205 Ga0207665_10001505 3300025939 Bacteria 15673
206 Ga0207665_10002682 3300025939 Bacteria 11942
207 Ga0207665_10028122 3300025939 Bacteria 3713
208 Ga0207665_10030933 3300025939 Bacteria 3540
209 Ga0207665_10047472 3300025939 Bacteria 2879
210 Ga0207665_10112640 3300025939 Bacteria 1913
211 Ga0207691_10013817 3300025940 Bacteria 7710
212 Ga0207711_10048159 3300025941 Bacteria 3647
213 Ga0207689_10004016 3300025942 Bacteria 13377
214 Ga0207661_10011013 3300025944 Bacteria 6536
215 Ga0207667_10006310 3300025949 Bacteria 14379
216 Ga0207667_10061012 3300025949 Bacteria 3946
217 Ga0207667_10171303 3300025949 Bacteria 2231
218 Ga0207658_10090744 3300025986 Bacteria 2369
219 Ga0207703_10066025 3300026035 Bacteria 2976
220 Ga0207678_10017244 3300026067 Bacteria 6340
221 Ga0207678_10031651 3300026067 Bacteria 4613
222 Ga0207708_10014711 3300026075 Bacteria 5856
223 Ga0207641_10002226 3300026088 Bacteria 18176
224 Ga0207641_10062024 3300026088 Bacteria 3189
225 Ga0207648_10007078 3300026089 Bacteria 11070
226 Ga0207674_10007191 3300026116 Bacteria 12995
227 Ga0207674_10064856 3300026116 Bacteria 3683
228 Ga0207675_100055632 3300026118 Bacteria 3692
229 Ga0207675_100280748 3300026118 Bacteria 1618
230 Ga0207683_10012512 3300026121 Bacteria 7239
231 Ga0207698_10000064 3300026142 Bacteria 72490
232 Ga0207698_10007382 3300026142 Bacteria 6888
233 Ga0209588_1005798 3300027671 Bacteria 3556
234 Ga0209588_1014677 3300027671 Bacteria 2401
235 Ga0209588_1020169 3300027671 Bacteria 2087
236 Ga0209588_1032538 3300027671 Bacteria 1671
237 Ga0209588_1038155 3300027671 Bacteria 1547
238 Ga0207428_10000041 3300027907 Bacteria 203097
239 Ga0265354_1000215 3300028016 Bacteria 10513
240 Ga0268266_10000249 3300028379 Bacteria 91239
241 Ga0268266_10025424 3300028379 Bacteria 5037
242 Ga0268264_10005590 3300028381 Bacteria 10650
243 Ga0265319_1000770 3300028563 Bacteria 20820
244 Ga0265319_1012123 3300028563 Bacteria 3496
245 Ga0265318_10000563 3300028577 Bacteria 26166
246 Ga0265338_10028706 3300028800 Bacteria 5541
247 Ga0265338_10049122 3300028800 Bacteria 3828
248 Ga0265338_10112620 3300028800 Bacteria 2187
249 Ga0265762_1004874 3300030760 Unclassified 2403
250 Ga0265770_1000885 3300030878 Bacteria 4152
251 Ga0265765_1000434 3300030879 Bacteria 3237
252 Ga0265760_10010495 3300031090 Bacteria 2644
253 Ga0265760_10010588 3300031090 Bacteria 2635
254 Ga0265320_10000328 3300031240 Bacteria 38910
255 Ga0265325_10002985 3300031241 Bacteria 11228
256 Ga0265325_10003280 3300031241 Bacteria 10638
257 Ga0265325_10045203 3300031241 Bacteria 2289
258 Ga0265329_10001095 3300031242 Bacteria 13310
259 Ga0265339_10002459 3300031249 Bacteria 13260
260 Ga0265331_10000021 3300031250 Bacteria 242632
261 Ga0265331_10021257 3300031250 Bacteria 3323
262 Ga0265316_10001865 3300031344 Bacteria 22179
263 Ga0265316_10004918 3300031344 Bacteria 13144
264 Ga0265316_10021584 3300031344 Bacteria 5449
265 Ga0265313_10000730 3300031595 Bacteria 33796
266 Ga0265313_10033213 3300031595 Bacteria 2626
267 Ga0265314_10025641 3300031711 Bacteria 4443
268 Ga0265342_10000032 3300031712 Bacteria 150633
269 Ga0307405_10002586 3300031731 Bacteria 8024
270 Ga0307407_10003717 3300031903 Bacteria 6330
271 Ga0307412_10069507 3300031911 Bacteria 2397
272 Ga0307409_100003588 3300031995 Bacteria 8477
273 Ga0307416_100034734 3300032002 Bacteria 3841
274 Ga0307414_10001893 3300032004 Bacteria 10816
275 Ga0307411_10168465 3300032005 Bacteria 1649
276 Ga0307415_100026277 3300032126 Bacteria 3669
277 Ga0373926_0005201 3300035083 Bacteria 4282
278 Ga0373934_0001476 3300035086 Bacteria 8620
279 Ga0373923_0013591 3300035111 Bacteria 3037
280 Ga0373953_0001062 3300035117 Bacteria 7781
281 Ga0373954_0000098 3300035118 Bacteria 29183
282 Ga0373956_0002903 3300035119 Bacteria 6932
283 Ga0373957_0001978 3300035120 Bacteria 5716
284 Ga0373955_0001344 3300035172 Bacteria 10438
285 Ga0373955_0082755 3300035172 Bacteria 1817
286 Ga0373931_0090576 3300035691 Bacteria 1703
287 Ga0373935_0008699 3300035692 Bacteria 6079
288 Ga0373927_0000199 3300035695 Bacteria 48441
289 Ga0373927_0020642 3300035695 Bacteria 4319
290 Ga0373933_0000349 3300035724 Bacteria 29471
291 Ga0373933_0000396 3300035724 Bacteria 27617
292 Ga0373933_0065878 3300035724 Bacteria 2194
293 Ga0373947_0009523 3300035725 Bacteria 5577
294 Ga0373947_0011600 3300035725 Bacteria 5056
295 Ga0373937_0000702 3300036401 Bacteria 29218
296 Ga0373937_0003293 3300036401 Bacteria 13555
297 Ga0373937_0024652 3300036401 Bacteria 5428
298 Ga0373937_0229421 3300036401 Bacteria 1748
299 Ga0373925_0000193 3300037068 Bacteria 66246
300 Ga0436365_1619374 3300039437 Bacteria 3193
301 Ga0436363_1717151 3300039450 Bacteria 3455
302 Ga0439433_0012323 3300041999 Bacteria 1874
303 Ga0439446_0005363 3300042156 Bacteria 3296
304 Ga0451577_0016798 3300042876 Bacteria 6768
305 Ga0451577_0078912 3300042876 Bacteria 2935
306 Ga0453683_0009033 3300044673 Bacteria 6657
307 Ga0453683_0010731 3300044673 Bacteria 6066
308 Ga0466963_0025257 3300044694 Bacteria 3787
309 Ga0466967_0037818 3300045976 Bacteria 4134
310 Ga0495592_0008485 3300046454 Bacteria 7710
311 Ga0495603_0006829 3300046455 Bacteria 6846
312 Ga0495629_0096489 3300046459 Bacteria 2062
313 Ga0495651_0000533 3300046462 Bacteria 29377
314 Ga0495651_0000692 3300046462 Bacteria 26245
315 Ga0495651_0002818 3300046462 Bacteria 13470
316 Ga0495651_0005417 3300046462 Bacteria 9735
317 Ga0495651_0014560 3300046462 Bacteria 6080
318 Ga0495653_0003742 3300046463 Bacteria 12300
319 Ga0495653_0038501 3300046463 Bacteria 3754
320 Ga0495653_0041810 3300046463 Bacteria 3575
321 Ga0495580_0001121 3300046472 Bacteria 23574
322 Ga0495580_0001761 3300046472 Bacteria 19013
323 Ga0495580_0006606 3300046472 Bacteria 9425
324 Ga0495580_0020185 3300046472 Bacteria 4937
325 Ga0495582_0006675 3300046473 Bacteria 6410
326 Ga0495662_0109470 3300046476 Bacteria 1353
327 Ga0495664_0008729 3300046477 Bacteria 5659
328 Ga0495594_0007176 3300046499 Bacteria 5731
329 Ga0495608_0026254 3300046511 Bacteria 3971
330 Ga0495618_0106633 3300046514 Bacteria 1794
331 Ga0495628_0010080 3300046516 Bacteria 8038
332 Ga0495628_0023174 3300046516 Bacteria 5098
333 Ga0495628_0023489 3300046516 Bacteria 5060
334 Ga0495628_0062364 3300046516 Unclassified 2922
335 Ga0495630_0045315 3300046517 Bacteria 3286
336 Ga0495630_0050306 3300046517 Bacteria 3119
337 Ga0495630_0073820 3300046517 Bacteria 2569
338 Ga0495666_0021021 3300046526 Bacteria 3232
339 Ga0495666_0038243 3300046526 Bacteria 2334
340 Ga0495666_0045314 3300046526 Bacteria 2122
341 Ga0495652_0010742 3300046529 Bacteria 8298
342 Ga0495652_0026389 3300046529 Bacteria 5133
343 Ga0495652_0052485 3300046529 Bacteria 3477
344 Ga0495652_0144334 3300046529 Bacteria 1868
345 Ga0495665_0009744 3300046531 Bacteria 5199
346 Ga0495640_0017368 3300046533 Bacteria 5365
347 Ga0495586_0036693 3300046535 Bacteria 2631
348 Ga0495587_0000322 3300046536 Bacteria 34081
349 Ga0495587_0002389 3300046536 Bacteria 12529
350 Ga0495587_0003834 3300046536 Bacteria 9975
351 Ga0495587_0004325 3300046536 Bacteria 9376
352 Ga0495587_0040148 3300046536 Bacteria 2798
353 Ga0495645_0008136 3300046543 Bacteria 7313
354 Ga0495667_0001553 3300046559 Bacteria 15237
355 Ga0495634_0024323 3300046642 Bacteria 4250
356 Ga0495634_0075292 3300046642 Bacteria 2217
357 Ga0495657_0002729 3300046675 Bacteria 14749
358 Ga0495657_0018900 3300046675 Bacteria 4980
359 Ga0495623_0026432 3300046679 Bacteria 3737
360 Ga0495646_0012964 3300046680 Bacteria 5300
361 Ga0495646_0030587 3300046680 Bacteria 3361
362 Ga0495647_0003075 3300046681 Bacteria 5329
363 Ga0495669_0053113 3300046684 Bacteria 1822
364 Ga0495613_0006496 3300046689 Bacteria 8736
365 Ga0495613_0018811 3300046689 Bacteria 5148
366 Ga0495613_0064990 3300046689 Bacteria 2667
367 Ga0495624_0019984 3300046690 Bacteria 4463
368 Ga0495600_0001868 3300046809 Bacteria 11819
369 Ga0495600_0013224 3300046809 Bacteria 5181
370 Ga0495604_0001058 3300047317 Bacteria 22815
371 Ga0495604_0003607 3300047317 Bacteria 12337
372 Ga0495604_0018348 3300047317 Bacteria 5603
373 Ga0495604_0033251 3300047317 Bacteria 4083
374 Ga0495674_0003602 3300047319 Bacteria 15066
375 Ga0495674_0015586 3300047319 Bacteria 7100
376 Ga0495674_0060187 3300047319 Bacteria 3314
377 Ga0495674_0110250 3300047319 Bacteria 2334
378 Ga0495676_0015762 3300047321 Bacteria 6718
379 Ga0495676_0119918 3300047321 Bacteria 1915
380 Ga0495680_0001171 3300047322 Bacteria 28858
381 Ga0495680_0019148 3300047322 Bacteria 5791
382 Ga0495680_0041533 3300047322 Bacteria 3657
383 Ga0495680_0045543 3300047322 Bacteria 3463
384 Ga0495675_0000013 3300047444 Bacteria 139190
385 Ga0495675_0002215 3300047444 Bacteria 11597
386 Ga0495675_0012138 3300047444 Bacteria 5420
387 Ga0495684_0000259 3300047471 Bacteria 41881
388 Ga0495684_0002933 3300047471 Bacteria 13438
389 Ga0495684_0009923 3300047471 Bacteria 7351
390 Ga0495684_0016132 3300047471 Bacteria 5751
391 Ga0495684_0078849 3300047471 Bacteria 2500
392 Ga0495593_0071892 3300047673 Bacteria 1796
393 Ga0495602_0006387 3300048088 Bacteria 12366
394 Ga0495614_0006478 3300048089 Bacteria 5253
395 Ga0496100_0067602 3300048903 Bacteria 2374
396 Ga0496101_0064218 3300048904 Bacteria 2674
397 Ga0496102_0002721 3300048905 Bacteria 15052
398 Ga0496102_0031113 3300048905 Bacteria 4784
399 Ga0496102_0229141 3300048905 Bacteria 1752
400 Ga0496104_0059530 3300048907 Bacteria 3616
401 Ga0496104_0063867 3300048907 Bacteria 3493
402 Ga0496105_0075864 3300048908 Bacteria 2776
403 Ga0496106_0019255 3300048909 Bacteria 5062
404 Ga0496106_0032521 3300048909 Bacteria 3889
405 nmdc:mga0k408_388_c2 3300050493 Bacteria 14713
406 nmdc:mga07m45_8854_c1 3300050496 Bacteria 5193
407 nmdc:mga05p37_21495_c1 3300050507 Bacteria 7815
408 nmdc:mga09592_184902_c1 3300050508 Bacteria 1803
409 nmdc:mga08y16_925_c1 3300050511 Bacteria 28503
410 nmdc:mga0n895_42885_c1 3300050512 Bacteria 4405
411 nmdc:mga0n895_51481_c1 3300050512 Bacteria 4040
412 nmdc:mga0n895_59907_c1 3300050512 Bacteria 3756
413 nmdc:mga0rr50_23356_c1 3300050513 Bacteria 4263
414 nmdc:mga0rr50_4825_c1 3300050513 Bacteria 7966
415 nmdc:mga0rr50_57390_c1 3300050513 Bacteria 2912
416 nmdc:mga08x19_11269_c1 3300050514 Bacteria 5382
417 nmdc:mga08x19_11809_c1 3300050514 Bacteria 5255
418 nmdc:mga08x19_2451_c1 3300050514 Bacteria 11278
419 nmdc:mga08x19_84965_c1 3300050514 Bacteria 2082
420 nmdc:mga0a205_337462_c1 3300050515 Bacteria 1376
421 Ga0495601_0035715 3300053077 Bacteria 3103
422 Ga0495619_0102796 3300053085 Bacteria 1946
423 Ga0500616_0001506 3300053153 Bacteria 21995
424 Ga0070683_100015197
425 rootH1_10299149
426 Ga0065707_10147442
427 Ga0070658_10173365
428 Ga0070683_100040158
429 Ga0070690_100023148
430 Ga0068869_100005534
431 Ga0070689_100038444
432 Ga0070661_100089450
433 Ga0070692_10082414
434 Ga0070668_100042940
435 Ga0070675_100044861
436 Ga0070671_100053593
437 Ga0070673_100099274
438 Ga0070688_100007957
439 Ga0070709_10014128
440 Ga0070709_10048932
441 Ga0070709_10110937
442 Ga0070713_100011478
443 Ga0070713_100028597
444 Ga0070713_100056102
445 Ga0070713_100152929
446 Ga0070701_10001278
447 Ga0070711_100001258
448 Ga0070711_100085982
449 Ga0070705_100006004
450 Ga0070700_100012078
451 Ga0070694_100168330
452 Ga0070708_100069836
453 Ga0070678_100011351
454 Ga0068867_100018651
455 Ga0070706_100050476
456 Ga0070707_100002393
457 Ga0070698_100004510
458 Ga0070698_100010239
459 Ga0070699_100045521
460 Ga0070699_100064773
461 Ga0070684_100051680
462 Ga0070684_100080876
463 Ga0070697_100007778
464 Ga0070697_100086567
465 Ga0068853_100000025
466 Ga0070672_100103390
467 Ga0070696_100000576
468 Ga0070696_100129117
469 Ga0070693_100000336
470 Ga0070665_100000666
471 Ga0070665_100036975
472 Ga0070704_100002079
473 Ga0068855_100006377
474 Ga0068855_100008541
475 Ga0068855_100097082
476 Ga0068857_100008401
477 Ga0068857_100119644
478 Ga0068857_100146156
479 Ga0068854_100035619
480 Ga0068856_100005089
481 Ga0068856_100021896
482 Ga0068856_100108778
483 Ga0068852_100000085
484 Ga0068852_100000098
485 Ga0068852_100065459
486 Ga0068859_100040309
487 Ga0068866_10020220
488 Ga0068851_10041304
489 Ga0068870_10016452
490 Ga0068863_100005665
491 Ga0068863_100020760
492 Ga0068858_100028483
493 Ga0068860_100002880
494 Ga0068860_100309203
495 Ga0070717_10001437
496 Ga0070717_10108725
497 Ga0070716_100000045
498 Ga0070716_100000212
499 Ga0070716_100005481
500 Ga0070716_100018198
501 Ga0070712_100012776
502 Ga0070712_100021509
503 Ga0070712_100036506
504 Ga0070712_100062182
505 Ga0070712_100102560
506 Ga0075367_10002310
507 Ga0097621_100003819
508 Ga0097621_100005776
509 Ga0075370_10048282
510 Ga0068871_100041106
511 Ga0068871_100068873
512 Ga0075431_100011609
513 Ga0075434_100006006
514 Ga0068865_100008799
515 Ga0075436_100006168
516 Ga0075436_100044653
517 Ga0097620_100040310
518 Ga0099794_10003279
519 Ga0099794_10009858
520 Ga0099794_10010248
521 Ga0099794_10012946
522 Ga0099794_10027383
523 Ga0099794_10067132
524 Ga0105240_10000300
525 Ga0105240_10004749
526 Ga0105240_10005664
527 Ga0105240_10031190
528 Ga0105240_10055458
529 Ga0105240_10061880
530 Ga0105240_10064553
531 Ga0105240_10126743
532 Ga0111539_10001822
533 Ga0105245_10001710
534 Ga0105245_10007268
535 Ga0105245_10039011
536 Ga0105245_10058740
537 Ga0114129_10031013
538 Ga0105243_10015155
539 Ga0105243_10066581
540 Ga0105241_10001586
541 Ga0105241_10002333
542 Ga0105241_10011368
543 Ga0105241_10035572
544 Ga0105241_10048348
545 Ga0105241_10068245
546 Ga0105242_10015472
547 Ga0105242_10025284
548 Ga0105248_10016127
549 Ga0105248_10022628
550 Ga0105237_10019659
551 Ga0105237_10160684
552 Ga0105237_10194158
553 Ga0105238_10001515
554 Ga0105238_10021603
555 Ga0105238_10044071
556 Ga0105238_10055425
557 Ga0099796_10005383
558 Ga0099796_10052351
559 Ga0105239_10001364
560 Ga0105239_10277498
561 Ga0157370_10000105
562 Ga0157370_10084735
563 Ga0157369_10000155
564 Ga0157369_10002037
565 Ga0157369_10005647
566 Ga0157369_10010413
567 Ga0157374_10014956
568 Ga0157374_10022861
569 Ga0157374_10054472
570 Ga0157378_10000053
571 Ga0157378_10000203
572 Ga0157378_10001919
573 Ga0157378_10002000
574 Ga0163162_10059054
575 Ga0163162_10103916
576 Ga0163162_10263384
577 Ga0157372_10000803
578 Ga0157372_10011871
579 Ga0157372_10038296
580 Ga0157372_10055193
581 Ga0157380_10015364
582 Ga0157377_10119606
583 Ga0157379_10005527
584 Ga0157376_10000029
585 Ga0163161_10135455
586 Ga0213876_10011521
587 Ga0207653_10021279
588 Ga0207699_10077451
589 Ga0207643_10012039
590 Ga0207684_10024365
591 Ga0207654_10000025
592 Ga0207654_10000035
593 Ga0207654_10000958
594 Ga0207695_10000389
595 Ga0207695_10000782
596 Ga0207695_10002523
597 Ga0207695_10029810
598 Ga0207695_10070359
599 Ga0207695_10096252
600 Ga0207671_10000355
601 Ga0207693_10004521
602 Ga0207693_10106856
603 Ga0207663_10004900
604 Ga0207663_10032058
605 Ga0207649_10030484
606 Ga0207646_10000927
607 Ga0207646_10003326
608 Ga0207646_10080281
609 Ga0207694_10003212
610 Ga0207694_10015939
611 Ga0207659_10116564
612 Ga0207687_10012484
613 Ga0207687_10021493
614 Ga0207700_10029542
615 Ga0207700_10041210
616 Ga0207700_10065608
617 Ga0207664_10149976
618 Ga0207644_10014531
619 Ga0207706_10029002
620 Ga0207686_10033903
621 Ga0207686_10040329
622 Ga0207709_10060768
623 Ga0207709_10068629
624 Ga0207670_10016797
625 Ga0207704_10011845
626 Ga0207704_10146108
627 Ga0207665_10000089
628 Ga0207665_10001505
629 Ga0207665_10002682
630 Ga0207665_10028122
631 Ga0207665_10030933
632 Ga0207665_10047472
633 Ga0207665_10112640
634 Ga0207691_10013817
635 Ga0207711_10048159
636 Ga0207689_10004016
637 Ga0207661_10011013
638 Ga0207667_10006310
639 Ga0207667_10061012
640 Ga0207667_10171303
641 Ga0207658_10090744
642 Ga0207703_10066025
643 Ga0207678_10017244
644 Ga0207678_10031651
645 Ga0207708_10014711
646 Ga0207641_10002226
647 Ga0207641_10062024
648 Ga0207648_10007078
649 Ga0207674_10007191
650 Ga0207674_10064856
651 Ga0207675_100055632
652 Ga0207675_100280748
653 Ga0207683_10012512
654 Ga0207698_10000064
655 Ga0207698_10007382
656 Ga0209588_1005798
657 Ga0209588_1014677
658 Ga0209588_1020169
659 Ga0209588_1032538
660 Ga0209588_1038155
661 Ga0207428_10000041
662 Ga0265354_1000215
663 Ga0268266_10000249
664 Ga0268266_10025424
665 Ga0268264_10005590
666 Ga0265319_1000770
667 Ga0265319_1012123
668 Ga0265318_10000563
669 Ga0265338_10028706
670 Ga0265338_10049122
671 Ga0265338_10112620
672 Ga0265762_1004874
673 Ga0265770_1000885
674 Ga0265765_1000434
675 Ga0265760_10010495
676 Ga0265760_10010588
677 Ga0265320_10000328
678 Ga0265325_10002985
679 Ga0265325_10003280
680 Ga0265325_10045203
681 Ga0265329_10001095
682 Ga0265339_10002459
683 Ga0265331_10000021
684 Ga0265331_10021257
685 Ga0265316_10001865
686 Ga0265316_10004918
687 Ga0265316_10021584
688 Ga0265313_10000730
689 Ga0265313_10033213
690 Ga0265314_10025641
691 Ga0265342_10000032
692 Ga0307405_10002586
693 Ga0307407_10003717
694 Ga0307412_10069507
695 Ga0307409_100003588
696 Ga0307416_100034734
697 Ga0307414_10001893
698 Ga0307411_10168465
699 Ga0307415_100026277
700 Ga0373926_0005201
701 Ga0373934_0001476
702 Ga0373923_0013591
703 Ga0373953_0001062
704 Ga0373954_0000098
705 Ga0373956_0002903
706 Ga0373957_0001978
707 Ga0373955_0001344
708 Ga0373955_0082755
709 Ga0373931_0090576
710 Ga0373935_0008699
711 Ga0373927_0000199
712 Ga0373927_0020642
713 Ga0373933_0000349
714 Ga0373933_0000396
715 Ga0373933_0065878
716 Ga0373947_0009523
717 Ga0373947_0011600
718 Ga0373937_0000702
719 Ga0373937_0003293
720 Ga0373937_0024652
721 Ga0373937_0229421
722 Ga0373925_0000193
723 Ga0436365_1619374
724 Ga0436363_1717151
725 Ga0439433_0012323
726 Ga0439446_0005363
727 Ga0451577_0016798
728 Ga0451577_0078912
729 Ga0453683_0009033
730 Ga0453683_0010731
731 Ga0466963_0025257
732 Ga0466967_0037818
733 Ga0495592_0008485
734 Ga0495603_0006829
735 Ga0495629_0096489
736 Ga0495651_0000533
737 Ga0495651_0000692
738 Ga0495651_0002818
739 Ga0495651_0005417
740 Ga0495651_0014560
741 Ga0495653_0003742
742 Ga0495653_0038501
743 Ga0495653_0041810
744 Ga0495580_0001121
745 Ga0495580_0001761
746 Ga0495580_0006606
747 Ga0495580_0020185
748 Ga0495582_0006675
749 Ga0495662_0109470
750 Ga0495664_0008729
751 Ga0495594_0007176
752 Ga0495608_0026254
753 Ga0495618_0106633
754 Ga0495628_0010080
755 Ga0495628_0023174
756 Ga0495628_0023489
757 Ga0495628_0062364
758 Ga0495630_0045315
759 Ga0495630_0050306
760 Ga0495630_0073820
761 Ga0495666_0021021
762 Ga0495666_0038243
763 Ga0495666_0045314
764 Ga0495652_0010742
765 Ga0495652_0026389
766 Ga0495652_0052485
767 Ga0495652_0144334
768 Ga0495665_0009744
769 Ga0495640_0017368
770 Ga0495586_0036693
771 Ga0495587_0000322
772 Ga0495587_0002389
773 Ga0495587_0003834
774 Ga0495587_0004325
775 Ga0495587_0040148
776 Ga0495645_0008136
777 Ga0495667_0001553
778 Ga0495634_0024323
779 Ga0495634_0075292
780 Ga0495657_0002729
781 Ga0495657_0018900
782 Ga0495623_0026432
783 Ga0495646_0012964
784 Ga0495646_0030587
785 Ga0495647_0003075
786 Ga0495669_0053113
787 Ga0495613_0006496
788 Ga0495613_0018811
789 Ga0495613_0064990
790 Ga0495624_0019984
791 Ga0495600_0001868
792 Ga0495600_0013224
793 Ga0495604_0001058
794 Ga0495604_0003607
795 Ga0495604_0018348
796 Ga0495604_0033251
797 Ga0495674_0003602
798 Ga0495674_0015586
799 Ga0495674_0060187
800 Ga0495674_0110250
801 Ga0495676_0015762
802 Ga0495676_0119918
803 Ga0495680_0001171
804 Ga0495680_0019148
805 Ga0495680_0041533
806 Ga0495680_0045543
807 Ga0495675_0000013
808 Ga0495675_0002215
809 Ga0495675_0012138
810 Ga0495684_0000259
811 Ga0495684_0002933
812 Ga0495684_0009923
813 Ga0495684_0016132
814 Ga0495684_0078849
815 Ga0495593_0071892
816 Ga0495602_0006387
817 Ga0495614_0006478
818 Ga0496100_0067602
819 Ga0496101_0064218
820 Ga0496102_0002721
821 Ga0496102_0031113
822 Ga0496102_0229141
823 Ga0496104_0059530
824 Ga0496104_0063867
825 Ga0496105_0075864
826 Ga0496106_0019255
827 Ga0496106_0032521
828 nmdc:mga0k408_388_c2
829 nmdc:mga07m45_8854_c1
830 nmdc:mga05p37_21495_c1
831 nmdc:mga09592_184902_c1
832 nmdc:mga08y16_925_c1
833 nmdc:mga0n895_42885_c1
834 nmdc:mga0n895_51481_c1
835 nmdc:mga0n895_59907_c1
836 nmdc:mga0rr50_23356_c1
837 nmdc:mga0rr50_4825_c1
838 nmdc:mga0rr50_57390_c1
839 nmdc:mga08x19_11269_c1
840 nmdc:mga08x19_11809_c1
841 nmdc:mga08x19_2451_c1
842 nmdc:mga08x19_84965_c1
843 nmdc:mga0a205_337462_c1
844 Ga0495601_0035715
845 Ga0495619_0102796
846 Ga0500616_0001506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

95

226

0.94

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

250

436

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nnz-assembly2.cif.gz_B subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9391 2 417
4nnz-assembly2.cif.gz_A subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9358 2 417
4nnz-assembly2.cif.gz_B subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9276 2 417
7v4y-assembly1.cif.gz_A ttha1264/ttha1265 complex 0.9246 2 416
4nnz-assembly2.cif.gz_A subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9245 2 417
ID Description Score Start End Superfamily
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9469 2 217 3.30.830.10
3amjC01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9424 2 216 3.30.830.10
af_P9WHT5_3_225_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.926 2 205 3.30.830.10
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9194 2 217 3.30.830.10
5eufA01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9128 2 217 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A2V8S850-F1-model_v4 Peptidase M16 0.9714 2 418 GO:0006508
GO:0008237
GO:0046872
AF-A0A0U2ZPN4-F1-model_v4 Peptidase M16 0.966 2 421 GO:0006508
GO:0008237
GO:0046872
AF-A0A316RMU3-F1-model_v4 Peptidase M16 0.9655 2 419 GO:0004222
GO:0006508
GO:0046872
AF-A0A1F9YK43-F1-model_v4 Peptidase M16 C-terminal domain-containing protein 0.9648 57 416 GO:0046872
AF-A0A1Q3WJQ7-F1-model_v4 Peptidase M16 0.9618 2 417 GO:0006508
GO:0008237
GO:0046872

Map