F440533

General Info

Members Datasets Scaffolds Average Seq Length
423 223 846 148

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10404596|Ga0207649_104045962
Length 176
Sequence MDCEYGAATRKSESGAAASLADAAAGKSSGRATMTTIELFTDGACSGNPGPGGWAAILRSGPHESELSGGEALTTNNRMEMTAVIEGLKALKKNSAVTIHTDSRYVMDGASKWIIGWKKKGWKTADKKPVKNEDLWRALDEEMARHQIRWIWVAGHSGHPENERADALARGAIPGP

Samples

Sample ID Description Type Environment
1 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0
Rhizoplane 0.95
Rhizosphere 87.47
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207649_10404596 3300025920 Bacteria 1022
2 JGI25156J39149_1000222 3300002705 Bacteria 39568
3 JGI25154J39366_1001936 3300002738 Bacteria 6173
4 JGI25157J39369_1000056 3300002741 Bacteria 107681
5 JGI25165J46597_1000036 3300003214 Bacteria 286380
6 JGI25153J46596_10000638 3300003215 Bacteria 21413
7 rootH1_10039875 3300003316 Bacteria 5671
8 rootH2_10006278 3300003320 Bacteria 3048
9 Ga0055539_1002458 3300003752 Bacteria 2823
10 Ga0055539_1015898 3300003752 Bacteria 914
11 Ga0070658_10002507 3300005327 Bacteria 15338
12 Ga0070658_10056877 3300005327 Bacteria 3180
13 Ga0070658_10062081 3300005327 Bacteria 3045
14 Ga0070658_10241567 3300005327 Bacteria 1531
15 Ga0070658_10635911 3300005327 Unclassified 926
16 Ga0070658_11362924 3300005327 Bacteria 616
17 Ga0070683_100095395 3300005329 Bacteria 2797
18 Ga0070690_100019828 3300005330 Bacteria 4090
19 Ga0070670_100803000 3300005331 Unclassified 850
20 Ga0068869_100572912 3300005334 Bacteria 951
21 Ga0068869_100653677 3300005334 Bacteria 893
22 Ga0070666_10042849 3300005335 Bacteria 3029
23 Ga0070666_10059192 3300005335 Bacteria 2591
24 Ga0070680_100026152 3300005336 Bacteria 4667
25 Ga0070680_100306648 3300005336 Bacteria 1346
26 Ga0070660_100006467 3300005339 Bacteria 8125
27 Ga0070660_100006576 3300005339 Bacteria 8062
28 Ga0070660_100252513 3300005339 Bacteria 1438
29 Ga0070660_101063153 3300005339 Bacteria 685
30 Ga0070691_10486915 3300005341 Bacteria 711
31 Ga0070661_100000741 3300005344 Bacteria 23706
32 Ga0070661_100094609 3300005344 Bacteria 2215
33 Ga0070661_101256190 3300005344 Bacteria 620
34 Ga0070668_100601234 3300005347 Bacteria 962
35 Ga0070674_100761641 3300005356 Bacteria 833
36 Ga0070673_100867418 3300005364 Bacteria 836
37 Ga0070688_100407162 3300005365 Bacteria 1008
38 Ga0070659_100040672 3300005366 Bacteria 3633
39 Ga0070667_100281714 3300005367 Bacteria 1493
40 Ga0070667_100868975 3300005367 Bacteria 839
41 Ga0070700_100053641 3300005441 Bacteria 2517
42 Ga0070663_100309921 3300005455 Bacteria 1266
43 Ga0070678_100036663 3300005456 Bacteria 3434
44 Ga0070678_100612760 3300005456 Bacteria 973
45 Ga0070662_100287911 3300005457 Bacteria 1331
46 Ga0070679_100113247 3300005530 Bacteria 2698
47 Ga0070679_100261451 3300005530 Bacteria 1686
48 Ga0070679_100285106 3300005530 Bacteria 1604
49 Ga0070684_100248742 3300005535 Bacteria 1625
50 Ga0068853_100229881 3300005539 Bacteria 1696
51 Ga0068853_100744156 3300005539 Bacteria 937
52 Ga0068853_101002742 3300005539 Bacteria 804
53 Ga0070686_100312451 3300005544 Bacteria 1169
54 Ga0070695_100006772 3300005545 Bacteria 6783
55 Ga0070665_100000381 3300005548 Bacteria 65638
56 Ga0070665_100073535 3300005548 Bacteria 3424
57 Ga0070665_100303207 3300005548 Bacteria 1600
58 Ga0068855_100004492 3300005563 Bacteria 17050
59 Ga0068855_100191358 3300005563 Bacteria 2307
60 Ga0068855_100219316 3300005563 Bacteria 2134
61 Ga0068855_101871116 3300005563 Bacteria 608
62 Ga0068857_100003268 3300005577 Bacteria 13471
63 Ga0068857_100072280 3300005577 Bacteria 3074
64 Ga0068857_100156844 3300005577 Bacteria 2064
65 Ga0068857_100223619 3300005577 Bacteria 1720
66 Ga0068857_100288593 3300005577 Bacteria 1510
67 Ga0068857_100870202 3300005577 Bacteria 863
68 Ga0068857_100988063 3300005577 Bacteria 810
69 Ga0068854_101522034 3300005578 Bacteria 608
70 Ga0068856_100007974 3300005614 Bacteria 10343
71 Ga0068856_100049908 3300005614 Bacteria 4124
72 Ga0068856_100063433 3300005614 Bacteria 3651
73 Ga0068852_100268488 3300005616 Bacteria 1641
74 Ga0068864_100086570 3300005618 Bacteria 2757
75 Ga0068866_10021161 3300005718 Bacteria 2992
76 Ga0068861_100014752 3300005719 Bacteria 5490
77 Ga0068861_100202819 3300005719 Bacteria 1666
78 Ga0068861_100377527 3300005719 Bacteria 1251
79 Ga0068863_100028623 3300005841 Bacteria 5319
80 Ga0068863_102046012 3300005841 Bacteria 583
81 Ga0068860_101069036 3300005843 Bacteria 826
82 Ga0068862_100338831 3300005844 Bacteria 1392
83 Ga0081455_10003020 3300005937 Bacteria 19620
84 Ga0081540_1023816 3300005983 Bacteria 3568
85 Ga0075365_10002139 3300006038 Bacteria 9479
86 Ga0070712_100492979 3300006175 Bacteria 1026
87 Ga0075367_10077405 3300006178 Bacteria 2008
88 Ga0075366_10017186 3300006195 Bacteria 4161
89 Ga0075366_10031057 3300006195 Bacteria 3143
90 Ga0097621_100530362 3300006237 Bacteria 1070
91 Ga0075370_10064287 3300006353 Bacteria 2092
92 Ga0075370_10166638 3300006353 Bacteria 1294
93 Ga0068871_100000805 3300006358 Bacteria 21096
94 Ga0068871_101046268 3300006358 Bacteria 762
95 Ga0075433_10466129 3300006852 Bacteria 1113
96 Ga0068865_100004736 3300006881 Bacteria 8219
97 Ga0075435_100970619 3300007076 Bacteria 742
98 Ga0105240_10067115 3300009093 Bacteria 4447
99 Ga0105240_10070676 3300009093 Bacteria 4318
100 Ga0105240_10159923 3300009093 Bacteria 2676
101 Ga0105240_10243264 3300009093 Bacteria 2085
102 Ga0105240_10252235 3300009093 Bacteria 2040
103 Ga0105240_10282982 3300009093 Bacteria 1904
104 Ga0105240_10308211 3300009093 Bacteria 1809
105 Ga0105240_11264050 3300009093 Bacteria 780
106 Ga0105245_10135024 3300009098 Bacteria 2318
107 Ga0105245_11089052 3300009098 Bacteria 845
108 Ga0105247_10111633 3300009101 Bacteria 1760
109 Ga0114129_11100253 3300009147 Bacteria 995
110 Ga0105243_10101455 3300009148 Bacteria 2389
111 Ga0105243_10491742 3300009148 Bacteria 1160
112 Ga0105243_10896473 3300009148 Bacteria 882
113 Ga0105243_11119026 3300009148 Bacteria 797
114 Ga0105243_11278906 3300009148 Bacteria 750
115 Ga0105241_10113267 3300009174 Bacteria 2174
116 Ga0105241_10121871 3300009174 Bacteria 2101
117 Ga0105241_11038433 3300009174 Bacteria 769
118 Ga0105242_10117082 3300009176 Bacteria 2281
119 Ga0105242_10309221 3300009176 Bacteria 1445
120 Ga0105242_10768492 3300009176 Bacteria 950
121 Ga0105242_11865550 3300009176 Bacteria 641
122 Ga0105237_10242234 3300009545 Bacteria 1805
123 Ga0105237_10267422 3300009545 Bacteria 1713
124 Ga0105237_10561217 3300009545 Bacteria 1148
125 Ga0105237_10658839 3300009545 Bacteria 1053
126 Ga0105237_10822789 3300009545 Bacteria 935
127 Ga0105238_10008779 3300009551 Bacteria 10111
128 Ga0105238_10037180 3300009551 Bacteria 4950
129 Ga0105238_10099495 3300009551 Bacteria 2891
130 Ga0105238_10103963 3300009551 Bacteria 2821
131 Ga0105238_10156483 3300009551 Bacteria 2254
132 Ga0105238_10187539 3300009551 Bacteria 2044
133 Ga0105238_10210886 3300009551 Bacteria 1918
134 Ga0105238_10333198 3300009551 Bacteria 1505
135 Ga0105249_10222999 3300009553 Bacteria 1856
136 Ga0105249_10294725 3300009553 Bacteria 1625
137 Ga0105249_11817670 3300009553 Bacteria 682
138 Ga0105239_10136123 3300010375 Bacteria 2735
139 Ga0105239_10649233 3300010375 Bacteria 1205
140 Ga0105239_10651718 3300010375 Bacteria 1203
141 Ga0105239_10922125 3300010375 Bacteria 1003
142 Ga0105239_11676199 3300010375 Bacteria 736
143 Ga0105239_12362899 3300010375 Bacteria 619
144 Ga0105246_10068275 3300011119 Bacteria 2493
145 Ga0105246_10356723 3300011119 Bacteria 1200
146 Ga0157373_10159021 3300013100 Bacteria 1589
147 Ga0157371_10042460 3300013102 Bacteria 3241
148 Ga0157370_10004733 3300013104 Bacteria 15514
149 Ga0157370_10132921 3300013104 Bacteria 2321
150 Ga0157370_10201526 3300013104 Bacteria 1846
151 Ga0157370_10344482 3300013104 Bacteria 1374
152 Ga0157374_10061712 3300013296 Bacteria 3512
153 Ga0157378_10013704 3300013297 Bacteria 7091
154 Ga0157378_10099867 3300013297 Bacteria 2648
155 Ga0163162_10237609 3300013306 Bacteria 1953
156 Ga0163162_11250242 3300013306 Bacteria 843
157 Ga0157372_10056784 3300013307 Bacteria 4374
158 Ga0157372_11286267 3300013307 Bacteria 844
159 Ga0157375_10082607 3300013308 Bacteria 3255
160 Ga0157375_12873676 3300013308 Bacteria 576
161 Ga0163163_10667503 3300014325 Bacteria 1103
162 Ga0163163_11127500 3300014325 Bacteria 847
163 Ga0157379_10718459 3300014968 Bacteria 939
164 Ga0157379_10926504 3300014968 Bacteria 828
165 Ga0157376_10092811 3300014969 Bacteria 2618
166 Ga0157376_11305000 3300014969 Bacteria 756
167 Ga0182007_10075812 3300015262 Bacteria 1102
168 Ga0207427_100499 3300025231 Bacteria 20877
169 Ga0207427_103565 3300025231 Bacteria 3176
170 Ga0209258_102942 3300025242 Bacteria 3980
171 Ga0209646_1000124 3300025246 Bacteria 138207
172 Ga0209026_1000085 3300025250 Bacteria 185778
173 Ga0209677_100203 3300025253 Bacteria 47561
174 Ga0209677_100768 3300025253 Bacteria 16243
175 Ga0209759_1000068 3300025256 Bacteria 183479
176 Ga0209759_1032990 3300025256 Bacteria 988
177 Ga0209233_1000015 3300025261 Bacteria 980563
178 Ga0209758_1000013 3300025297 Bacteria 873003
179 Ga0209758_1148443 3300025297 Bacteria 598
180 Ga0207692_10223859 3300025898 Bacteria 1116
181 Ga0207642_10188255 3300025899 Bacteria 1130
182 Ga0207642_10218807 3300025899 Bacteria 1063
183 Ga0207642_10746642 3300025899 Bacteria 619
184 Ga0207705_10000474 3300025909 Bacteria 34416
185 Ga0207705_10057540 3300025909 Bacteria 2804
186 Ga0207705_10118204 3300025909 Bacteria 1964
187 Ga0207705_10224936 3300025909 Bacteria 1426
188 Ga0207705_10270907 3300025909 Bacteria 1298
189 Ga0207654_10042972 3300025911 Bacteria 2560
190 Ga0207654_10290260 3300025911 Bacteria 1109
191 Ga0207707_10009023 3300025912 Bacteria 8665
192 Ga0207695_10010508 3300025913 Bacteria 11323
193 Ga0207695_10026992 3300025913 Bacteria 6397
194 Ga0207695_10049604 3300025913 Bacteria 4423
195 Ga0207695_10285461 3300025913 Bacteria 1544
196 Ga0207695_10367761 3300025913 Bacteria 1324
197 Ga0207671_10515715 3300025914 Bacteria 953
198 Ga0207693_10525529 3300025915 Bacteria 923
199 Ga0207663_10942978 3300025916 Bacteria 691
200 Ga0207660_10002089 3300025917 Bacteria 13240
201 Ga0207657_10000541 3300025919 Bacteria 40337
202 Ga0207657_10014611 3300025919 Bacteria 7651
203 Ga0207657_10037025 3300025919 Bacteria 4362
204 Ga0207657_11075647 3300025919 Bacteria 615
205 Ga0207649_10000080 3300025920 Bacteria 82307
206 Ga0207652_10000973 3300025921 Bacteria 26573
207 Ga0207652_10298442 3300025921 Bacteria 1454
208 Ga0207652_10331554 3300025921 Bacteria 1374
209 Ga0207652_10354937 3300025921 Bacteria 1323
210 Ga0207694_10011511 3300025924 Bacteria 6676
211 Ga0207694_10014844 3300025924 Bacteria 5874
212 Ga0207694_10099433 3300025924 Bacteria 2304
213 Ga0207687_10568409 3300025927 Bacteria 953
214 Ga0207700_10359987 3300025928 Bacteria 1268
215 Ga0207700_11043432 3300025928 Bacteria 731
216 Ga0207644_11402332 3300025931 Bacteria 587
217 Ga0207690_10039931 3300025932 Bacteria 3065
218 Ga0207690_10356117 3300025932 Bacteria 1158
219 Ga0207706_11621452 3300025933 Bacteria 523
220 Ga0207686_10015274 3300025934 Bacteria 4290
221 Ga0207686_10216221 3300025934 Bacteria 1381
222 Ga0207709_10991051 3300025935 Bacteria 686
223 Ga0207709_11632735 3300025935 Bacteria 535
224 Ga0207704_10129565 3300025938 Bacteria 1744
225 Ga0207691_10716514 3300025940 Bacteria 843
226 Ga0207711_10437659 3300025941 Bacteria 1217
227 Ga0207711_10600985 3300025941 Bacteria 1026
228 Ga0207689_10066707 3300025942 Bacteria 2958
229 Ga0207689_10648496 3300025942 Bacteria 889
230 Ga0207661_10058666 3300025944 Bacteria 3098
231 Ga0207661_10256214 3300025944 Bacteria 1557
232 Ga0207679_10401493 3300025945 Bacteria 1206
233 Ga0207667_10029897 3300025949 Bacteria 5902
234 Ga0207667_10049792 3300025949 Bacteria 4422
235 Ga0207667_10064776 3300025949 Bacteria 3814
236 Ga0207667_10310950 3300025949 Bacteria 1609
237 Ga0207667_10379836 3300025949 Bacteria 1440
238 Ga0207667_10426065 3300025949 Bacteria 1350
239 Ga0207667_10807736 3300025949 Bacteria 934
240 Ga0207668_10339246 3300025972 Bacteria 1253
241 Ga0207640_10015177 3300025981 Bacteria 4453
242 Ga0207640_10237386 3300025981 Bacteria 1406
243 Ga0207640_10450730 3300025981 Bacteria 1060
244 Ga0207703_10075896 3300026035 Bacteria 2787
245 Ga0207703_10652815 3300026035 Bacteria 998
246 Ga0207703_11032946 3300026035 Bacteria 789
247 Ga0207639_10548431 3300026041 Bacteria 1061
248 Ga0207639_10581200 3300026041 Bacteria 1031
249 Ga0207639_10668811 3300026041 Bacteria 962
250 Ga0207678_10179579 3300026067 Bacteria 1807
251 Ga0207708_10873360 3300026075 Bacteria 777
252 Ga0207702_10000235 3300026078 Bacteria 64091
253 Ga0207641_12226908 3300026088 Bacteria 548
254 Ga0207648_10456454 3300026089 Bacteria 1164
255 Ga0207648_10567743 3300026089 Bacteria 1043
256 Ga0207676_10317866 3300026095 Bacteria 1428
257 Ga0207674_10093073 3300026116 Bacteria 3003
258 Ga0207674_10104187 3300026116 Bacteria 2816
259 Ga0207674_10521469 3300026116 Bacteria 1148
260 Ga0207674_10961018 3300026116 Bacteria 823
261 Ga0207674_11256434 3300026116 Bacteria 710
262 Ga0207675_100064205 3300026118 Bacteria 3432
263 Ga0207683_10009569 3300026121 Bacteria 8263
264 Ga0207683_10998186 3300026121 Bacteria 777
265 Ga0207698_10943619 3300026142 Bacteria 871
266 Ga0268266_10033242 3300028379 Bacteria 4385
267 Ga0268266_10091907 3300028379 Bacteria 2662
268 Ga0268264_10423297 3300028381 Bacteria 1285
269 Ga0265336_10000813 3300028666 Bacteria 16445
270 Ga0307517_10148566 3300028786 Bacteria 1617
271 Ga0265338_10032597 3300028800 Bacteria 5075
272 Ga0265324_10001876 3300029957 Bacteria 11312
273 Ga0307511_10247951 3300030521 Bacteria 859
274 Ga0265320_10206925 3300031240 Bacteria 875
275 Ga0265329_10052504 3300031242 Bacteria 1297
276 Ga0265339_10088546 3300031249 Bacteria 1626
277 Ga0265339_10461551 3300031249 Bacteria 589
278 Ga0265331_10000003 3300031250 Bacteria 499358
279 Ga0265331_10001245 3300031250 Bacteria 19114
280 Ga0265331_10036411 3300031250 Bacteria 2416
281 Ga0265327_10000187 3300031251 Bacteria 131135
282 Ga0265316_10000393 3300031344 Bacteria 49924
283 Ga0265313_10120574 3300031595 Bacteria 1144
284 Ga0265314_10011954 3300031711 Bacteria 7120
285 Ga0265314_10021623 3300031711 Bacteria 4941
286 Ga0265314_10038218 3300031711 Bacteria 3470
287 Ga0265314_10074130 3300031711 Bacteria 2268
288 Ga0265314_10115590 3300031711 Bacteria 1697
289 Ga0265314_10529916 3300031711 Bacteria 616
290 Ga0307516_10014476 3300031730 Bacteria 8341
291 Ga0373937_0373018 3300036401 Bacteria 1353
292 Ga0395900_0036616 3300037418 Bacteria 5059
293 Ga0395900_0167482 3300037418 Bacteria 2239
294 Ga0395898_0453355 3300037466 Bacteria 1221
295 Ga0395901_0015920 3300038443 Bacteria 7661
296 Ga0395901_0031861 3300038443 Bacteria 5436
297 Ga0436361_0501198 3300039447 Bacteria 3476
298 Ga0436361_1052949 3300039447 Bacteria 1005
299 Ga0451789_0760355 3300041443 Bacteria 630
300 Ga0451791_0001192 3300041451 Bacteria 534
301 Ga0451800_0794675 3300041459 Bacteria 611
302 Ga0451837_0956472 3300041494 Bacteria 535
303 Ga0451841_1055949 3300041498 Bacteria 943
304 Ga0451577_0402650 3300042876 Bacteria 1242
305 Ga0466961_0583454 3300044693 Bacteria 673
306 Ga0453684_0001126 3300044712 Bacteria 83760
307 Ga0466971_0564299 3300044719 Unclassified 566
308 Ga0466957_0025721 3300044842 Bacteria 3490
309 Ga0466957_0059968 3300044842 Bacteria 2333
310 Ga0451576_0206894 3300045051 Bacteria 2049
311 Ga0451576_0279393 3300045051 Bacteria 1746
312 Ga0466958_0000187 3300045836 Bacteria 22479
313 Ga0495651_0364365 3300046462 Bacteria 952
314 Ga0495650_0163442 3300046471 Bacteria 792
315 Ga0495639_0089617 3300046475 Bacteria 1441
316 Ga0495583_0000224 3300046506 Bacteria 95810
317 Ga0495606_0004414 3300046507 Bacteria 14072
318 Ga0495606_0435066 3300046507 Bacteria 675
319 Ga0495654_0101419 3300046530 Bacteria 1325
320 Ga0495668_0012115 3300046616 Bacteria 5129
321 Ga0495625_0101484 3300046660 Bacteria 1976
322 Ga0495625_0671943 3300046660 Bacteria 615
323 Ga0495649_0045088 3300046694 Bacteria 2405
324 Ga0495649_0366900 3300046694 Bacteria 726
325 Ga0495676_0314678 3300047321 Bacteria 1053
326 Ga0495602_0275373 3300048088 Bacteria 1242
327 Ga0496115_0221317 3300048918 Bacteria 1562
328 Ga0496121_0010270 3300048924 Bacteria 10593
329 Ga0501032_0019432 3300049569 Bacteria 4753
330 Ga0501033_0006232 3300049570 Bacteria 9348
331 Ga0501033_0030506 3300049570 Bacteria 4051
332 Ga0501033_0038864 3300049570 Bacteria 3555
333 Ga0501033_0113198 3300049570 Bacteria 1973
334 Ga0501033_0346853 3300049570 Bacteria 1040
335 Ga0501033_0967030 3300049570 Bacteria 570
336 Ga0501034_0006522 3300049571 Bacteria 12545
337 Ga0501034_0067731 3300049571 Unclassified 3582
338 Ga0501034_0986260 3300049571 Bacteria 727
339 Ga0501036_0054596 3300049572 Bacteria 3384
340 Ga0501036_0098206 3300049572 Bacteria 2476
341 Ga0501036_0133486 3300049572 Bacteria 2095
342 Ga0501037_0049579 3300049573 Bacteria 3074
343 Ga0501037_0103343 3300049573 Bacteria 2055
344 Ga0501037_0192646 3300049573 Bacteria 1443
345 Ga0501037_0246172 3300049573 Bacteria 1252
346 Ga0501038_0019089 3300049574 Bacteria 6182
347 Ga0501038_0201601 3300049574 Bacteria 1597
348 Ga0501039_0004461 3300049575 Bacteria 10563
349 Ga0501041_0045511 3300049577 Bacteria 2668
350 Ga0501043_0013627 3300049579 Bacteria 6361
351 Ga0501043_0341286 3300049579 Bacteria 1139
352 Ga0501046_0003181 3300049580 Bacteria 15155
353 Ga0501046_0007420 3300049580 Bacteria 9638
354 Ga0501046_0096751 3300049580 Bacteria 2268
355 Ga0501046_0134062 3300049580 Bacteria 1877
356 Ga0501047_0002631 3300049581 Bacteria 17092
357 Ga0501047_0032993 3300049581 Bacteria 4999
358 Ga0501047_0035101 3300049581 Bacteria 4843
359 Ga0501047_0042416 3300049581 Bacteria 4397
360 Ga0501047_0729761 3300049581 Bacteria 807
361 Ga0501047_1058149 3300049581 Bacteria 625
362 Ga0501048_0002118 3300049582 Bacteria 15125
363 Ga0501048_0685099 3300049582 Bacteria 736
364 Ga0501067_0007327 3300049583 Bacteria 6128
365 Ga0501068_0965014 3300049584 Bacteria 562
366 Ga0501069_0003162 3300049585 Bacteria 8438
367 Ga0501070_0013137 3300049586 Bacteria 6979
368 Ga0501070_0068098 3300049586 Bacteria 2947
369 Ga0501070_0197838 3300049586 Bacteria 1651
370 Ga0501070_0248876 3300049586 Bacteria 1454
371 Ga0501072_0287865 3300049588 Bacteria 1306
372 Ga0501073_0086332 3300049589 Bacteria 2182
373 Ga0501073_0203917 3300049589 Bacteria 1367
374 Ga0501074_0004923 3300049590 Bacteria 9572
375 Ga0501075_0025590 3300049591 Bacteria 4336
376 Ga0501075_1253254 3300049591 Bacteria 562
377 Ga0501076_0077309 3300049592 Bacteria 2670
378 Ga0501077_0096245 3300049593 Bacteria 1876
379 Ga0501079_0005793 3300049741 Bacteria 9234
380 Ga0501079_0024811 3300049741 Bacteria 4600
381 Ga0501080_0016332 3300049742 Bacteria 6855
382 Ga0501080_0017035 3300049742 Bacteria 6710
383 Ga0501080_0074405 3300049742 Bacteria 3159
384 Ga0501080_0495103 3300049742 Bacteria 1093
385 Ga0501080_0897338 3300049742 Bacteria 773
386 Ga0501080_1573252 3300049742 Bacteria 557
387 Ga0501083_0000872 3300049744 Bacteria 19937
388 Ga0501083_0362729 3300049744 Bacteria 942
389 Ga0501035_0020162 3300049822 Bacteria 6123
390 Ga0501035_0629742 3300049822 Bacteria 871
391 Ga0501035_0692823 3300049822 Bacteria 822
392 Ga0501044_0007426 3300049823 Bacteria 12057
393 Ga0501044_0020413 3300049823 Bacteria 7074
394 Ga0501044_0061678 3300049823 Bacteria 3835
395 Ga0501044_0073349 3300049823 Bacteria 3479
396 Ga0501044_0120231 3300049823 Bacteria 2628
397 Ga0501044_0139154 3300049823 Bacteria 2416
398 Ga0501044_0228641 3300049823 Bacteria 1808
399 Ga0501044_1060160 3300049823 Bacteria 681
400 nmdc:mga0yw44_10616_c1 3300050492 Bacteria 4714
401 nmdc:mga0k408_63733_c1 3300050493 Bacteria 2144
402 nmdc:mga06z11_69404_c1 3300050494 Bacteria 1860
403 nmdc:mga07m45_3748_c1 3300050496 Bacteria 7355
404 nmdc:mga07m45_7440_c1 3300050496 Bacteria 5597
405 nmdc:mga07m45_809160_c1 3300050496 Bacteria 537
406 nmdc:mga08y16_84793_c1 3300050511 Bacteria 3302
407 nmdc:mga0a205_468898_c1 3300050515 Bacteria 1118
408 Ga0500635_0000057 3300053080 Bacteria 73077
409 Ga0500643_000003 3300053087 Bacteria 876659
410 Ga0500595_005398 3300053119 Bacteria 5586
411 Ga0500607_196748 3300053121 Bacteria 872
412 Ga0500652_158589 3300053131 Bacteria 936
413 Ga0500559_0090081 3300053136 Bacteria 1403
414 Ga0500568_0223079 3300053139 Bacteria 688
415 Ga0500577_0323122 3300053142 Bacteria 674
416 Ga0500637_0006041 3300053178 Bacteria 5924
417 Ga0501084_0024257 3300054114 Bacteria 5057
418 Ga0501084_0494997 3300054114 Bacteria 1033
419 Ga0500661_002750 3300055283 Bacteria 3320
420 Ga0501082_0004121 3300060353 Bacteria 12700
421 Ga0501082_0520923 3300060353 Bacteria 1039
422 Ga0501082_1225254 3300060353 Bacteria 656
423 Ga0466962_0027249 3300061719 Bacteria 2743
424 Ga0207649_10404596
425 JGI25156J39149_1000222
426 JGI25154J39366_1001936
427 JGI25157J39369_1000056
428 JGI25165J46597_1000036
429 JGI25153J46596_10000638
430 rootH1_10039875
431 rootH2_10006278
432 Ga0055539_1002458
433 Ga0055539_1015898
434 Ga0070658_10002507
435 Ga0070658_10056877
436 Ga0070658_10062081
437 Ga0070658_10241567
438 Ga0070658_10635911
439 Ga0070658_11362924
440 Ga0070683_100095395
441 Ga0070690_100019828
442 Ga0070670_100803000
443 Ga0068869_100572912
444 Ga0068869_100653677
445 Ga0070666_10042849
446 Ga0070666_10059192
447 Ga0070680_100026152
448 Ga0070680_100306648
449 Ga0070660_100006467
450 Ga0070660_100006576
451 Ga0070660_100252513
452 Ga0070660_101063153
453 Ga0070691_10486915
454 Ga0070661_100000741
455 Ga0070661_100094609
456 Ga0070661_101256190
457 Ga0070668_100601234
458 Ga0070674_100761641
459 Ga0070673_100867418
460 Ga0070688_100407162
461 Ga0070659_100040672
462 Ga0070667_100281714
463 Ga0070667_100868975
464 Ga0070700_100053641
465 Ga0070663_100309921
466 Ga0070678_100036663
467 Ga0070678_100612760
468 Ga0070662_100287911
469 Ga0070679_100113247
470 Ga0070679_100261451
471 Ga0070679_100285106
472 Ga0070684_100248742
473 Ga0068853_100229881
474 Ga0068853_100744156
475 Ga0068853_101002742
476 Ga0070686_100312451
477 Ga0070695_100006772
478 Ga0070665_100000381
479 Ga0070665_100073535
480 Ga0070665_100303207
481 Ga0068855_100004492
482 Ga0068855_100191358
483 Ga0068855_100219316
484 Ga0068855_101871116
485 Ga0068857_100003268
486 Ga0068857_100072280
487 Ga0068857_100156844
488 Ga0068857_100223619
489 Ga0068857_100288593
490 Ga0068857_100870202
491 Ga0068857_100988063
492 Ga0068854_101522034
493 Ga0068856_100007974
494 Ga0068856_100049908
495 Ga0068856_100063433
496 Ga0068852_100268488
497 Ga0068864_100086570
498 Ga0068866_10021161
499 Ga0068861_100014752
500 Ga0068861_100202819
501 Ga0068861_100377527
502 Ga0068863_100028623
503 Ga0068863_102046012
504 Ga0068860_101069036
505 Ga0068862_100338831
506 Ga0081455_10003020
507 Ga0081540_1023816
508 Ga0075365_10002139
509 Ga0070712_100492979
510 Ga0075367_10077405
511 Ga0075366_10017186
512 Ga0075366_10031057
513 Ga0097621_100530362
514 Ga0075370_10064287
515 Ga0075370_10166638
516 Ga0068871_100000805
517 Ga0068871_101046268
518 Ga0075433_10466129
519 Ga0068865_100004736
520 Ga0075435_100970619
521 Ga0105240_10067115
522 Ga0105240_10070676
523 Ga0105240_10159923
524 Ga0105240_10243264
525 Ga0105240_10252235
526 Ga0105240_10282982
527 Ga0105240_10308211
528 Ga0105240_11264050
529 Ga0105245_10135024
530 Ga0105245_11089052
531 Ga0105247_10111633
532 Ga0114129_11100253
533 Ga0105243_10101455
534 Ga0105243_10491742
535 Ga0105243_10896473
536 Ga0105243_11119026
537 Ga0105243_11278906
538 Ga0105241_10113267
539 Ga0105241_10121871
540 Ga0105241_11038433
541 Ga0105242_10117082
542 Ga0105242_10309221
543 Ga0105242_10768492
544 Ga0105242_11865550
545 Ga0105237_10242234
546 Ga0105237_10267422
547 Ga0105237_10561217
548 Ga0105237_10658839
549 Ga0105237_10822789
550 Ga0105238_10008779
551 Ga0105238_10037180
552 Ga0105238_10099495
553 Ga0105238_10103963
554 Ga0105238_10156483
555 Ga0105238_10187539
556 Ga0105238_10210886
557 Ga0105238_10333198
558 Ga0105249_10222999
559 Ga0105249_10294725
560 Ga0105249_11817670
561 Ga0105239_10136123
562 Ga0105239_10649233
563 Ga0105239_10651718
564 Ga0105239_10922125
565 Ga0105239_11676199
566 Ga0105239_12362899
567 Ga0105246_10068275
568 Ga0105246_10356723
569 Ga0157373_10159021
570 Ga0157371_10042460
571 Ga0157370_10004733
572 Ga0157370_10132921
573 Ga0157370_10201526
574 Ga0157370_10344482
575 Ga0157374_10061712
576 Ga0157378_10013704
577 Ga0157378_10099867
578 Ga0163162_10237609
579 Ga0163162_11250242
580 Ga0157372_10056784
581 Ga0157372_11286267
582 Ga0157375_10082607
583 Ga0157375_12873676
584 Ga0163163_10667503
585 Ga0163163_11127500
586 Ga0157379_10718459
587 Ga0157379_10926504
588 Ga0157376_10092811
589 Ga0157376_11305000
590 Ga0182007_10075812
591 Ga0207427_100499
592 Ga0207427_103565
593 Ga0209258_102942
594 Ga0209646_1000124
595 Ga0209026_1000085
596 Ga0209677_100203
597 Ga0209677_100768
598 Ga0209759_1000068
599 Ga0209759_1032990
600 Ga0209233_1000015
601 Ga0209758_1000013
602 Ga0209758_1148443
603 Ga0207692_10223859
604 Ga0207642_10188255
605 Ga0207642_10218807
606 Ga0207642_10746642
607 Ga0207705_10000474
608 Ga0207705_10057540
609 Ga0207705_10118204
610 Ga0207705_10224936
611 Ga0207705_10270907
612 Ga0207654_10042972
613 Ga0207654_10290260
614 Ga0207707_10009023
615 Ga0207695_10010508
616 Ga0207695_10026992
617 Ga0207695_10049604
618 Ga0207695_10285461
619 Ga0207695_10367761
620 Ga0207671_10515715
621 Ga0207693_10525529
622 Ga0207663_10942978
623 Ga0207660_10002089
624 Ga0207657_10000541
625 Ga0207657_10014611
626 Ga0207657_10037025
627 Ga0207657_11075647
628 Ga0207649_10000080
629 Ga0207652_10000973
630 Ga0207652_10298442
631 Ga0207652_10331554
632 Ga0207652_10354937
633 Ga0207694_10011511
634 Ga0207694_10014844
635 Ga0207694_10099433
636 Ga0207687_10568409
637 Ga0207700_10359987
638 Ga0207700_11043432
639 Ga0207644_11402332
640 Ga0207690_10039931
641 Ga0207690_10356117
642 Ga0207706_11621452
643 Ga0207686_10015274
644 Ga0207686_10216221
645 Ga0207709_10991051
646 Ga0207709_11632735
647 Ga0207704_10129565
648 Ga0207691_10716514
649 Ga0207711_10437659
650 Ga0207711_10600985
651 Ga0207689_10066707
652 Ga0207689_10648496
653 Ga0207661_10058666
654 Ga0207661_10256214
655 Ga0207679_10401493
656 Ga0207667_10029897
657 Ga0207667_10049792
658 Ga0207667_10064776
659 Ga0207667_10310950
660 Ga0207667_10379836
661 Ga0207667_10426065
662 Ga0207667_10807736
663 Ga0207668_10339246
664 Ga0207640_10015177
665 Ga0207640_10237386
666 Ga0207640_10450730
667 Ga0207703_10075896
668 Ga0207703_10652815
669 Ga0207703_11032946
670 Ga0207639_10548431
671 Ga0207639_10581200
672 Ga0207639_10668811
673 Ga0207678_10179579
674 Ga0207708_10873360
675 Ga0207702_10000235
676 Ga0207641_12226908
677 Ga0207648_10456454
678 Ga0207648_10567743
679 Ga0207676_10317866
680 Ga0207674_10093073
681 Ga0207674_10104187
682 Ga0207674_10521469
683 Ga0207674_10961018
684 Ga0207674_11256434
685 Ga0207675_100064205
686 Ga0207683_10009569
687 Ga0207683_10998186
688 Ga0207698_10943619
689 Ga0268266_10033242
690 Ga0268266_10091907
691 Ga0268264_10423297
692 Ga0265336_10000813
693 Ga0307517_10148566
694 Ga0265338_10032597
695 Ga0265324_10001876
696 Ga0307511_10247951
697 Ga0265320_10206925
698 Ga0265329_10052504
699 Ga0265339_10088546
700 Ga0265339_10461551
701 Ga0265331_10000003
702 Ga0265331_10001245
703 Ga0265331_10036411
704 Ga0265327_10000187
705 Ga0265316_10000393
706 Ga0265313_10120574
707 Ga0265314_10011954
708 Ga0265314_10021623
709 Ga0265314_10038218
710 Ga0265314_10074130
711 Ga0265314_10115590
712 Ga0265314_10529916
713 Ga0307516_10014476
714 Ga0373937_0373018
715 Ga0395900_0036616
716 Ga0395900_0167482
717 Ga0395898_0453355
718 Ga0395901_0015920
719 Ga0395901_0031861
720 Ga0436361_0501198
721 Ga0436361_1052949
722 Ga0451789_0760355
723 Ga0451791_0001192
724 Ga0451800_0794675
725 Ga0451837_0956472
726 Ga0451841_1055949
727 Ga0451577_0402650
728 Ga0466961_0583454
729 Ga0453684_0001126
730 Ga0466971_0564299
731 Ga0466957_0025721
732 Ga0466957_0059968
733 Ga0451576_0206894
734 Ga0451576_0279393
735 Ga0466958_0000187
736 Ga0495651_0364365
737 Ga0495650_0163442
738 Ga0495639_0089617
739 Ga0495583_0000224
740 Ga0495606_0004414
741 Ga0495606_0435066
742 Ga0495654_0101419
743 Ga0495668_0012115
744 Ga0495625_0101484
745 Ga0495625_0671943
746 Ga0495649_0045088
747 Ga0495649_0366900
748 Ga0495676_0314678
749 Ga0495602_0275373
750 Ga0496115_0221317
751 Ga0496121_0010270
752 Ga0501032_0019432
753 Ga0501033_0006232
754 Ga0501033_0030506
755 Ga0501033_0038864
756 Ga0501033_0113198
757 Ga0501033_0346853
758 Ga0501033_0967030
759 Ga0501034_0006522
760 Ga0501034_0067731
761 Ga0501034_0986260
762 Ga0501036_0054596
763 Ga0501036_0098206
764 Ga0501036_0133486
765 Ga0501037_0049579
766 Ga0501037_0103343
767 Ga0501037_0192646
768 Ga0501037_0246172
769 Ga0501038_0019089
770 Ga0501038_0201601
771 Ga0501039_0004461
772 Ga0501041_0045511
773 Ga0501043_0013627
774 Ga0501043_0341286
775 Ga0501046_0003181
776 Ga0501046_0007420
777 Ga0501046_0096751
778 Ga0501046_0134062
779 Ga0501047_0002631
780 Ga0501047_0032993
781 Ga0501047_0035101
782 Ga0501047_0042416
783 Ga0501047_0729761
784 Ga0501047_1058149
785 Ga0501048_0002118
786 Ga0501048_0685099
787 Ga0501067_0007327
788 Ga0501068_0965014
789 Ga0501069_0003162
790 Ga0501070_0013137
791 Ga0501070_0068098
792 Ga0501070_0197838
793 Ga0501070_0248876
794 Ga0501072_0287865
795 Ga0501073_0086332
796 Ga0501073_0203917
797 Ga0501074_0004923
798 Ga0501075_0025590
799 Ga0501075_1253254
800 Ga0501076_0077309
801 Ga0501077_0096245
802 Ga0501079_0005793
803 Ga0501079_0024811
804 Ga0501080_0016332
805 Ga0501080_0017035
806 Ga0501080_0074405
807 Ga0501080_0495103
808 Ga0501080_0897338
809 Ga0501080_1573252
810 Ga0501083_0000872
811 Ga0501083_0362729
812 Ga0501035_0020162
813 Ga0501035_0629742
814 Ga0501035_0692823
815 Ga0501044_0007426
816 Ga0501044_0020413
817 Ga0501044_0061678
818 Ga0501044_0073349
819 Ga0501044_0120231
820 Ga0501044_0139154
821 Ga0501044_0228641
822 Ga0501044_1060160
823 nmdc:mga0yw44_10616_c1
824 nmdc:mga0k408_63733_c1
825 nmdc:mga06z11_69404_c1
826 nmdc:mga07m45_3748_c1
827 nmdc:mga07m45_7440_c1
828 nmdc:mga07m45_809160_c1
829 nmdc:mga08y16_84793_c1
830 nmdc:mga0a205_468898_c1
831 Ga0500635_0000057
832 Ga0500643_000003
833 Ga0500595_005398
834 Ga0500607_196748
835 Ga0500652_158589
836 Ga0500559_0090081
837 Ga0500568_0223079
838 Ga0500577_0323122
839 Ga0500637_0006041
840 Ga0501084_0024257
841 Ga0501084_0494997
842 Ga0500661_002750
843 Ga0501082_0004121
844 Ga0501082_0520923
845 Ga0501082_1225254
846 Ga0466962_0027249

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

34

173

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsj-assembly7.cif.gz_G crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9833 6 146
2z1j-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) 0.9827 6 146
1wsj-assembly5.cif.gz_E crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9816 6 146
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9813 6 146
2z1h-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t92k/q105k/q113r/q115k/n143k/t145k) 0.9812 6 146
ID Description Score Start End Superfamily
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9734 8 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.964 7 148 3.30.420.10
af_Q86MG7_99_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9206 10 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9003 7 148 3.30.420.10
4ibnA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8943 2 148 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3C2BGT8-F1-model_v4 deleted 1.001 6 77
AF-A0A527HH28-F1-model_v4 deleted 0.9989 6 77
AF-A0A2N3AU90-F1-model_v4 Ribonuclease HI 0.9981 6 88 GO:0003676
GO:0004523
AF-B6Y9Z3-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9956 46 122 GO:0003676
GO:0004523
GO:0043137
AF-Q8XZ91-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9953 6 151 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137

Map