F440574

General Info

Members Datasets Scaffolds Average Seq Length
423 237 846 428

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1197910|Ga0451853_1197910_758_2218
Length 486
Sequence LIPVFVPAFAIFLSQKAFMYSDYEALFSFAVSRFTLPLDDSRTQRVKNSNLRTKFVSMTIEQLYEIYRQYPSVQTDTRKLKTGDIFFALKGPNFNGNQFAPAALAAGSAYAVVDEAPATPDSRIIVVEDVLTTLQQLAKYHRQQFTIPFIAITGSNGKTTTKELVYAVLSAGYKTYTTQGNLNNHIGIPLTILSVKPDAEMAVIEMGANHLREIASYCEYTLPTHGIITNCGKAHLEGFGSIEGVRKGKGELYDHLRAHDGTAFVMWDYDYLQTMSTGIPTVVKYGTTDAADIQGTVQQSEPFLTVAISKGAALPVIQTQLVGSYNLPNVLVAVTTGKFFKVPDEKIRSAIENYTPSNSRSQLIEKNGNKFILDAYNANPTSMKLAIENFAGIQASNKVLMLGGMAELGHESLQEHKAIIDLIKQHSWKAVVLVGGDFMKIDHPYIKMSNSTEAAQWFTDQSFNDTYFLIKGSRSMQMEKVIPPAP

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
196 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
197 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
198 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
199 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
200 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
201 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
202 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
203 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
204 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
205 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
226 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
227 2738541278 Niastella sp. CF465 Isolate Unclassified
228 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
229 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
230 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
231 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
232 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
233 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
234 2914759650 Rhizosphaericola mali Isolate Rhizosphere
235 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
236 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
237 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.93
Nodule 0
Rhizoplane 0.47
Rhizosphere 83.45
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_1197910 3300041512 Bacteria 2616
2 JGI24736J21556_1002098 3300001904 Bacteria 3539
3 JGI24740J21852_10002536 3300001979 Bacteria 8243
4 JGI24739J22299_10000257 3300001989 Bacteria 17846
5 JGI24751J29686_10001389 3300002459 Bacteria 5085
6 JGI25154J39366_1000002 3300002738 Bacteria 466942
7 JGI25153J46596_10000187 3300003215 Bacteria 60030
8 JGI25153J46596_10010451 3300003215 Bacteria 4195
9 rootH2_10001992 3300003320 Bacteria 27353
10 rootH2_10041059 3300003320 Bacteria 8625
11 rootH2_10120975 3300003320 Bacteria 4752
12 rootL2_10069792 3300003322 Bacteria 2570
13 rootL2_10074125 3300003322 Bacteria 3798
14 rootL2_10306438 3300003322 Bacteria 2088
15 rootH1_10014859 3300003323 Bacteria 7780
16 rootH1_10062620 3300003323 Bacteria 10973
17 rootH1_10092435 3300003323 Bacteria 2519
18 rootH1_10136000 3300003323 Bacteria 5487
19 JGI25160J50197_1000943 3300003354 Bacteria 15255
20 Ga0055535_1002788 3300003761 Bacteria 5577
21 Ga0055528_1000338 3300003790 Bacteria 39174
22 Ga0055530_10001956 3300003791 Bacteria 14038
23 Ga0055531_10000014 3300003794 Bacteria 184532
24 Ga0065165_1000100 3300005262 Bacteria 141963
25 Ga0065704_10075692 3300005289 Bacteria 5460
26 Ga0065712_10002957 3300005290 Bacteria 6775
27 Ga0065712_10081218 3300005290 Bacteria 3028
28 Ga0065712_10081948 3300005290 Bacteria 2961
29 Ga0070658_10004172 3300005327 Bacteria 11824
30 Ga0070658_10004224 3300005327 Bacteria 11752
31 Ga0070676_10026113 3300005328 Bacteria 3306
32 Ga0070683_100000106 3300005329 Bacteria 54661
33 Ga0070670_100004569 3300005331 Bacteria 11610
34 Ga0070670_100040978 3300005331 Bacteria 3980
35 Ga0068869_100014774 3300005334 Bacteria 5222
36 Ga0068869_100071809 3300005334 Bacteria 2564
37 Ga0070666_10000038 3300005335 Bacteria 115799
38 Ga0070666_10000431 3300005335 Bacteria 25787
39 Ga0070682_100000005 3300005337 Bacteria 386439
40 Ga0068868_100006700 3300005338 Bacteria 8173
41 Ga0068868_100008228 3300005338 Bacteria 7464
42 Ga0070660_100000295 3300005339 Bacteria 33225
43 Ga0070689_100012836 3300005340 Bacteria 6048
44 Ga0070689_100047840 3300005340 Bacteria 3298
45 Ga0070687_100015390 3300005343 Bacteria 3459
46 Ga0070668_100000016 3300005347 Bacteria 104092
47 Ga0070668_100018828 3300005347 Bacteria 5187
48 Ga0070668_100091284 3300005347 Bacteria 2401
49 Ga0070669_100018500 3300005353 Bacteria 4979
50 Ga0070669_100124748 3300005353 Unclassified 1969
51 Ga0070674_100012744 3300005356 Bacteria 5173
52 Ga0070673_100000074 3300005364 Bacteria 42660
53 Ga0070688_100053553 3300005365 Bacteria 2524
54 Ga0070688_100063609 3300005365 Bacteria 2339
55 Ga0070659_100005770 3300005366 Bacteria 8910
56 Ga0070667_100000031 3300005367 Bacteria 177447
57 Ga0070667_100009794 3300005367 Bacteria 7946
58 Ga0070667_100065714 3300005367 Bacteria 3080
59 Ga0070667_100106327 3300005367 Bacteria 2429
60 Ga0070678_100190170 3300005456 Unclassified 1687
61 Ga0070662_100010182 3300005457 Bacteria 6165
62 Ga0070662_100183811 3300005457 Bacteria 1649
63 Ga0068867_100002817 3300005459 Bacteria 12223
64 Ga0070685_10044211 3300005466 Bacteria 2549
65 Ga0070685_10066503 3300005466 Bacteria 2124
66 Ga0070698_100003140 3300005471 Bacteria 18206
67 Ga0070698_100003376 3300005471 Bacteria 17567
68 Ga0070698_100021248 3300005471 Bacteria 6800
69 Ga0070684_100000083 3300005535 Bacteria 61611
70 Ga0068853_100002162 3300005539 Bacteria 14638
71 Ga0070672_100000002 3300005543 Bacteria 159809
72 Ga0070665_100000002 3300005548 Bacteria 849037
73 Ga0070665_100000222 3300005548 Bacteria 94961
74 Ga0068855_100031650 3300005563 Bacteria 6317
75 Ga0068855_100052791 3300005563 Bacteria 4785
76 Ga0068857_100039098 3300005577 Bacteria 4201
77 Ga0068856_100022359 3300005614 Bacteria 6147
78 Ga0068856_100175743 3300005614 Bacteria 2153
79 Ga0068852_100022105 3300005616 Bacteria 5094
80 Ga0068852_100028536 3300005616 Bacteria 4570
81 Ga0068852_100034563 3300005616 Bacteria 4207
82 Ga0068852_100106141 3300005616 Bacteria 2546
83 Ga0068859_100000007 3300005617 Bacteria 390070
84 Ga0068859_100003007 3300005617 Bacteria 17097
85 Ga0068859_100010163 3300005617 Bacteria 9477
86 Ga0068859_100021113 3300005617 Bacteria 6534
87 Ga0068864_100002308 3300005618 Bacteria 15782
88 Ga0068864_100027310 3300005618 Bacteria 4819
89 Ga0068864_100036488 3300005618 Bacteria 4190
90 Ga0068864_100051620 3300005618 Bacteria 3543
91 Ga0068864_100089029 3300005618 Bacteria 2719
92 Ga0068861_100018084 3300005719 Bacteria 5013
93 Ga0068861_100023480 3300005719 Bacteria 4448
94 Ga0068861_100091719 3300005719 Bacteria 2399
95 Ga0068861_100164968 3300005719 Bacteria 1831
96 Ga0068851_10000266 3300005834 Bacteria 24602
97 Ga0068863_100006676 3300005841 Bacteria 11327
98 Ga0068863_100011953 3300005841 Bacteria 8389
99 Ga0068863_100162256 3300005841 Bacteria 2142
100 Ga0068858_100001512 3300005842 Bacteria 23886
101 Ga0068858_100002116 3300005842 Bacteria 20141
102 Ga0068860_100000153 3300005843 Bacteria 112147
103 Ga0068860_100005736 3300005843 Bacteria 12522
104 Ga0068860_100006636 3300005843 Bacteria 11621
105 Ga0068860_100087203 3300005843 Bacteria 2971
106 Ga0068862_100007671 3300005844 Bacteria 8930
107 Ga0068862_100239332 3300005844 Bacteria 1649
108 Ga0081540_1009809 3300005983 Bacteria 6552
109 Ga0075366_10008814 3300006195 Bacteria 5619
110 Ga0075366_10036514 3300006195 Bacteria 2898
111 Ga0097621_100020168 3300006237 Bacteria 5134
112 Ga0097621_100029195 3300006237 Bacteria 4354
113 Ga0097621_100038945 3300006237 Bacteria 3816
114 Ga0068871_100002241 3300006358 Bacteria 13141
115 Ga0068871_100002443 3300006358 Bacteria 12694
116 Ga0075431_100013446 3300006847 Bacteria 8267
117 Ga0075431_100081904 3300006847 Bacteria 3332
118 Ga0075429_100004456 3300006880 Bacteria 12047
119 Ga0075429_100061118 3300006880 Bacteria 3281
120 Ga0068865_100001410 3300006881 Bacteria 14005
121 Ga0097620_100000007 3300006931 Bacteria 390070
122 Ga0097620_100003007 3300006931 Bacteria 17097
123 Ga0097620_100010163 3300006931 Bacteria 9477
124 Ga0097620_100021113 3300006931 Bacteria 6534
125 Ga0105240_10000047 3300009093 Bacteria 239067
126 Ga0105240_10001289 3300009093 Bacteria 43373
127 Ga0105240_10001361 3300009093 Bacteria 41976
128 Ga0105240_10109990 3300009093 Bacteria 3336
129 Ga0111539_10071489 3300009094 Bacteria 4094
130 Ga0111539_10323993 3300009094 Unclassified 1793
131 Ga0111539_10379110 3300009094 Bacteria 1647
132 Ga0105245_10041764 3300009098 Bacteria 4089
133 Ga0105247_10000702 3300009101 Bacteria 26164
134 Ga0105247_10005964 3300009101 Bacteria 7592
135 Ga0105247_10009108 3300009101 Bacteria 6042
136 Ga0114129_10005818 3300009147 Bacteria 17462
137 Ga0105241_10003349 3300009174 Bacteria 11935
138 Ga0105241_10032013 3300009174 Bacteria 3938
139 Ga0105241_10181847 3300009174 Bacteria 1745
140 Ga0105242_10012958 3300009176 Bacteria 6429
141 Ga0105242_10026160 3300009176 Bacteria 4624
142 Ga0105242_10095452 3300009176 Bacteria 2510
143 Ga0105237_10002631 3300009545 Bacteria 22095
144 Ga0105237_10005717 3300009545 Bacteria 13978
145 Ga0105237_10006835 3300009545 Bacteria 12575
146 Ga0105237_10143404 3300009545 Bacteria 2383
147 Ga0105249_10000769 3300009553 Bacteria 28707
148 Ga0105249_10001060 3300009553 Bacteria 24381
149 Ga0105249_10001119 3300009553 Bacteria 23864
150 Ga0105249_10002666 3300009553 Bacteria 15430
151 Ga0105249_10002912 3300009553 Bacteria 14766
152 Ga0105249_10014757 3300009553 Bacteria 6905
153 Ga0105249_10029768 3300009553 Bacteria 4933
154 Ga0105239_10001102 3300010375 Bacteria 37330
155 Ga0105239_10003353 3300010375 Bacteria 19678
156 Ga0105239_10003716 3300010375 Bacteria 18578
157 Ga0105239_10029822 3300010375 Bacteria 5999
158 Ga0105239_10037394 3300010375 Bacteria 5322
159 Ga0105239_10059542 3300010375 Bacteria 4192
160 Ga0105239_10153836 3300010375 Bacteria 2568
161 Ga0105246_10009985 3300011119 Bacteria 5857
162 Ga0157370_10287844 3300013104 Bacteria 1518
163 Ga0157369_10040640 3300013105 Bacteria 5077
164 Ga0157374_10000013 3300013296 Bacteria 461240
165 Ga0157374_10000074 3300013296 Bacteria 99947
166 Ga0157374_10145853 3300013296 Bacteria 2299
167 Ga0157374_10273775 3300013296 Bacteria 1665
168 Ga0157378_10001264 3300013297 Bacteria 22767
169 Ga0157378_10211077 3300013297 Unclassified 1841
170 Ga0163162_10000029 3300013306 Bacteria 168510
171 Ga0163162_10000970 3300013306 Bacteria 26653
172 Ga0163162_10003598 3300013306 Bacteria 14838
173 Ga0163162_10011551 3300013306 Bacteria 8615
174 Ga0163162_10013425 3300013306 Bacteria 7997
175 Ga0163162_10050100 3300013306 Bacteria 4187
176 Ga0157372_10004138 3300013307 Bacteria 15533
177 Ga0157372_10033207 3300013307 Bacteria 5666
178 Ga0157372_10270412 3300013307 Bacteria 1975
179 Ga0157375_10000042 3300013308 Bacteria 160008
180 Ga0157375_10005779 3300013308 Bacteria 10762
181 Ga0157375_10474056 3300013308 Bacteria 1417
182 Ga0163163_10000076 3300014325 Bacteria 108784
183 Ga0163163_10108034 3300014325 Bacteria 2809
184 Ga0157380_10000796 3300014326 Bacteria 19825
185 Ga0157380_10000855 3300014326 Bacteria 19105
186 Ga0157380_10061627 3300014326 Bacteria 3002
187 Ga0157380_10184400 3300014326 Unclassified 1837
188 Ga0157377_10006062 3300014745 Bacteria 5736
189 Ga0157379_10000016 3300014968 Bacteria 103230
190 Ga0157376_10000067 3300014969 Bacteria 83894
191 Ga0157376_10055183 3300014969 Bacteria 3315
192 Ga0163161_10013566 3300017792 Bacteria 5673
193 Ga0163161_10067603 3300017792 Bacteria 2610
194 Ga0163161_10088981 3300017792 Bacteria 2283
195 Ga0209258_100029 3300025242 Bacteria 490648
196 Ga0209646_1000005 3300025246 Bacteria 717627
197 Ga0209646_1002193 3300025246 Bacteria 4509
198 Ga0209026_1000587 3300025250 Bacteria 23729
199 Ga0209148_1000089 3300025254 Bacteria 253548
200 Ga0209673_1000049 3300025273 Bacteria 286207
201 Ga0209564_1004571 3300025295 Bacteria 8382
202 Ga0209758_1000346 3300025297 Bacteria 84821
203 Ga0209758_1006396 3300025297 Bacteria 8483
204 Ga0209758_1047055 3300025297 Bacteria 1548
205 Ga0209050_1000272 3300025298 Bacteria 110636
206 Ga0207426_1000536 3300025302 Bacteria 54323
207 Ga0207426_1001075 3300025302 Bacteria 25593
208 Ga0209257_1000004 3300025304 Bacteria 1678347
209 Ga0209257_1005429 3300025304 Bacteria 8959
210 Ga0207656_10002125 3300025321 Bacteria 6622
211 Ga0207656_10027993 3300025321 Bacteria 2310
212 Ga0207710_10000975 3300025900 Bacteria 15053
213 Ga0207710_10018629 3300025900 Bacteria 2954
214 Ga0207680_10000015 3300025903 Bacteria 138253
215 Ga0207680_10004520 3300025903 Bacteria 6599
216 Ga0207647_10000088 3300025904 Bacteria 70267
217 Ga0207645_10003999 3300025907 Bacteria 10993
218 Ga0207645_10039520 3300025907 Bacteria 3023
219 Ga0207705_10003723 3300025909 Bacteria 11605
220 Ga0207705_10017370 3300025909 Bacteria 5153
221 Ga0207654_10008231 3300025911 Bacteria 5264
222 Ga0207654_10101932 3300025911 Bacteria 1770
223 Ga0207695_10000010 3300025913 Bacteria 981919
224 Ga0207695_10000361 3300025913 Bacteria 104230
225 Ga0207695_10000431 3300025913 Bacteria 91965
226 Ga0207695_10001348 3300025913 Bacteria 41610
227 Ga0207695_10060008 3300025913 Bacteria 3941
228 Ga0207671_10002899 3300025914 Bacteria 17715
229 Ga0207671_10005104 3300025914 Bacteria 12244
230 Ga0207671_10118627 3300025914 Bacteria 2021
231 Ga0207662_10034956 3300025918 Bacteria 2934
232 Ga0207657_10001629 3300025919 Bacteria 24192
233 Ga0207650_10028644 3300025925 Bacteria 3996
234 Ga0207650_10033332 3300025925 Bacteria 3730
235 Ga0207650_10149270 3300025925 Bacteria 1843
236 Ga0207659_10019943 3300025926 Bacteria 4423
237 Ga0207690_10053676 3300025932 Bacteria 2706
238 Ga0207706_10015868 3300025933 Bacteria 6809
239 Ga0207686_10002586 3300025934 Bacteria 9824
240 Ga0207670_10003567 3300025936 Bacteria 8263
241 Ga0207670_10009226 3300025936 Bacteria 5615
242 Ga0207669_10075141 3300025937 Bacteria 2140
243 Ga0207704_10001983 3300025938 Bacteria 9175
244 Ga0207691_10000004 3300025940 Bacteria 168729
245 Ga0207689_10006920 3300025942 Bacteria 9975
246 Ga0207689_10038591 3300025942 Bacteria 3955
247 Ga0207689_10054389 3300025942 Bacteria 3296
248 Ga0207661_10000054 3300025944 Bacteria 88056
249 Ga0207667_10004643 3300025949 Bacteria 16844
250 Ga0207667_10010495 3300025949 Bacteria 10826
251 Ga0207651_10000456 3300025960 Bacteria 17226
252 Ga0207651_10011503 3300025960 Bacteria 4958
253 Ga0207651_10024581 3300025960 Bacteria 3729
254 Ga0207712_10001318 3300025961 Bacteria 17023
255 Ga0207712_10002570 3300025961 Bacteria 11667
256 Ga0207712_10003008 3300025961 Bacteria 10775
257 Ga0207712_10006689 3300025961 Bacteria 7268
258 Ga0207668_10000112 3300025972 Bacteria 58202
259 Ga0207668_10072816 3300025972 Bacteria 2460
260 Ga0207658_10000059 3300025986 Bacteria 121530
261 Ga0207658_10081098 3300025986 Bacteria 2487
262 Ga0207677_10002071 3300026023 Bacteria 10560
263 Ga0207703_10007561 3300026035 Bacteria 8615
264 Ga0207703_10073819 3300026035 Bacteria 2822
265 Ga0207639_10026251 3300026041 Bacteria 4232
266 Ga0207639_10136020 3300026041 Bacteria 2041
267 Ga0207702_10045382 3300026078 Bacteria 3697
268 Ga0207641_10000056 3300026088 Bacteria 170719
269 Ga0207641_10008158 3300026088 Bacteria 8665
270 Ga0207641_10018253 3300026088 Bacteria 5750
271 Ga0207641_10046070 3300026088 Bacteria 3675
272 Ga0207648_10001923 3300026089 Bacteria 22701
273 Ga0207648_10032768 3300026089 Bacteria 4585
274 Ga0207648_10136896 3300026089 Bacteria 2157
275 Ga0207648_10190564 3300026089 Bacteria 1817
276 Ga0207676_10008702 3300026095 Bacteria 7218
277 Ga0207676_10025096 3300026095 Bacteria 4420
278 Ga0207676_10037274 3300026095 Bacteria 3704
279 Ga0207676_10107625 3300026095 Bacteria 2326
280 Ga0207676_10163867 3300026095 Unclassified 1929
281 Ga0207674_10001712 3300026116 Bacteria 28070
282 Ga0207674_10005126 3300026116 Bacteria 15635
283 Ga0207674_10033982 3300026116 Bacteria 5333
284 Ga0207674_10060097 3300026116 Bacteria 3844
285 Ga0207675_100001037 3300026118 Bacteria 27537
286 Ga0207675_100002556 3300026118 Bacteria 18017
287 Ga0207675_100020494 3300026118 Bacteria 6163
288 Ga0207675_100072489 3300026118 Bacteria 3221
289 Ga0207683_10025706 3300026121 Bacteria 5078
290 Ga0207683_10203935 3300026121 Unclassified 1798
291 Ga0207698_10004577 3300026142 Bacteria 8443
292 Ga0207698_10040345 3300026142 Bacteria 3468
293 Ga0207698_10050508 3300026142 Bacteria 3173
294 Ga0207428_10013837 3300027907 Bacteria 7029
295 Ga0268266_10000022 3300028379 Bacteria 508060
296 Ga0268266_10004701 3300028379 Bacteria 12995
297 Ga0268265_10101836 3300028380 Bacteria 2321
298 Ga0268264_10000159 3300028381 Bacteria 152716
299 Ga0268264_10003138 3300028381 Bacteria 14321
300 Ga0268264_10004218 3300028381 Bacteria 12266
301 Ga0268264_10005645 3300028381 Bacteria 10603
302 Ga0307515_10000684 3300028794 Bacteria 78055
303 Ga0265327_10000010 3300031251 Bacteria 566817
304 Ga0307509_10301826 3300031507 Bacteria 1349
305 Ga0307510_10015354 3300033180 Bacteria 9053
306 Ga0373935_0057447 3300035692 Bacteria 2482
307 Ga0439436_0003662 3300041404 Bacteria 4686
308 Ga0439431_0001162 3300041997 Bacteria 5747
309 Ga0439449_0011525 3300042007 Bacteria 3326
310 Ga0439449_0022650 3300042007 Bacteria 2352
311 Ga0439449_0071353 3300042007 Bacteria 1280
312 Ga0439457_002231 3300042014 Bacteria 5599
313 Ga0439457_004420 3300042014 Bacteria 3663
314 Ga0451577_0002869 3300042876 Bacteria 19808
315 Ga0466969_0000152 3300044656 Bacteria 37627
316 Ga0466969_0038014 3300044656 Bacteria 2425
317 Ga0466972_0000104 3300044658 Bacteria 73886
318 Ga0466972_0002005 3300044658 Bacteria 9972
319 Ga0466972_0011717 3300044658 Bacteria 4403
320 Ga0466965_0026621 3300044683 Bacteria 2804
321 Ga0466966_0000193 3300044684 Bacteria 40730
322 Ga0466961_0013482 3300044693 Bacteria 5235
323 Ga0453684_0005471 3300044712 Bacteria 25133
324 Ga0466968_0054168 3300044735 Bacteria 1719
325 Ga0466970_0097352 3300044765 Bacteria 1601
326 Ga0466957_0014002 3300044842 Bacteria 4664
327 Ga0466957_0052280 3300044842 Bacteria 2487
328 Ga0466959_0000016 3300045049 Bacteria 144600
329 Ga0466959_0011533 3300045049 Bacteria 6353
330 Ga0495638_0065845 3300046460 Bacteria 2229
331 Ga0495606_0032843 3300046507 Unclassified 3589
332 Ga0495648_0001257 3300046524 Bacteria 25300
333 Ga0495633_0000025 3300046558 Bacteria 218627
334 Ga0495668_0000108 3300046616 Bacteria 132593
335 Ga0495668_0006079 3300046616 Bacteria 7994
336 Ga0495611_0000101 3300046648 Bacteria 59066
337 Ga0495649_0015130 3300046694 Bacteria 4396
338 Ga0495672_0013065 3300047320 Bacteria 5747
339 Ga0495672_0045103 3300047320 Bacteria 2641
340 Ga0495687_008037 3300047443 Bacteria 6097
341 Ga0495686_0000010 3300047472 Bacteria 573229
342 Ga0495686_0000322 3300047472 Bacteria 79695
343 Ga0496108_0189620 3300048911 Bacteria 1782
344 Ga0496115_0186303 3300048918 Unclassified 1715
345 Ga0496121_0000008 3300048924 Bacteria 843593
346 Ga0501290_001609 3300049513 Bacteria 3043
347 Ga0501292_001849 3300049515 Bacteria 2653
348 Ga0501298_002833 3300049521 Bacteria 2658
349 Ga0501299_003377 3300049522 Unclassified 2308
350 Ga0501032_0009658 3300049569 Bacteria 6988
351 Ga0501033_0051494 3300049570 Bacteria 3052
352 Ga0501034_0029664 3300049571 Bacteria 5561
353 Ga0501034_0063339 3300049571 Bacteria 3711
354 Ga0501034_0142834 3300049571 Unclassified 2372
355 Ga0501036_0002554 3300049572 Bacteria 14316
356 Ga0501036_0202191 3300049572 Bacteria 1671
357 Ga0501038_0029241 3300049574 Bacteria 4886
358 Ga0501039_0060479 3300049575 Bacteria 2934
359 Ga0501043_0044168 3300049579 Unclassified 3503
360 Ga0501046_0012080 3300049580 Bacteria 7363
361 Ga0501047_0007092 3300049581 Bacteria 10523
362 Ga0501047_0023112 3300049581 Bacteria 5969
363 Ga0501047_0119477 3300049581 Bacteria 2518
364 Ga0501048_0004971 3300049582 Bacteria 10146
365 Ga0501067_0006644 3300049583 Bacteria 6417
366 Ga0501068_0059550 3300049584 Unclassified 2318
367 Ga0501073_0089224 3300049589 Unclassified 2143
368 Ga0501074_0014996 3300049590 Bacteria 5640
369 Ga0501201_000566 3300049651 Bacteria 3455
370 Ga0501207_001761 3300049654 Bacteria 2738
371 Ga0501217_000068 3300049661 Bacteria 12339
372 Ga0501223_000404 3300049663 Bacteria 10565
373 Ga0501240_000199 3300049673 Bacteria 4365
374 Ga0501243_000365 3300049675 Bacteria 5955
375 Ga0501251_003177 3300049681 Unclassified 1628
376 Ga0501257_025245 3300049686 Bacteria 1414
377 Ga0501259_001183 3300049688 Bacteria 4349
378 Ga0501261_001588 3300049690 Bacteria 2796
379 Ga0501219_000521 3300049703 Bacteria 5760
380 Ga0501221_001002 3300049704 Bacteria 4647
381 Ga0501241_004801 3300049758 Bacteria 2525
382 Ga0501035_0007292 3300049822 Bacteria 10347
383 Ga0501044_0012552 3300049823 Bacteria 9176
384 Ga0501044_0047789 3300049823 Bacteria 4425
385 Ga0501044_0060501 3300049823 Bacteria 3878
386 Ga0501284_00005 3300050005 Bacteria 164758
387 nmdc:mga0k408_88184_c1 3300050493 Bacteria 1822
388 nmdc:mga05p37_306281_c1 3300050507 Bacteria 1885
389 nmdc:mga05p37_3872_c1 3300050507 Bacteria 17505
390 nmdc:mga09592_109920_c1 3300050508 Bacteria 2365
391 nmdc:mga09592_167694_c1 3300050508 Bacteria 1898
392 nmdc:mga0qj67_5037_c1 3300050509 Bacteria 9603
393 nmdc:mga06r32_310042_c1 3300050510 Bacteria 1564
394 Ga0500578_0002185 3300053086 Bacteria 17132
395 Ga0500644_0000039 3300053088 Bacteria 78834
396 Ga0500646_0001356 3300053090 Bacteria 6502
397 Ga0500646_0008662 3300053090 Bacteria 2605
398 Ga0500646_0019636 3300053090 Bacteria 1789
399 Ga0500583_0000009 3300053092 Bacteria 160749
400 Ga0500583_0002527 3300053092 Bacteria 5521
401 Ga0500592_001769 3300053116 Bacteria 3497
402 Ga0500577_0000726 3300053142 Bacteria 8429
403 Ga0500589_040298 3300053147 Bacteria 2181
404 Ga0500616_0002253 3300053153 Bacteria 16431
405 Ga0500616_0004698 3300053153 Bacteria 9614
406 Ga0500622_0000151 3300053156 Bacteria 73392
407 Ga0500622_0001750 3300053156 Bacteria 16734
408 Ga0500622_0012266 3300053156 Bacteria 4646
409 Ga0500633_0000629 3300053160 Bacteria 5848
410 Ga0500636_0010079 3300053177 Bacteria 5505
411 Ga0500611_000004 3300053727 Bacteria 253326
412 Ga0500661_001081 3300055283 Bacteria 5134
413 2738726021 2738541278 Bacteria 9755573
414 2819576628 2818991442 Bacteria 8318214
415 2821143144 2821136567 Bacteria 8080116
416 2881956277 2881955468 Bacteria 3545609
417 2883070015 2883068021 Bacteria 6192739
418 2896114303 2896109856 Bacteria 7140722
419 2904470863 2904467357 Bacteria 8057758
420 2914760161 2914759650 Bacteria 4701441
421 2929239650 2929239360 Bacteria 7745570
422 2929921284 2929921140 Bacteria 8649150
423 8003157669 8003151029 Bacteria 8187759
424 Ga0451853_1197910
425 JGI24736J21556_1002098
426 JGI24740J21852_10002536
427 JGI24739J22299_10000257
428 JGI24751J29686_10001389
429 JGI25154J39366_1000002
430 JGI25153J46596_10000187
431 JGI25153J46596_10010451
432 rootH2_10001992
433 rootH2_10041059
434 rootH2_10120975
435 rootL2_10069792
436 rootL2_10074125
437 rootL2_10306438
438 rootH1_10014859
439 rootH1_10062620
440 rootH1_10092435
441 rootH1_10136000
442 JGI25160J50197_1000943
443 Ga0055535_1002788
444 Ga0055528_1000338
445 Ga0055530_10001956
446 Ga0055531_10000014
447 Ga0065165_1000100
448 Ga0065704_10075692
449 Ga0065712_10002957
450 Ga0065712_10081218
451 Ga0065712_10081948
452 Ga0070658_10004172
453 Ga0070658_10004224
454 Ga0070676_10026113
455 Ga0070683_100000106
456 Ga0070670_100004569
457 Ga0070670_100040978
458 Ga0068869_100014774
459 Ga0068869_100071809
460 Ga0070666_10000038
461 Ga0070666_10000431
462 Ga0070682_100000005
463 Ga0068868_100006700
464 Ga0068868_100008228
465 Ga0070660_100000295
466 Ga0070689_100012836
467 Ga0070689_100047840
468 Ga0070687_100015390
469 Ga0070668_100000016
470 Ga0070668_100018828
471 Ga0070668_100091284
472 Ga0070669_100018500
473 Ga0070669_100124748
474 Ga0070674_100012744
475 Ga0070673_100000074
476 Ga0070688_100053553
477 Ga0070688_100063609
478 Ga0070659_100005770
479 Ga0070667_100000031
480 Ga0070667_100009794
481 Ga0070667_100065714
482 Ga0070667_100106327
483 Ga0070678_100190170
484 Ga0070662_100010182
485 Ga0070662_100183811
486 Ga0068867_100002817
487 Ga0070685_10044211
488 Ga0070685_10066503
489 Ga0070698_100003140
490 Ga0070698_100003376
491 Ga0070698_100021248
492 Ga0070684_100000083
493 Ga0068853_100002162
494 Ga0070672_100000002
495 Ga0070665_100000002
496 Ga0070665_100000222
497 Ga0068855_100031650
498 Ga0068855_100052791
499 Ga0068857_100039098
500 Ga0068856_100022359
501 Ga0068856_100175743
502 Ga0068852_100022105
503 Ga0068852_100028536
504 Ga0068852_100034563
505 Ga0068852_100106141
506 Ga0068859_100000007
507 Ga0068859_100003007
508 Ga0068859_100010163
509 Ga0068859_100021113
510 Ga0068864_100002308
511 Ga0068864_100027310
512 Ga0068864_100036488
513 Ga0068864_100051620
514 Ga0068864_100089029
515 Ga0068861_100018084
516 Ga0068861_100023480
517 Ga0068861_100091719
518 Ga0068861_100164968
519 Ga0068851_10000266
520 Ga0068863_100006676
521 Ga0068863_100011953
522 Ga0068863_100162256
523 Ga0068858_100001512
524 Ga0068858_100002116
525 Ga0068860_100000153
526 Ga0068860_100005736
527 Ga0068860_100006636
528 Ga0068860_100087203
529 Ga0068862_100007671
530 Ga0068862_100239332
531 Ga0081540_1009809
532 Ga0075366_10008814
533 Ga0075366_10036514
534 Ga0097621_100020168
535 Ga0097621_100029195
536 Ga0097621_100038945
537 Ga0068871_100002241
538 Ga0068871_100002443
539 Ga0075431_100013446
540 Ga0075431_100081904
541 Ga0075429_100004456
542 Ga0075429_100061118
543 Ga0068865_100001410
544 Ga0097620_100000007
545 Ga0097620_100003007
546 Ga0097620_100010163
547 Ga0097620_100021113
548 Ga0105240_10000047
549 Ga0105240_10001289
550 Ga0105240_10001361
551 Ga0105240_10109990
552 Ga0111539_10071489
553 Ga0111539_10323993
554 Ga0111539_10379110
555 Ga0105245_10041764
556 Ga0105247_10000702
557 Ga0105247_10005964
558 Ga0105247_10009108
559 Ga0114129_10005818
560 Ga0105241_10003349
561 Ga0105241_10032013
562 Ga0105241_10181847
563 Ga0105242_10012958
564 Ga0105242_10026160
565 Ga0105242_10095452
566 Ga0105237_10002631
567 Ga0105237_10005717
568 Ga0105237_10006835
569 Ga0105237_10143404
570 Ga0105249_10000769
571 Ga0105249_10001060
572 Ga0105249_10001119
573 Ga0105249_10002666
574 Ga0105249_10002912
575 Ga0105249_10014757
576 Ga0105249_10029768
577 Ga0105239_10001102
578 Ga0105239_10003353
579 Ga0105239_10003716
580 Ga0105239_10029822
581 Ga0105239_10037394
582 Ga0105239_10059542
583 Ga0105239_10153836
584 Ga0105246_10009985
585 Ga0157370_10287844
586 Ga0157369_10040640
587 Ga0157374_10000013
588 Ga0157374_10000074
589 Ga0157374_10145853
590 Ga0157374_10273775
591 Ga0157378_10001264
592 Ga0157378_10211077
593 Ga0163162_10000029
594 Ga0163162_10000970
595 Ga0163162_10003598
596 Ga0163162_10011551
597 Ga0163162_10013425
598 Ga0163162_10050100
599 Ga0157372_10004138
600 Ga0157372_10033207
601 Ga0157372_10270412
602 Ga0157375_10000042
603 Ga0157375_10005779
604 Ga0157375_10474056
605 Ga0163163_10000076
606 Ga0163163_10108034
607 Ga0157380_10000796
608 Ga0157380_10000855
609 Ga0157380_10061627
610 Ga0157380_10184400
611 Ga0157377_10006062
612 Ga0157379_10000016
613 Ga0157376_10000067
614 Ga0157376_10055183
615 Ga0163161_10013566
616 Ga0163161_10067603
617 Ga0163161_10088981
618 Ga0209258_100029
619 Ga0209646_1000005
620 Ga0209646_1002193
621 Ga0209026_1000587
622 Ga0209148_1000089
623 Ga0209673_1000049
624 Ga0209564_1004571
625 Ga0209758_1000346
626 Ga0209758_1006396
627 Ga0209758_1047055
628 Ga0209050_1000272
629 Ga0207426_1000536
630 Ga0207426_1001075
631 Ga0209257_1000004
632 Ga0209257_1005429
633 Ga0207656_10002125
634 Ga0207656_10027993
635 Ga0207710_10000975
636 Ga0207710_10018629
637 Ga0207680_10000015
638 Ga0207680_10004520
639 Ga0207647_10000088
640 Ga0207645_10003999
641 Ga0207645_10039520
642 Ga0207705_10003723
643 Ga0207705_10017370
644 Ga0207654_10008231
645 Ga0207654_10101932
646 Ga0207695_10000010
647 Ga0207695_10000361
648 Ga0207695_10000431
649 Ga0207695_10001348
650 Ga0207695_10060008
651 Ga0207671_10002899
652 Ga0207671_10005104
653 Ga0207671_10118627
654 Ga0207662_10034956
655 Ga0207657_10001629
656 Ga0207650_10028644
657 Ga0207650_10033332
658 Ga0207650_10149270
659 Ga0207659_10019943
660 Ga0207690_10053676
661 Ga0207706_10015868
662 Ga0207686_10002586
663 Ga0207670_10003567
664 Ga0207670_10009226
665 Ga0207669_10075141
666 Ga0207704_10001983
667 Ga0207691_10000004
668 Ga0207689_10006920
669 Ga0207689_10038591
670 Ga0207689_10054389
671 Ga0207661_10000054
672 Ga0207667_10004643
673 Ga0207667_10010495
674 Ga0207651_10000456
675 Ga0207651_10011503
676 Ga0207651_10024581
677 Ga0207712_10001318
678 Ga0207712_10002570
679 Ga0207712_10003008
680 Ga0207712_10006689
681 Ga0207668_10000112
682 Ga0207668_10072816
683 Ga0207658_10000059
684 Ga0207658_10081098
685 Ga0207677_10002071
686 Ga0207703_10007561
687 Ga0207703_10073819
688 Ga0207639_10026251
689 Ga0207639_10136020
690 Ga0207702_10045382
691 Ga0207641_10000056
692 Ga0207641_10008158
693 Ga0207641_10018253
694 Ga0207641_10046070
695 Ga0207648_10001923
696 Ga0207648_10032768
697 Ga0207648_10136896
698 Ga0207648_10190564
699 Ga0207676_10008702
700 Ga0207676_10025096
701 Ga0207676_10037274
702 Ga0207676_10107625
703 Ga0207676_10163867
704 Ga0207674_10001712
705 Ga0207674_10005126
706 Ga0207674_10033982
707 Ga0207674_10060097
708 Ga0207675_100001037
709 Ga0207675_100002556
710 Ga0207675_100020494
711 Ga0207675_100072489
712 Ga0207683_10025706
713 Ga0207683_10203935
714 Ga0207698_10004577
715 Ga0207698_10040345
716 Ga0207698_10050508
717 Ga0207428_10013837
718 Ga0268266_10000022
719 Ga0268266_10004701
720 Ga0268265_10101836
721 Ga0268264_10000159
722 Ga0268264_10003138
723 Ga0268264_10004218
724 Ga0268264_10005645
725 Ga0307515_10000684
726 Ga0265327_10000010
727 Ga0307509_10301826
728 Ga0307510_10015354
729 Ga0373935_0057447
730 Ga0439436_0003662
731 Ga0439431_0001162
732 Ga0439449_0011525
733 Ga0439449_0022650
734 Ga0439449_0071353
735 Ga0439457_002231
736 Ga0439457_004420
737 Ga0451577_0002869
738 Ga0466969_0000152
739 Ga0466969_0038014
740 Ga0466972_0000104
741 Ga0466972_0002005
742 Ga0466972_0011717
743 Ga0466965_0026621
744 Ga0466966_0000193
745 Ga0466961_0013482
746 Ga0453684_0005471
747 Ga0466968_0054168
748 Ga0466970_0097352
749 Ga0466957_0014002
750 Ga0466957_0052280
751 Ga0466959_0000016
752 Ga0466959_0011533
753 Ga0495638_0065845
754 Ga0495606_0032843
755 Ga0495648_0001257
756 Ga0495633_0000025
757 Ga0495668_0000108
758 Ga0495668_0006079
759 Ga0495611_0000101
760 Ga0495649_0015130
761 Ga0495672_0013065
762 Ga0495672_0045103
763 Ga0495687_008037
764 Ga0495686_0000010
765 Ga0495686_0000322
766 Ga0496108_0189620
767 Ga0496115_0186303
768 Ga0496121_0000008
769 Ga0501290_001609
770 Ga0501292_001849
771 Ga0501298_002833
772 Ga0501299_003377
773 Ga0501032_0009658
774 Ga0501033_0051494
775 Ga0501034_0029664
776 Ga0501034_0063339
777 Ga0501034_0142834
778 Ga0501036_0002554
779 Ga0501036_0202191
780 Ga0501038_0029241
781 Ga0501039_0060479
782 Ga0501043_0044168
783 Ga0501046_0012080
784 Ga0501047_0007092
785 Ga0501047_0023112
786 Ga0501047_0119477
787 Ga0501048_0004971
788 Ga0501067_0006644
789 Ga0501068_0059550
790 Ga0501073_0089224
791 Ga0501074_0014996
792 Ga0501201_000566
793 Ga0501207_001761
794 Ga0501217_000068
795 Ga0501223_000404
796 Ga0501240_000199
797 Ga0501243_000365
798 Ga0501251_003177
799 Ga0501257_025245
800 Ga0501259_001183
801 Ga0501261_001588
802 Ga0501219_000521
803 Ga0501221_001002
804 Ga0501241_004801
805 Ga0501035_0007292
806 Ga0501044_0012552
807 Ga0501044_0047789
808 Ga0501044_0060501
809 Ga0501284_00005
810 nmdc:mga0k408_88184_c1
811 nmdc:mga05p37_306281_c1
812 nmdc:mga05p37_3872_c1
813 nmdc:mga09592_109920_c1
814 nmdc:mga09592_167694_c1
815 nmdc:mga0qj67_5037_c1
816 nmdc:mga06r32_310042_c1
817 Ga0500578_0002185
818 Ga0500644_0000039
819 Ga0500646_0001356
820 Ga0500646_0008662
821 Ga0500646_0019636
822 Ga0500583_0000009
823 Ga0500583_0002527
824 Ga0500592_001769
825 Ga0500577_0000726
826 Ga0500589_040298
827 Ga0500616_0002253
828 Ga0500616_0004698
829 Ga0500622_0000151
830 Ga0500622_0001750
831 Ga0500622_0012266
832 Ga0500633_0000629
833 Ga0500636_0010079
834 Ga0500611_000004
835 Ga0500661_001081
836 2738726021
837 2819576628
838 2821143144
839 2881956277
840 2883070015
841 2896114303
842 2904470863
843 2914760161
844 2929239650
845 2929921284
846 8003157669

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01225

Mur_ligase

Mur ligase family, catalytic domain

69

142

0.88

PF08245

Mur_ligase_M

Mur ligase middle domain

152

337

0.88

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

359

474

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qf5-assembly2.cif.gz_B crystal structure i of murf from acinetobacter baumannii 0.9054 15 424
8f5d-assembly1.cif.gz_A architecture of the mure-murf ligase bacterial cell wall biosynthesis complex 0.8963 6 297
3zl8-assembly1.cif.gz_A crystal structure of murf ligase from thermotoga maritima in complex with adp 0.8927 11 425
4qf5-assembly2.cif.gz_B crystal structure i of murf from acinetobacter baumannii 0.8711 15 424
3zl8-assembly1.cif.gz_A crystal structure of murf ligase from thermotoga maritima in complex with adp 0.869 11 425
ID Description Score Start End Superfamily
af_P9WJL1_108_337_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9265 73 293 3.40.1190.10
af_Q2FWH4_87_313_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.918 71 296 3.40.1190.10
af_Q2FWH4_87_313_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9104 71 296 3.40.1190.10
af_P9WJL1_108_337_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.888 73 293 3.40.1190.10
4ziyA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8857 72 296 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A059WT83-F1-model_v4 Mur ligase middle domain protein 0.9947 1 297 GO:0005524
GO:0009058
GO:0016881
AF-A0A258Y4V1-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9922 1 175 GO:0005524
GO:0009058
GO:0016881
AF-A0A059WT83-F1-model_v4 Mur ligase middle domain protein 0.9913 1 297 GO:0005524
GO:0009058
GO:0016881
AF-A0A258Y4V1-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9865 1 175 GO:0005524
GO:0009058
GO:0016881
AF-A0A3D4TF72-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9824 284 423 GO:0009058
GO:0016881

Map