F440587

General Info

Members Datasets Scaffolds Average Seq Length
423 213 423 263

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0044084|Ga0495580_0044084_396_1262
Length 288
Sequence MTAANSTQTRISRQFAALRESGELGIVAYITAGDPSLDATHKFVLALGEAGADVIELGIPFSDPLADGPTIQRASERALKAHTTLAQVIDLVREIRKSSEVPLVLFSYYNPVLQMGLEEFASAASAAGADGVLITDLTPEESDDYRQILAAHHLDTIFLGAPTSTDDRLAKIAAVSSGFLYLISRTGVTGAKDALPDDLPALLRRARKVTQLPLAVGFGISLPGHVSVLGGLADAAVVGSALVSEIEKATTASPTPSNIDTAAAALAIRIRSLKQAARHGLSRREVAP

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 1.65
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10157531 3300005289 Bacteria 1379
2 Ga0065715_10096479 3300005293 Bacteria 3871
3 Ga0065707_10002244 3300005295 Bacteria 5943
4 Ga0065707_10128740 3300005295 Bacteria 1960
5 Ga0070676_10122441 3300005328 Bacteria 1635
6 Ga0070683_100001440 3300005329 Bacteria 18271
7 Ga0070683_100003811 3300005329 Bacteria 12321
8 Ga0070683_100056199 3300005329 Bacteria 3654
9 Ga0070683_100344986 3300005329 Bacteria 1418
10 Ga0070670_100009850 3300005331 Bacteria 8161
11 Ga0070670_100017512 3300005331 Bacteria 6148
12 Ga0070670_100045471 3300005331 Bacteria 3775
13 Ga0070670_100059421 3300005331 Bacteria 3282
14 Ga0070677_10024493 3300005333 Bacteria 2245
15 Ga0070677_10097179 3300005333 Bacteria 1292
16 Ga0070677_10216857 3300005333 Bacteria 932
17 Ga0068869_100025795 3300005334 Bacteria 4085
18 Ga0068869_100343773 3300005334 Bacteria 1215
19 Ga0070680_100034987 3300005336 Bacteria 4053
20 Ga0070680_100271652 3300005336 Bacteria 1435
21 Ga0070660_100393248 3300005339 Bacteria 1145
22 Ga0070689_100135064 3300005340 Bacteria 1980
23 Ga0070689_100222334 3300005340 Bacteria 1549
24 Ga0070661_100359712 3300005344 Bacteria 1144
25 Ga0070692_10049189 3300005345 Bacteria 2186
26 Ga0070668_100161731 3300005347 Bacteria 1817
27 Ga0070669_100018893 3300005353 Bacteria 4926
28 Ga0070675_100021756 3300005354 Bacteria 5123
29 Ga0070675_100080067 3300005354 Bacteria 2722
30 Ga0070675_100117216 3300005354 Bacteria 2260
31 Ga0070675_100259318 3300005354 Bacteria 1523
32 Ga0070671_100001437 3300005355 Bacteria 17796
33 Ga0070671_100166187 3300005355 Bacteria 1866
34 Ga0070671_100292759 3300005355 Bacteria 1386
35 Ga0070674_100136452 3300005356 Bacteria 1835
36 Ga0070673_100003282 3300005364 Bacteria 10038
37 Ga0070673_100229543 3300005364 Bacteria 1610
38 Ga0070688_100126613 3300005365 Bacteria 1718
39 Ga0070688_100168252 3300005365 Bacteria 1510
40 Ga0070659_100094505 3300005366 Bacteria 2401
41 Ga0070659_100312582 3300005366 Bacteria 1312
42 Ga0070659_100410229 3300005366 Bacteria 1145
43 Ga0070667_100158847 3300005367 Bacteria 1990
44 Ga0070667_100673855 3300005367 Bacteria 956
45 Ga0070713_100143182 3300005436 Bacteria 2119
46 Ga0070701_10012223 3300005438 Bacteria 3864
47 Ga0070701_10131833 3300005438 Bacteria 1421
48 Ga0070705_100000088 3300005440 Bacteria 51329
49 Ga0070700_100165884 3300005441 Unclassified 1525
50 Ga0070694_100007040 3300005444 Bacteria 6842
51 Ga0070694_100066402 3300005444 Bacteria 2474
52 Ga0070694_100174739 3300005444 Bacteria 1584
53 Ga0070662_100299574 3300005457 Bacteria 1306
54 Ga0070681_10486988 3300005458 Bacteria 1146
55 Ga0068867_100001765 3300005459 Bacteria 15044
56 Ga0070685_10097506 3300005466 Bacteria 1790
57 Ga0070706_100521311 3300005467 Bacteria 1106
58 Ga0070707_100043347 3300005468 Bacteria 4307
59 Ga0070707_100149532 3300005468 Bacteria 2274
60 Ga0070698_100005658 3300005471 Bacteria 13683
61 Ga0070698_100066521 3300005471 Bacteria 3627
62 Ga0070698_100228730 3300005471 Bacteria 1793
63 Ga0070699_100030212 3300005518 Bacteria 4677
64 Ga0070699_100034488 3300005518 Bacteria 4374
65 Ga0070699_100070601 3300005518 Bacteria 3036
66 Ga0070699_100472905 3300005518 Bacteria 1137
67 Ga0070679_100007331 3300005530 Bacteria 10304
68 Ga0070684_100002824 3300005535 Bacteria 12893
69 Ga0070697_100022746 3300005536 Bacteria 4981
70 Ga0070697_100299714 3300005536 Bacteria 1382
71 Ga0070672_100035605 3300005543 Bacteria 3785
72 Ga0070672_100041049 3300005543 Bacteria 3554
73 Ga0070672_100052696 3300005543 Bacteria 3178
74 Ga0070672_100064210 3300005543 Bacteria 2900
75 Ga0070672_100123638 3300005543 Bacteria 2120
76 Ga0070686_100093064 3300005544 Bacteria 2020
77 Ga0070686_100144294 3300005544 Bacteria 1661
78 Ga0070686_100162065 3300005544 Bacteria 1576
79 Ga0070686_100330294 3300005544 Bacteria 1140
80 Ga0070695_100000021 3300005545 Bacteria 60669
81 Ga0070695_100302584 3300005545 Unclassified 1182
82 Ga0070695_100313115 3300005545 Bacteria 1164
83 Ga0070696_100000016 3300005546 Bacteria 76371
84 Ga0070704_100002034 3300005549 Bacteria 11210
85 Ga0070704_100130901 3300005549 Bacteria 1944
86 Ga0070704_100190961 3300005549 Bacteria 1646
87 Ga0070704_100363651 3300005549 Bacteria 1225
88 Ga0070664_100042927 3300005564 Bacteria 3815
89 Ga0070664_100044468 3300005564 Bacteria 3750
90 Ga0070664_100075998 3300005564 Bacteria 2885
91 Ga0070664_100213557 3300005564 Bacteria 1725
92 Ga0068857_100045406 3300005577 Bacteria 3898
93 Ga0070702_100140402 3300005615 Bacteria 1538
94 Ga0068852_100811647 3300005616 Bacteria 950
95 Ga0068859_100002429 3300005617 Bacteria 18976
96 Ga0068859_100038232 3300005617 Bacteria 4815
97 Ga0068859_100060094 3300005617 Bacteria 3830
98 Ga0068859_100148099 3300005617 Bacteria 2423
99 Ga0068864_100260641 3300005618 Bacteria 1612
100 Ga0068864_100575581 3300005618 Bacteria 1091
101 Ga0068870_10006003 3300005840 Bacteria 5335
102 Ga0068870_10215765 3300005840 Bacteria 1172
103 Ga0068863_100128791 3300005841 Bacteria 2416
104 Ga0068863_100235034 3300005841 Bacteria 1768
105 Ga0068863_100253547 3300005841 Bacteria 1700
106 Ga0068858_100233981 3300005842 Bacteria 1742
107 Ga0068862_100002348 3300005844 Bacteria 16851
108 Ga0068862_100460411 3300005844 Bacteria 1200
109 Ga0081539_10001461 3300005985 Bacteria 40211
110 Ga0081539_10080911 3300005985 Bacteria 1707
111 Ga0070717_10149771 3300006028 Bacteria 2018
112 Ga0070717_10206967 3300006028 Bacteria 1721
113 Ga0075365_10047859 3300006038 Bacteria 2812
114 Ga0075368_10014497 3300006042 Bacteria 2913
115 Ga0075364_10004718 3300006051 Bacteria 7867
116 Ga0075367_10014379 3300006178 Bacteria 4285
117 Ga0068871_100278621 3300006358 Bacteria 1462
118 Ga0075428_100000561 3300006844 Bacteria 38057
119 Ga0075428_100026543 3300006844 Bacteria 6411
120 Ga0075428_100158266 3300006844 Bacteria 2459
121 Ga0075430_100000634 3300006846 Bacteria 26757
122 Ga0075431_100004099 3300006847 Bacteria 14230
123 Ga0075431_100127128 3300006847 Bacteria 2630
124 Ga0075431_100181623 3300006847 Bacteria 2159
125 Ga0075433_10008517 3300006852 Bacteria 8179
126 Ga0075433_10062187 3300006852 Bacteria 3270
127 Ga0075433_10202980 3300006852 Bacteria 1762
128 Ga0075433_10206802 3300006852 Bacteria 1745
129 Ga0075434_100003140 3300006871 Bacteria 14727
130 Ga0075434_100011772 3300006871 Bacteria 8263
131 Ga0075434_100057280 3300006871 Bacteria 3873
132 Ga0075434_100178190 3300006871 Bacteria 2145
133 Ga0075434_100210838 3300006871 Bacteria 1963
134 Ga0075434_100543565 3300006871 Bacteria 1182
135 Ga0075434_100597920 3300006871 Bacteria 1122
136 Ga0075429_100002724 3300006880 Bacteria 14910
137 Ga0075429_100009669 3300006880 Bacteria 8361
138 Ga0075429_100043784 3300006880 Bacteria 3895
139 Ga0075429_100064214 3300006880 Bacteria 3198
140 Ga0075429_100269343 3300006880 Bacteria 1492
141 Ga0068865_100136961 3300006881 Bacteria 1841
142 Ga0068865_100320989 3300006881 Bacteria 1246
143 Ga0068865_100347292 3300006881 Bacteria 1201
144 Ga0075436_100099683 3300006914 Bacteria 2023
145 Ga0097620_100002429 3300006931 Bacteria 18976
146 Ga0097620_100038232 3300006931 Bacteria 4815
147 Ga0097620_100060094 3300006931 Bacteria 3830
148 Ga0097620_100148093 3300006931 Bacteria 2423
149 Ga0097620_100659746 3300006931 Bacteria 1138
150 Ga0075435_100003163 3300007076 Bacteria 11138
151 Ga0075435_100023885 3300007076 Bacteria 4736
152 Ga0075435_100043553 3300007076 Bacteria 3593
153 Ga0075435_100076291 3300007076 Bacteria 2746
154 Ga0075435_100295890 3300007076 Bacteria 1384
155 Ga0105240_10116562 3300009093 Bacteria 3222
156 Ga0111539_10001329 3300009094 Bacteria 32962
157 Ga0111539_10006200 3300009094 Bacteria 15430
158 Ga0111539_10015546 3300009094 Bacteria 9463
159 Ga0111539_10043989 3300009094 Bacteria 5352
160 Ga0111539_10046777 3300009094 Bacteria 5174
161 Ga0111539_10163270 3300009094 Bacteria 2605
162 Ga0111539_10397157 3300009094 Bacteria 1606
163 Ga0114129_10002708 3300009147 Bacteria 24682
164 Ga0114129_10003670 3300009147 Bacteria 21598
165 Ga0114129_10007770 3300009147 Bacteria 15258
166 Ga0114129_10020210 3300009147 Bacteria 9477
167 Ga0114129_10024134 3300009147 Bacteria 8617
168 Ga0114129_10105943 3300009147 Bacteria 3885
169 Ga0114129_10108231 3300009147 Bacteria 3838
170 Ga0114129_10233584 3300009147 Bacteria 2476
171 Ga0114129_10381749 3300009147 Bacteria 1861
172 Ga0114129_10404949 3300009147 Bacteria 1797
173 Ga0114129_10424187 3300009147 Bacteria 1749
174 Ga0105243_10373820 3300009148 Bacteria 1316
175 Ga0105242_10477957 3300009176 Bacteria 1180
176 Ga0105248_10201246 3300009177 Bacteria 2244
177 Ga0105238_10010341 3300009551 Bacteria 9362
178 Ga0105249_10016096 3300009553 Bacteria 6628
179 Ga0105249_10102742 3300009553 Bacteria 2691
180 Ga0157370_10268866 3300013104 Bacteria 1575
181 Ga0157374_10350571 3300013296 Bacteria 1467
182 Ga0157375_10087759 3300013308 Bacteria 3164
183 Ga0157375_10360649 3300013308 Bacteria 1619
184 Ga0163163_10023158 3300014325 Bacteria 5892
185 Ga0163163_10109307 3300014325 Bacteria 2792
186 Ga0163163_10673141 3300014325 Bacteria 1098
187 Ga0157380_10278397 3300014326 Bacteria 1529
188 Ga0157377_10497100 3300014745 Unclassified 851
189 Ga0157379_10112078 3300014968 Bacteria 2451
190 Ga0157376_10185330 3300014969 Bacteria 1905
191 Ga0206356_11687783 3300020070 Bacteria 1123
192 Ga0207682_10154082 3300025893 Bacteria 1038
193 Ga0207645_10127611 3300025907 Bacteria 1654
194 Ga0207643_10108497 3300025908 Bacteria 1633
195 Ga0207695_10168801 3300025913 Bacteria 2115
196 Ga0207695_10212773 3300025913 Bacteria 1843
197 Ga0207660_10096513 3300025917 Bacteria 2201
198 Ga0207662_10474438 3300025918 Bacteria 858
199 Ga0207657_10258345 3300025919 Bacteria 1387
200 Ga0207652_10109405 3300025921 Bacteria 2450
201 Ga0207652_10658139 3300025921 Bacteria 936
202 Ga0207646_10014862 3300025922 Bacteria 7374
203 Ga0207681_10096458 3300025923 Bacteria 2123
204 Ga0207694_10059123 3300025924 Bacteria 2982
205 Ga0207650_10002645 3300025925 Bacteria 12392
206 Ga0207650_10010728 3300025925 Bacteria 6290
207 Ga0207650_10044450 3300025925 Bacteria 3264
208 Ga0207650_10245016 3300025925 Bacteria 1449
209 Ga0207659_10018020 3300025926 Bacteria 4622
210 Ga0207659_10148037 3300025926 Bacteria 1830
211 Ga0207659_10233387 3300025926 Bacteria 1485
212 Ga0207659_10444224 3300025926 Bacteria 1091
213 Ga0207659_10473136 3300025926 Bacteria 1058
214 Ga0207687_10343930 3300025927 Bacteria 1213
215 Ga0207700_10088317 3300025928 Bacteria 2440
216 Ga0207644_10004753 3300025931 Bacteria 8831
217 Ga0207644_10033691 3300025931 Bacteria 3582
218 Ga0207644_10088884 3300025931 Bacteria 2299
219 Ga0207690_10296829 3300025932 Bacteria 1263
220 Ga0207706_10305143 3300025933 Bacteria 1386
221 Ga0207686_10130524 3300025934 Bacteria 1723
222 Ga0207670_10013368 3300025936 Bacteria 4837
223 Ga0207669_10102763 3300025937 Bacteria 1894
224 Ga0207691_10024353 3300025940 Bacteria 5693
225 Ga0207691_10182008 3300025940 Bacteria 1836
226 Ga0207691_10326236 3300025940 Bacteria 1316
227 Ga0207689_10119943 3300025942 Bacteria 2164
228 Ga0207689_10125203 3300025942 Bacteria 2114
229 Ga0207661_10007265 3300025944 Bacteria 7880
230 Ga0207661_10020983 3300025944 Bacteria 4892
231 Ga0207679_10036064 3300025945 Bacteria 3504
232 Ga0207679_10104766 3300025945 Bacteria 2220
233 Ga0207679_10255228 3300025945 Bacteria 1493
234 Ga0207679_10312513 3300025945 Bacteria 1358
235 Ga0207651_10003589 3300025960 Bacteria 7632
236 Ga0207651_10329487 3300025960 Bacteria 1279
237 Ga0207712_10145486 3300025961 Bacteria 1824
238 Ga0207668_10094761 3300025972 Bacteria 2202
239 Ga0207640_10345554 3300025981 Bacteria 1193
240 Ga0207677_10384903 3300026023 Bacteria 1185
241 Ga0207639_10667144 3300026041 Unclassified 963
242 Ga0207678_10171024 3300026067 Bacteria 1855
243 Ga0207678_10436873 3300026067 Bacteria 1136
244 Ga0207708_10052207 3300026075 Bacteria 3114
245 Ga0207708_10099221 3300026075 Bacteria 2252
246 Ga0207708_10342266 3300026075 Bacteria 1225
247 Ga0207702_10329175 3300026078 Bacteria 1457
248 Ga0207641_10080974 3300026088 Bacteria 2819
249 Ga0207641_10125990 3300026088 Bacteria 2293
250 Ga0207641_10230541 3300026088 Bacteria 1721
251 Ga0207648_10000338 3300026089 Bacteria 51422
252 Ga0207676_10044767 3300026095 Bacteria 3416
253 Ga0207676_10067251 3300026095 Bacteria 2862
254 Ga0207674_10010709 3300026116 Bacteria 10356
255 Ga0207674_10015388 3300026116 Bacteria 8404
256 Ga0207675_100252853 3300026118 Bacteria 1706
257 Ga0207683_10100077 3300026121 Bacteria 2588
258 Ga0207698_10693305 3300026142 Bacteria 1013
259 Ga0209813_10020875 3300027866 Bacteria 1837
260 Ga0209974_10030536 3300027876 Bacteria 1786
261 Ga0207428_10000438 3300027907 Bacteria 51028
262 Ga0207428_10001787 3300027907 Bacteria 22018
263 Ga0207428_10002109 3300027907 Bacteria 20038
264 Ga0207428_10106556 3300027907 Bacteria 2161
265 Ga0207428_10228177 3300027907 Bacteria 1394
266 Ga0265354_1000007 3300028016 Bacteria 30899
267 Ga0268266_10197992 3300028379 Bacteria 1837
268 Ga0268265_10002063 3300028380 Bacteria 15717
269 Ga0268264_10167110 3300028381 Bacteria 1987
270 Ga0265770_1000764 3300030878 Bacteria 4482
271 Ga0307408_100004358 3300031548 Bacteria 9615
272 Ga0307408_100010125 3300031548 Bacteria 6217
273 Ga0307408_100126982 3300031548 Bacteria 1984
274 Ga0307408_100192658 3300031548 Bacteria 1644
275 Ga0307405_10069025 3300031731 Bacteria 2264
276 Ga0307405_10176862 3300031731 Bacteria 1528
277 Ga0307413_10091647 3300031824 Bacteria 1981
278 Ga0307413_10172485 3300031824 Bacteria 1532
279 Ga0307413_10416979 3300031824 Bacteria 1056
280 Ga0307410_10004204 3300031852 Bacteria 7397
281 Ga0307410_10053453 3300031852 Bacteria 2733
282 Ga0307406_10006470 3300031901 Bacteria 6469
283 Ga0307406_10052543 3300031901 Bacteria 2592
284 Ga0307407_10030091 3300031903 Bacteria 2925
285 Ga0307412_10005263 3300031911 Bacteria 7259
286 Ga0307416_100018256 3300032002 Bacteria 4936
287 Ga0307416_100032265 3300032002 Bacteria 3954
288 Ga0307416_100186831 3300032002 Bacteria 1949
289 Ga0307416_100224153 3300032002 Bacteria 1806
290 Ga0307416_100386739 3300032002 Bacteria 1431
291 Ga0307416_100428706 3300032002 Bacteria 1369
292 Ga0307416_100626596 3300032002 Bacteria 1158
293 Ga0307414_10036056 3300032004 Bacteria 3298
294 Ga0307414_10310402 3300032004 Bacteria 1338
295 Ga0307411_10003183 3300032005 Bacteria 7549
296 Ga0307411_10065184 3300032005 Bacteria 2442
297 Ga0307411_10223860 3300032005 Bacteria 1461
298 Ga0307415_100002939 3300032126 Bacteria 8552
299 Ga0316212_1008094 3300033547 Bacteria 1514
300 Ga0373943_0055395 3300035170 Bacteria 1964
301 Ga0373943_0171593 3300035170 Bacteria 1187
302 Ga0373931_0287579 3300035691 Bacteria 1011
303 Ga0373937_0021998 3300036401 Bacteria 5726
304 Ga0373937_0043760 3300036401 Bacteria 4089
305 Ga0373937_0141805 3300036401 Bacteria 2249
306 Ga0373925_0002903 3300037068 Bacteria 13525
307 Ga0373925_0081834 3300037068 Bacteria 2456
308 Ga0439431_0020029 3300041997 Bacteria 1595
309 Ga0439433_0007263 3300041999 Bacteria 2393
310 Ga0439450_000446 3300042008 Bacteria 5361
311 Ga0439446_0012167 3300042156 Bacteria 2347
312 Ga0439446_0056244 3300042156 Bacteria 1182
313 Ga0439435_0008408 3300042436 Bacteria 2391
314 Ga0439435_0033075 3300042436 Bacteria 1414
315 Ga0439464_0013618 3300042439 Bacteria 2180
316 Ga0439464_0018038 3300042439 Bacteria 1919
317 Ga0439440_0022697 3300042993 Bacteria 1424
318 Ga0451576_0127252 3300045051 Bacteria 2654
319 Ga0451576_0269752 3300045051 Bacteria 1779
320 Ga0495580_0044084 3300046472 Bacteria 3174
321 Ga0495580_0312673 3300046472 Bacteria 1068
322 Ga0495594_0022890 3300046499 Bacteria 3345
323 Ga0495663_0012544 3300046525 Bacteria 2361
324 Ga0495642_0021194 3300046528 Bacteria 2555
325 Ga0495642_0089416 3300046528 Bacteria 1303
326 Ga0495665_0223206 3300046531 Unclassified 974
327 Ga0495621_0016609 3300046539 Bacteria 2365
328 Ga0495633_0155812 3300046558 Bacteria 1054
329 Ga0495656_0036623 3300046615 Bacteria 2022
330 Ga0495659_0016703 3300046664 Bacteria 2424
331 Ga0495659_0037049 3300046664 Bacteria 1726
332 Ga0495588_0003893 3300046674 Bacteria 6543
333 Ga0495669_0027674 3300046684 Bacteria 2481
334 Ga0495669_0194128 3300046684 Bacteria 969
335 Ga0495670_0027423 3300046691 Bacteria 2822
336 Ga0495674_0035771 3300047319 Bacteria 4477
337 Ga0496100_0115907 3300048903 Bacteria 1869
338 Ga0496108_0512005 3300048911 Bacteria 1048
339 Ga0496109_0106367 3300048912 Bacteria 2606
340 Ga0496109_0239702 3300048912 Bacteria 1707
341 Ga0496109_0316836 3300048912 Bacteria 1472
342 Ga0496112_0349821 3300048915 Bacteria 1420
343 Ga0496113_0094350 3300048916 Bacteria 2312
344 Ga0501292_005929 3300049515 Bacteria 1721
345 Ga0501033_0477090 3300049570 Bacteria 864
346 Ga0501034_0048126 3300049571 Bacteria 4303
347 Ga0501039_0076400 3300049575 Bacteria 2604
348 Ga0501042_0125894 3300049578 Bacteria 1845
349 Ga0501047_0041880 3300049581 Bacteria 4425
350 Ga0501071_0076839 3300049587 Bacteria 2439
351 Ga0501072_0079496 3300049588 Bacteria 2597
352 Ga0501072_0109407 3300049588 Bacteria 2199
353 Ga0501072_0139505 3300049588 Bacteria 1933
354 Ga0501076_0008027 3300049592 Bacteria 7712
355 Ga0501076_0109123 3300049592 Bacteria 2236
356 Ga0501077_0022773 3300049593 Bacteria 3970
357 Ga0501079_0008860 3300049741 Bacteria 7618
358 Ga0501079_0132276 3300049741 Bacteria 1941
359 Ga0501080_0042476 3300049742 Bacteria 4233
360 Ga0501080_0301271 3300049742 Bacteria 1454
361 Ga0501081_0107204 3300049743 Bacteria 1981
362 Ga0501045_0098828 3300049824 Bacteria 2159
363 nmdc:mga00v17_33595_c1 3300050491 Bacteria 3041
364 nmdc:mga0yw44_27236_c1 3300050492 Bacteria 3272
365 nmdc:mga0yw44_87706_c1 3300050492 Bacteria 1961
366 nmdc:mga0k408_105482_c1 3300050493 Bacteria 1664
367 nmdc:mga06z11_16832_c1 3300050494 Bacteria 3304
368 nmdc:mga06z11_29237_c1 3300050494 Bacteria 2653
369 nmdc:mga04h51_38696_c1 3300050495 Bacteria 1546
370 nmdc:mga05p37_1091778_c1 3300050507 Bacteria 837
371 nmdc:mga05p37_115472_c1 3300050507 Bacteria 3300
372 nmdc:mga05p37_117693_c1 3300050507 Bacteria 3265
373 nmdc:mga05p37_146098_c1 3300050507 Bacteria 2896
374 nmdc:mga05p37_296_c1 3300050507 Bacteria 52145
375 nmdc:mga05p37_390515_c1 3300050507 Bacteria 1628
376 nmdc:mga05p37_4938_c1 3300050507 Bacteria 15621
377 nmdc:mga05p37_77904_c1 3300050507 Bacteria 4081
378 nmdc:mga05p37_82282_c1 3300050507 Bacteria 3967
379 nmdc:mga09592_11185_c1 3300050508 Bacteria 7303
380 nmdc:mga09592_465523_c1 3300050508 Bacteria 1090
381 nmdc:mga09592_93296_c1 3300050508 Bacteria 2574
382 nmdc:mga0qj67_42857_c1 3300050509 Bacteria 3563
383 nmdc:mga06r32_1650_c1 3300050510 Bacteria 20144
384 nmdc:mga06r32_25151_c1 3300050510 Bacteria 5535
385 nmdc:mga06r32_725334_c1 3300050510 Unclassified 958
386 nmdc:mga06r32_78026_c1 3300050510 Bacteria 3218
387 nmdc:mga08y16_108349_c1 3300050511 Bacteria 2892
388 nmdc:mga08y16_11788_c1 3300050511 Bacteria 9186
389 nmdc:mga08y16_1409_c1 3300050511 Bacteria 24098
390 nmdc:mga08y16_19857_c1 3300050511 Bacteria 7087
391 nmdc:mga08y16_23195_c1 3300050511 Bacteria 6550
392 nmdc:mga08y16_254054_c1 3300050511 Bacteria 1816
393 nmdc:mga08y16_27777_c1 3300050511 Bacteria 5963
394 nmdc:mga08y16_459130_c1 3300050511 Bacteria 1298
395 nmdc:mga08y16_99445_c1 3300050511 Bacteria 3028
396 nmdc:mga0n895_197524_c1 3300050512 Bacteria 2043
397 nmdc:mga0n895_304825_c1 3300050512 Bacteria 1615
398 nmdc:mga0n895_349552_c1 3300050512 Bacteria 1497
399 nmdc:mga0n895_8549_c1 3300050512 Bacteria 8874
400 nmdc:mga0n895_98441_c1 3300050512 Bacteria 2931
401 nmdc:mga0rr50_152612_c1 3300050513 Bacteria 1868
402 nmdc:mga0rr50_72947_c1 3300050513 Bacteria 2623
403 nmdc:mga0rr50_90593_c1 3300050513 Bacteria 2380
404 nmdc:mga0a205_107641_c1 3300050515 Bacteria 2686
405 nmdc:mga0a205_19389_c1 3300050515 Bacteria 3298
406 nmdc:mga0a205_214834_c1 3300050515 Bacteria 1810
407 nmdc:mga0a205_323716_c1 3300050515 Bacteria 1412
408 nmdc:mga0a205_334117_c1 3300050515 Bacteria 1385
409 nmdc:mga0a205_41784_c1 3300050515 Bacteria 4417
410 nmdc:mga0a205_444007_c1 3300050515 Bacteria 1158
411 nmdc:mga0a205_47086_c1 3300050515 Bacteria 4160
412 Ga0495595_0202526 3300053084 Bacteria 988
413 Ga0495619_0020738 3300053085 Bacteria 4191
414 Ga0501084_0027973 3300054114 Bacteria 4711
415 Ga0501084_0038240 3300054114 Bacteria 4012
416 Ga0590074_005345 3300059423 Bacteria 2125
417 Ga0590075_000190 3300059424 Bacteria 17095
418 Ga0590077_000428 3300059426 Bacteria 11788
419 Ga0590077_000559 3300059426 Bacteria 10288
420 Ga0590077_006715 3300059426 Bacteria 2355
421 Ga0501082_0114093 3300060353 Bacteria 2340
422 Ga0501082_0200978 3300060353 Bacteria 1734
423 Ga0530510_0083716 3300061734 Bacteria 2323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028016 Ga0265354_1000007 Ga0265354_10000078 246
2 3300030878 Ga0265770_1000764 Ga0265770_10007644 246
3 3300033547 Ga0316212_1008094 Ga0316212_10080942 246
4 3300009147 Ga0114129_10381749 Ga0114129_103817492 258
5 3300048912 Ga0496109_0106367 Ga0496109_0106367_445_1236 258
6 3300050511 nmdc:mga08y16_27777_c1 nmdc:mga08y16_27777_c1_3182_3973 258
7 3300050515 nmdc:mga0a205_444007_c1 nmdc:mga0a205_444007_c1_300_1091 258
8 3300005340 Ga0070689_100222334 Ga0070689_1002223342 259
9 3300032002 Ga0307416_100386739 Ga0307416_1003867393 260
10 3300059426 Ga0590077_006715 Ga0590077_006715_314_1117 260
11 3300005289 Ga0065704_10157531 Ga0065704_101575312 261
12 3300005293 Ga0065715_10096479 Ga0065715_100964793 261
13 3300005295 Ga0065707_10002244 Ga0065707_100022442 261
14 3300005295 Ga0065707_10128740 Ga0065707_101287402 261
15 3300005328 Ga0070676_10122441 Ga0070676_101224412 261
16 3300005329 Ga0070683_100001440 Ga0070683_1000014403 261
17 3300005329 Ga0070683_100003811 Ga0070683_10000381113 261
18 3300005329 Ga0070683_100056199 Ga0070683_1000561994 261
19 3300005329 Ga0070683_100344986 Ga0070683_1003449863 261
20 3300005331 Ga0070670_100009850 Ga0070670_1000098509 261
21 3300005331 Ga0070670_100017512 Ga0070670_1000175123 261
22 3300005331 Ga0070670_100045471 Ga0070670_1000454715 261
23 3300005331 Ga0070670_100059421 Ga0070670_1000594212 261
24 3300005333 Ga0070677_10024493 Ga0070677_100244932 261
25 3300005333 Ga0070677_10097179 Ga0070677_100971792 261
26 3300005333 Ga0070677_10216857 Ga0070677_102168571 261
27 3300005334 Ga0068869_100025795 Ga0068869_1000257954 261
28 3300005334 Ga0068869_100343773 Ga0068869_1003437732 261
29 3300005336 Ga0070680_100034987 Ga0070680_1000349872 261
30 3300005336 Ga0070680_100271652 Ga0070680_1002716522 261
31 3300005339 Ga0070660_100393248 Ga0070660_1003932482 261
32 3300005340 Ga0070689_100135064 Ga0070689_1001350643 261
33 3300005344 Ga0070661_100359712 Ga0070661_1003597121 261
34 3300005345 Ga0070692_10049189 Ga0070692_100491892 261
35 3300005347 Ga0070668_100161731 Ga0070668_1001617312 261
36 3300005353 Ga0070669_100018893 Ga0070669_1000188935 261
37 3300005354 Ga0070675_100021756 Ga0070675_1000217564 261
38 3300005354 Ga0070675_100080067 Ga0070675_1000800672 261
39 3300005354 Ga0070675_100117216 Ga0070675_1001172162 261
40 3300005354 Ga0070675_100259318 Ga0070675_1002593181 261
41 3300005355 Ga0070671_100001437 Ga0070671_10000143717 261
42 3300005355 Ga0070671_100166187 Ga0070671_1001661872 261
43 3300005355 Ga0070671_100292759 Ga0070671_1002927591 261
44 3300005356 Ga0070674_100136452 Ga0070674_1001364521 261
45 3300005364 Ga0070673_100003282 Ga0070673_1000032828 261
46 3300005364 Ga0070673_100229543 Ga0070673_1002295433 261
47 3300005365 Ga0070688_100126613 Ga0070688_1001266133 261
48 3300005365 Ga0070688_100168252 Ga0070688_1001682521 261
49 3300005366 Ga0070659_100094505 Ga0070659_1000945052 261
50 3300005366 Ga0070659_100312582 Ga0070659_1003125822 261
51 3300005366 Ga0070659_100410229 Ga0070659_1004102292 261
52 3300005367 Ga0070667_100158847 Ga0070667_1001588473 261
53 3300005367 Ga0070667_100673855 Ga0070667_1006738551 261
54 3300005436 Ga0070713_100143182 Ga0070713_1001431822 261
55 3300005438 Ga0070701_10012223 Ga0070701_100122233 261
56 3300005438 Ga0070701_10131833 Ga0070701_101318332 261
57 3300005440 Ga0070705_100000088 Ga0070705_10000008821 261
58 3300005441 Ga0070700_100165884 Ga0070700_1001658842 261
59 3300005444 Ga0070694_100007040 Ga0070694_1000070407 261
60 3300005444 Ga0070694_100066402 Ga0070694_1000664022 261
61 3300005444 Ga0070694_100174739 Ga0070694_1001747392 261
62 3300005457 Ga0070662_100299574 Ga0070662_1002995741 261
63 3300005458 Ga0070681_10486988 Ga0070681_104869882 261
64 3300005459 Ga0068867_100001765 Ga0068867_10000176512 261
65 3300005466 Ga0070685_10097506 Ga0070685_100975063 261
66 3300005467 Ga0070706_100521311 Ga0070706_1005213112 261
67 3300005468 Ga0070707_100043347 Ga0070707_1000433475 261
68 3300005468 Ga0070707_100149532 Ga0070707_1001495322 261
69 3300005471 Ga0070698_100005658 Ga0070698_1000056583 261
70 3300005471 Ga0070698_100066521 Ga0070698_1000665213 261
71 3300005471 Ga0070698_100228730 Ga0070698_1002287301 261
72 3300005518 Ga0070699_100030212 Ga0070699_1000302122 261
73 3300005518 Ga0070699_100034488 Ga0070699_1000344883 261
74 3300005518 Ga0070699_100070601 Ga0070699_1000706013 261
75 3300005518 Ga0070699_100472905 Ga0070699_1004729052 261
76 3300005530 Ga0070679_100007331 Ga0070679_10000733110 261
77 3300005535 Ga0070684_100002824 Ga0070684_10000282410 261
78 3300005536 Ga0070697_100022746 Ga0070697_1000227463 261
79 3300005536 Ga0070697_100299714 Ga0070697_1002997142 261
80 3300005543 Ga0070672_100035605 Ga0070672_1000356054 261
81 3300005543 Ga0070672_100041049 Ga0070672_1000410493 261
82 3300005543 Ga0070672_100052696 Ga0070672_1000526963 261
83 3300005543 Ga0070672_100064210 Ga0070672_1000642104 261
84 3300005543 Ga0070672_100123638 Ga0070672_1001236383 261
85 3300005544 Ga0070686_100093064 Ga0070686_1000930643 261
86 3300005544 Ga0070686_100144294 Ga0070686_1001442942 261
87 3300005544 Ga0070686_100162065 Ga0070686_1001620652 261
88 3300005544 Ga0070686_100330294 Ga0070686_1003302941 261
89 3300005545 Ga0070695_100000021 Ga0070695_10000002159 261
90 3300005545 Ga0070695_100302584 Ga0070695_1003025842 261
91 3300005545 Ga0070695_100313115 Ga0070695_1003131152 261
92 3300005546 Ga0070696_100000016 Ga0070696_10000001621 261
93 3300005549 Ga0070704_100002034 Ga0070704_1000020345 261
94 3300005549 Ga0070704_100130901 Ga0070704_1001309011 261
95 3300005549 Ga0070704_100190961 Ga0070704_1001909612 261
96 3300005549 Ga0070704_100363651 Ga0070704_1003636512 261
97 3300005564 Ga0070664_100042927 Ga0070664_1000429274 261
98 3300005564 Ga0070664_100044468 Ga0070664_1000444685 261
99 3300005564 Ga0070664_100075998 Ga0070664_1000759984 261
100 3300005564 Ga0070664_100213557 Ga0070664_1002135572 261
101 3300005577 Ga0068857_100045406 Ga0068857_1000454064 261
102 3300005615 Ga0070702_100140402 Ga0070702_1001404023 261
103 3300005616 Ga0068852_100811647 Ga0068852_1008116472 261
104 3300005617 Ga0068859_100002429 Ga0068859_1000024295 261
105 3300005617 Ga0068859_100038232 Ga0068859_1000382326 261
106 3300005617 Ga0068859_100060094 Ga0068859_1000600945 261
107 3300005617 Ga0068859_100148099 Ga0068859_1001480993 261
108 3300005618 Ga0068864_100260641 Ga0068864_1002606412 261
109 3300005618 Ga0068864_100575581 Ga0068864_1005755812 261
110 3300005840 Ga0068870_10006003 Ga0068870_100060034 261
111 3300005840 Ga0068870_10215765 Ga0068870_102157652 261
112 3300005841 Ga0068863_100128791 Ga0068863_1001287912 261
113 3300005841 Ga0068863_100235034 Ga0068863_1002350343 261
114 3300005841 Ga0068863_100253547 Ga0068863_1002535472 261
115 3300005842 Ga0068858_100233981 Ga0068858_1002339812 261
116 3300005844 Ga0068862_100002348 Ga0068862_10000234810 261
117 3300005844 Ga0068862_100460411 Ga0068862_1004604112 261
118 3300005985 Ga0081539_10001461 Ga0081539_1000146115 261
119 3300005985 Ga0081539_10080911 Ga0081539_100809112 261
120 3300006028 Ga0070717_10149771 Ga0070717_101497712 261
121 3300006028 Ga0070717_10206967 Ga0070717_102069673 261
122 3300006038 Ga0075365_10047859 Ga0075365_100478593 261
123 3300006042 Ga0075368_10014497 Ga0075368_100144973 261
124 3300006051 Ga0075364_10004718 Ga0075364_100047183 261
125 3300006178 Ga0075367_10014379 Ga0075367_100143793 261
126 3300006358 Ga0068871_100278621 Ga0068871_1002786212 261
127 3300006844 Ga0075428_100000561 Ga0075428_10000056112 261
128 3300006844 Ga0075428_100026543 Ga0075428_1000265434 261
129 3300006844 Ga0075428_100158266 Ga0075428_1001582663 261
130 3300006846 Ga0075430_100000634 Ga0075430_10000063413 261
131 3300006847 Ga0075431_100004099 Ga0075431_10000409912 261
132 3300006847 Ga0075431_100127128 Ga0075431_1001271281 261
133 3300006847 Ga0075431_100181623 Ga0075431_1001816232 261
134 3300006852 Ga0075433_10008517 Ga0075433_100085176 261
135 3300006852 Ga0075433_10062187 Ga0075433_100621873 261
136 3300006852 Ga0075433_10202980 Ga0075433_102029802 261
137 3300006852 Ga0075433_10206802 Ga0075433_102068022 261
138 3300006871 Ga0075434_100003140 Ga0075434_1000031404 261
139 3300006871 Ga0075434_100011772 Ga0075434_1000117722 261
140 3300006871 Ga0075434_100057280 Ga0075434_1000572803 261
141 3300006871 Ga0075434_100178190 Ga0075434_1001781902 261
142 3300006871 Ga0075434_100210838 Ga0075434_1002108382 261
143 3300006871 Ga0075434_100543565 Ga0075434_1005435652 261
144 3300006871 Ga0075434_100597920 Ga0075434_1005979202 261
145 3300006880 Ga0075429_100002724 Ga0075429_10000272412 261
146 3300006880 Ga0075429_100009669 Ga0075429_1000096694 261
147 3300006880 Ga0075429_100043784 Ga0075429_1000437845 261
148 3300006880 Ga0075429_100064214 Ga0075429_1000642143 261
149 3300006880 Ga0075429_100269343 Ga0075429_1002693432 261
150 3300006881 Ga0068865_100136961 Ga0068865_1001369612 261
151 3300006881 Ga0068865_100320989 Ga0068865_1003209892 261
152 3300006881 Ga0068865_100347292 Ga0068865_1003472922 261
153 3300006914 Ga0075436_100099683 Ga0075436_1000996832 261
154 3300006931 Ga0097620_100002429 Ga0097620_10000242914 261
155 3300006931 Ga0097620_100038232 Ga0097620_1000382326 261
156 3300006931 Ga0097620_100060094 Ga0097620_1000600945 261
157 3300006931 Ga0097620_100148093 Ga0097620_1001480932 261
158 3300006931 Ga0097620_100659746 Ga0097620_1006597462 261
159 3300007076 Ga0075435_100003163 Ga0075435_1000031638 261
160 3300007076 Ga0075435_100023885 Ga0075435_1000238852 261
161 3300007076 Ga0075435_100043553 Ga0075435_1000435533 261
162 3300007076 Ga0075435_100076291 Ga0075435_1000762913 261
163 3300007076 Ga0075435_100295890 Ga0075435_1002958902 261
164 3300009093 Ga0105240_10116562 Ga0105240_101165624 261
165 3300009094 Ga0111539_10001329 Ga0111539_1000132926 261
166 3300009094 Ga0111539_10006200 Ga0111539_100062004 261
167 3300009094 Ga0111539_10015546 Ga0111539_100155463 261
168 3300009094 Ga0111539_10043989 Ga0111539_100439893 261
169 3300009094 Ga0111539_10046777 Ga0111539_100467771 261
170 3300009094 Ga0111539_10163270 Ga0111539_101632702 261
171 3300009094 Ga0111539_10397157 Ga0111539_103971572 261
172 3300009147 Ga0114129_10002708 Ga0114129_1000270812 261
173 3300009147 Ga0114129_10003670 Ga0114129_1000367021 261
174 3300009147 Ga0114129_10007770 Ga0114129_100077708 261
175 3300009147 Ga0114129_10020210 Ga0114129_100202108 261
176 3300009147 Ga0114129_10024134 Ga0114129_100241347 261
177 3300009147 Ga0114129_10105943 Ga0114129_101059433 261
178 3300009147 Ga0114129_10108231 Ga0114129_101082313 261
179 3300009147 Ga0114129_10233584 Ga0114129_102335842 261
180 3300009147 Ga0114129_10404949 Ga0114129_104049493 261
181 3300009147 Ga0114129_10424187 Ga0114129_104241872 261
182 3300009148 Ga0105243_10373820 Ga0105243_103738202 261
183 3300009176 Ga0105242_10477957 Ga0105242_104779572 261
184 3300009177 Ga0105248_10201246 Ga0105248_102012462 261
185 3300009551 Ga0105238_10010341 Ga0105238_100103413 261
186 3300009553 Ga0105249_10016096 Ga0105249_100160962 261
187 3300009553 Ga0105249_10102742 Ga0105249_101027424 261
188 3300013104 Ga0157370_10268866 Ga0157370_102688663 261
189 3300013296 Ga0157374_10350571 Ga0157374_103505711 261
190 3300013308 Ga0157375_10087759 Ga0157375_100877593 261
191 3300013308 Ga0157375_10360649 Ga0157375_103606492 261
192 3300014325 Ga0163163_10023158 Ga0163163_100231586 261
193 3300014325 Ga0163163_10109307 Ga0163163_101093073 261
194 3300014325 Ga0163163_10673141 Ga0163163_106731412 261
195 3300014326 Ga0157380_10278397 Ga0157380_102783971 261
196 3300014745 Ga0157377_10497100 Ga0157377_104971001 261
197 3300014968 Ga0157379_10112078 Ga0157379_101120782 261
198 3300014969 Ga0157376_10185330 Ga0157376_101853303 261
199 3300020070 Ga0206356_11687783 Ga0206356_116877832 261
200 3300025893 Ga0207682_10154082 Ga0207682_101540821 261
201 3300025907 Ga0207645_10127611 Ga0207645_101276112 261
202 3300025908 Ga0207643_10108497 Ga0207643_101084973 261
203 3300025913 Ga0207695_10168801 Ga0207695_101688012 261
204 3300025913 Ga0207695_10212773 Ga0207695_102127733 261
205 3300025917 Ga0207660_10096513 Ga0207660_100965133 261
206 3300025918 Ga0207662_10474438 Ga0207662_104744381 261
207 3300025919 Ga0207657_10258345 Ga0207657_102583452 261
208 3300025921 Ga0207652_10109405 Ga0207652_101094052 261
209 3300025921 Ga0207652_10658139 Ga0207652_106581391 261
210 3300025922 Ga0207646_10014862 Ga0207646_100148627 261
211 3300025923 Ga0207681_10096458 Ga0207681_100964583 261
212 3300025924 Ga0207694_10059123 Ga0207694_100591234 261
213 3300025925 Ga0207650_10002645 Ga0207650_100026452 261
214 3300025925 Ga0207650_10010728 Ga0207650_100107282 261
215 3300025925 Ga0207650_10044450 Ga0207650_100444504 261
216 3300025925 Ga0207650_10245016 Ga0207650_102450162 261
217 3300025926 Ga0207659_10018020 Ga0207659_100180203 261
218 3300025926 Ga0207659_10148037 Ga0207659_101480372 261
219 3300025926 Ga0207659_10233387 Ga0207659_102333872 261
220 3300025926 Ga0207659_10444224 Ga0207659_104442242 261
221 3300025926 Ga0207659_10473136 Ga0207659_104731362 261
222 3300025927 Ga0207687_10343930 Ga0207687_103439302 261
223 3300025928 Ga0207700_10088317 Ga0207700_100883172 261
224 3300025931 Ga0207644_10004753 Ga0207644_100047539 261
225 3300025931 Ga0207644_10033691 Ga0207644_100336916 261
226 3300025931 Ga0207644_10088884 Ga0207644_100888842 261
227 3300025932 Ga0207690_10296829 Ga0207690_102968292 261
228 3300025933 Ga0207706_10305143 Ga0207706_103051432 261
229 3300025934 Ga0207686_10130524 Ga0207686_101305242 261
230 3300025936 Ga0207670_10013368 Ga0207670_100133682 261
231 3300025937 Ga0207669_10102763 Ga0207669_101027633 261
232 3300025940 Ga0207691_10024353 Ga0207691_100243531 261
233 3300025940 Ga0207691_10182008 Ga0207691_101820082 261
234 3300025940 Ga0207691_10326236 Ga0207691_103262361 261
235 3300025942 Ga0207689_10119943 Ga0207689_101199432 261
236 3300025942 Ga0207689_10125203 Ga0207689_101252034 261
237 3300025944 Ga0207661_10007265 Ga0207661_100072653 261
238 3300025944 Ga0207661_10020983 Ga0207661_100209833 261
239 3300025945 Ga0207679_10036064 Ga0207679_100360642 261
240 3300025945 Ga0207679_10104766 Ga0207679_101047663 261
241 3300025945 Ga0207679_10255228 Ga0207679_102552282 261
242 3300025945 Ga0207679_10312513 Ga0207679_103125132 261
243 3300025960 Ga0207651_10003589 Ga0207651_100035897 261
244 3300025960 Ga0207651_10329487 Ga0207651_103294871 261
245 3300025961 Ga0207712_10145486 Ga0207712_101454862 261
246 3300025972 Ga0207668_10094761 Ga0207668_100947613 261
247 3300025981 Ga0207640_10345554 Ga0207640_103455542 261
248 3300026023 Ga0207677_10384903 Ga0207677_103849032 261
249 3300026041 Ga0207639_10667144 Ga0207639_106671442 261
250 3300026067 Ga0207678_10171024 Ga0207678_101710242 261
251 3300026067 Ga0207678_10436873 Ga0207678_104368732 261
252 3300026075 Ga0207708_10052207 Ga0207708_100522073 261
253 3300026075 Ga0207708_10099221 Ga0207708_100992212 261
254 3300026075 Ga0207708_10342266 Ga0207708_103422662 261
255 3300026078 Ga0207702_10329175 Ga0207702_103291752 261
256 3300026088 Ga0207641_10080974 Ga0207641_100809741 261
257 3300026088 Ga0207641_10125990 Ga0207641_101259902 261
258 3300026088 Ga0207641_10230541 Ga0207641_102305412 261
259 3300026089 Ga0207648_10000338 Ga0207648_1000033849 261
260 3300026095 Ga0207676_10044767 Ga0207676_100447672 261
261 3300026095 Ga0207676_10067251 Ga0207676_100672512 261
262 3300026116 Ga0207674_10010709 Ga0207674_100107092 261
263 3300026116 Ga0207674_10015388 Ga0207674_100153883 261
264 3300026118 Ga0207675_100252853 Ga0207675_1002528532 261
265 3300026121 Ga0207683_10100077 Ga0207683_101000774 261
266 3300026142 Ga0207698_10693305 Ga0207698_106933052 261
267 3300027866 Ga0209813_10020875 Ga0209813_100208753 261
268 3300027876 Ga0209974_10030536 Ga0209974_100305362 261
269 3300027907 Ga0207428_10000438 Ga0207428_100004388 261
270 3300027907 Ga0207428_10001787 Ga0207428_100017877 261
271 3300027907 Ga0207428_10002109 Ga0207428_1000210912 261
272 3300027907 Ga0207428_10106556 Ga0207428_101065562 261
273 3300027907 Ga0207428_10228177 Ga0207428_102281772 261
274 3300028379 Ga0268266_10197992 Ga0268266_101979922 261
275 3300028380 Ga0268265_10002063 Ga0268265_1000206312 261
276 3300028381 Ga0268264_10167110 Ga0268264_101671103 261
277 3300031548 Ga0307408_100004358 Ga0307408_1000043589 261
278 3300031548 Ga0307408_100010125 Ga0307408_1000101255 261
279 3300031548 Ga0307408_100126982 Ga0307408_1001269821 261
280 3300031548 Ga0307408_100192658 Ga0307408_1001926582 261
281 3300031731 Ga0307405_10069025 Ga0307405_100690252 261
282 3300031731 Ga0307405_10176862 Ga0307405_101768622 261
283 3300031824 Ga0307413_10091647 Ga0307413_100916472 261
284 3300031824 Ga0307413_10172485 Ga0307413_101724852 261
285 3300031824 Ga0307413_10416979 Ga0307413_104169791 261
286 3300031852 Ga0307410_10004204 Ga0307410_100042043 261
287 3300031852 Ga0307410_10053453 Ga0307410_100534533 261
288 3300031901 Ga0307406_10006470 Ga0307406_100064703 261
289 3300031901 Ga0307406_10052543 Ga0307406_100525433 261
290 3300031903 Ga0307407_10030091 Ga0307407_100300912 261
291 3300031911 Ga0307412_10005263 Ga0307412_100052634 261
292 3300032002 Ga0307416_100018256 Ga0307416_1000182564 261
293 3300032002 Ga0307416_100032265 Ga0307416_1000322653 261
294 3300032002 Ga0307416_100186831 Ga0307416_1001868312 261
295 3300032002 Ga0307416_100224153 Ga0307416_1002241532 261
296 3300032002 Ga0307416_100428706 Ga0307416_1004287062 261
297 3300032002 Ga0307416_100626596 Ga0307416_1006265962 261
298 3300032004 Ga0307414_10036056 Ga0307414_100360564 261
299 3300032004 Ga0307414_10310402 Ga0307414_103104022 261
300 3300032005 Ga0307411_10003183 Ga0307411_100031838 261
301 3300032005 Ga0307411_10065184 Ga0307411_100651842 261
302 3300032005 Ga0307411_10223860 Ga0307411_102238602 261
303 3300032126 Ga0307415_100002939 Ga0307415_1000029397 261
304 3300035170 Ga0373943_0055395 Ga0373943_0055395_626_1417 261
305 3300035170 Ga0373943_0171593 Ga0373943_0171593_248_1048 261
306 3300035691 Ga0373931_0287579 Ga0373931_0287579_35_820 261
307 3300036401 Ga0373937_0021998 Ga0373937_0021998_1009_1806 261
308 3300036401 Ga0373937_0043760 Ga0373937_0043760_956_1741 261
309 3300036401 Ga0373937_0141805 Ga0373937_0141805_509_1300 261
310 3300037068 Ga0373925_0002903 Ga0373925_0002903_7904_8695 261
311 3300037068 Ga0373925_0081834 Ga0373925_0081834_536_1327 261
312 3300041997 Ga0439431_0020029 Ga0439431_0020029_431_1222 261
313 3300041999 Ga0439433_0007263 Ga0439433_0007263_908_1699 261
314 3300042008 Ga0439450_000446 Ga0439450_000446_3094_3891 261
315 3300042156 Ga0439446_0012167 Ga0439446_0012167_918_1709 261
316 3300042156 Ga0439446_0056244 Ga0439446_0056244_252_1037 261
317 3300042436 Ga0439435_0008408 Ga0439435_0008408_1346_2143 261
318 3300042436 Ga0439435_0033075 Ga0439435_0033075_553_1341 261
319 3300042439 Ga0439464_0013618 Ga0439464_0013618_398_1195 261
320 3300042439 Ga0439464_0018038 Ga0439464_0018038_322_1107 261
321 3300042993 Ga0439440_0022697 Ga0439440_0022697_433_1230 261
322 3300045051 Ga0451576_0127252 Ga0451576_0127252_627_1412 261
323 3300045051 Ga0451576_0269752 Ga0451576_0269752_718_1503 261
324 3300046472 Ga0495580_0044084 Ga0495580_0044084_396_1262 261
325 3300046472 Ga0495580_0312673 Ga0495580_0312673_24_809 261
326 3300046499 Ga0495594_0022890 Ga0495594_0022890_861_1646 261
327 3300046525 Ga0495663_0012544 Ga0495663_0012544_1498_2283 261
328 3300046528 Ga0495642_0021194 Ga0495642_0021194_20_820 261
329 3300046528 Ga0495642_0089416 Ga0495642_0089416_481_1266 261
330 3300046531 Ga0495665_0223206 Ga0495665_0223206_79_924 261
331 3300046539 Ga0495621_0016609 Ga0495621_0016609_1437_2222 261
332 3300046558 Ga0495633_0155812 Ga0495633_0155812_88_873 261
333 3300046615 Ga0495656_0036623 Ga0495656_0036623_661_1446 261
334 3300046664 Ga0495659_0016703 Ga0495659_0016703_279_1064 261
335 3300046664 Ga0495659_0037049 Ga0495659_0037049_841_1626 261
336 3300046674 Ga0495588_0003893 Ga0495588_0003893_5548_6333 261
337 3300046684 Ga0495669_0027674 Ga0495669_0027674_666_1451 261
338 3300046684 Ga0495669_0194128 Ga0495669_0194128_40_825 261
339 3300046691 Ga0495670_0027423 Ga0495670_0027423_1104_1889 261
340 3300047319 Ga0495674_0035771 Ga0495674_0035771_3598_4464 261
341 3300048903 Ga0496100_0115907 Ga0496100_0115907_708_1532 261
342 3300048911 Ga0496108_0512005 Ga0496108_0512005_114_920 261
343 3300048912 Ga0496109_0239702 Ga0496109_0239702_154_960 261
344 3300048912 Ga0496109_0316836 Ga0496109_0316836_249_1034 261
345 3300048915 Ga0496112_0349821 Ga0496112_0349821_171_962 261
346 3300048916 Ga0496113_0094350 Ga0496113_0094350_605_1411 261
347 3300049515 Ga0501292_005929 Ga0501292_005929_92_889 261
348 3300049570 Ga0501033_0477090 Ga0501033_0477090_37_822 261
349 3300049571 Ga0501034_0048126 Ga0501034_0048126_1471_2262 261
350 3300049575 Ga0501039_0076400 Ga0501039_0076400_975_1760 261
351 3300049578 Ga0501042_0125894 Ga0501042_0125894_112_897 261
352 3300049581 Ga0501047_0041880 Ga0501047_0041880_2720_3511 261
353 3300049587 Ga0501071_0076839 Ga0501071_0076839_1325_2143 261
354 3300049588 Ga0501072_0079496 Ga0501072_0079496_94_879 261
355 3300049588 Ga0501072_0109407 Ga0501072_0109407_231_1016 261
356 3300049588 Ga0501072_0139505 Ga0501072_0139505_173_958 261
357 3300049592 Ga0501076_0008027 Ga0501076_0008027_780_1565 261
358 3300049592 Ga0501076_0109123 Ga0501076_0109123_706_1524 261
359 3300049593 Ga0501077_0022773 Ga0501077_0022773_968_1786 261
360 3300049741 Ga0501079_0008860 Ga0501079_0008860_6533_7351 261
361 3300049741 Ga0501079_0132276 Ga0501079_0132276_581_1366 261
362 3300049742 Ga0501080_0042476 Ga0501080_0042476_2350_3168 261
363 3300049742 Ga0501080_0301271 Ga0501080_0301271_420_1211 261
364 3300049743 Ga0501081_0107204 Ga0501081_0107204_795_1580 261
365 3300049824 Ga0501045_0098828 Ga0501045_0098828_614_1399 261
366 3300050491 nmdc:mga00v17_33595_c1 nmdc:mga00v17_33595_c1_1927_2718 261
367 3300050492 nmdc:mga0yw44_27236_c1 nmdc:mga0yw44_27236_c1_720_1514 261
368 3300050492 nmdc:mga0yw44_87706_c1 nmdc:mga0yw44_87706_c1_92_886 261
369 3300050493 nmdc:mga0k408_105482_c1 nmdc:mga0k408_105482_c1_646_1626 261
370 3300050494 nmdc:mga06z11_16832_c1 nmdc:mga06z11_16832_c1_2256_3074 261
371 3300050494 nmdc:mga06z11_29237_c1 nmdc:mga06z11_29237_c1_601_1392 261
372 3300050495 nmdc:mga04h51_38696_c1 nmdc:mga04h51_38696_c1_370_1161 261
373 3300050507 nmdc:mga05p37_1091778_c1 nmdc:mga05p37_1091778_c1_30_815 261
374 3300050507 nmdc:mga05p37_115472_c1 nmdc:mga05p37_115472_c1_1106_1903 261
375 3300050507 nmdc:mga05p37_117693_c1 nmdc:mga05p37_117693_c1_2276_3070 261
376 3300050507 nmdc:mga05p37_146098_c1 nmdc:mga05p37_146098_c1_1084_1869 261
377 3300050507 nmdc:mga05p37_296_c1 nmdc:mga05p37_296_c1_8200_8997 261
378 3300050507 nmdc:mga05p37_390515_c1 nmdc:mga05p37_390515_c1_457_1242 261
379 3300050507 nmdc:mga05p37_4938_c1 nmdc:mga05p37_4938_c1_10908_11693 261
380 3300050507 nmdc:mga05p37_77904_c1 nmdc:mga05p37_77904_c1_2831_3616 261
381 3300050507 nmdc:mga05p37_82282_c1 nmdc:mga05p37_82282_c1_3050_3847 261
382 3300050508 nmdc:mga09592_11185_c1 nmdc:mga09592_11185_c1_1737_2534 261
383 3300050508 nmdc:mga09592_465523_c1 nmdc:mga09592_465523_c1_118_903 261
384 3300050508 nmdc:mga09592_93296_c1 nmdc:mga09592_93296_c1_436_1230 261
385 3300050509 nmdc:mga0qj67_42857_c1 nmdc:mga0qj67_42857_c1_2546_3343 261
386 3300050510 nmdc:mga06r32_1650_c1 nmdc:mga06r32_1650_c1_16988_17785 261
387 3300050510 nmdc:mga06r32_25151_c1 nmdc:mga06r32_25151_c1_2062_2859 261
388 3300050510 nmdc:mga06r32_725334_c1 nmdc:mga06r32_725334_c1_22_813 261
389 3300050510 nmdc:mga06r32_78026_c1 nmdc:mga06r32_78026_c1_39_833 261
390 3300050511 nmdc:mga08y16_108349_c1 nmdc:mga08y16_108349_c1_566_1393 261
391 3300050511 nmdc:mga08y16_11788_c1 nmdc:mga08y16_11788_c1_6886_7683 261
392 3300050511 nmdc:mga08y16_1409_c1 nmdc:mga08y16_1409_c1_19491_20276 261
393 3300050511 nmdc:mga08y16_19857_c1 nmdc:mga08y16_19857_c1_595_1380 261
394 3300050511 nmdc:mga08y16_23195_c1 nmdc:mga08y16_23195_c1_1582_2379 261
395 3300050511 nmdc:mga08y16_254054_c1 nmdc:mga08y16_254054_c1_558_1349 261
396 3300050511 nmdc:mga08y16_459130_c1 nmdc:mga08y16_459130_c1_49_834 261
397 3300050511 nmdc:mga08y16_99445_c1 nmdc:mga08y16_99445_c1_144_938 261
398 3300050512 nmdc:mga0n895_197524_c1 nmdc:mga0n895_197524_c1_986_1771 261
399 3300050512 nmdc:mga0n895_304825_c1 nmdc:mga0n895_304825_c1_214_999 261
400 3300050512 nmdc:mga0n895_349552_c1 nmdc:mga0n895_349552_c1_299_1090 261
401 3300050512 nmdc:mga0n895_8549_c1 nmdc:mga0n895_8549_c1_1727_2524 261
402 3300050512 nmdc:mga0n895_98441_c1 nmdc:mga0n895_98441_c1_728_1522 261
403 3300050513 nmdc:mga0rr50_152612_c1 nmdc:mga0rr50_152612_c1_381_1166 261
404 3300050513 nmdc:mga0rr50_72947_c1 nmdc:mga0rr50_72947_c1_215_1000 261
405 3300050513 nmdc:mga0rr50_90593_c1 nmdc:mga0rr50_90593_c1_750_1541 261
406 3300050515 nmdc:mga0a205_107641_c1 nmdc:mga0a205_107641_c1_1685_2482 261
407 3300050515 nmdc:mga0a205_19389_c1 nmdc:mga0a205_19389_c1_1464_2255 261
408 3300050515 nmdc:mga0a205_214834_c1 nmdc:mga0a205_214834_c1_366_1193 261
409 3300050515 nmdc:mga0a205_323716_c1 nmdc:mga0a205_323716_c1_169_960 261
410 3300050515 nmdc:mga0a205_334117_c1 nmdc:mga0a205_334117_c1_566_1351 261
411 3300050515 nmdc:mga0a205_41784_c1 nmdc:mga0a205_41784_c1_2736_3533 261
412 3300050515 nmdc:mga0a205_47086_c1 nmdc:mga0a205_47086_c1_2183_2968 261
413 3300053084 Ga0495595_0202526 Ga0495595_0202526_163_960 261
414 3300053085 Ga0495619_0020738 Ga0495619_0020738_2729_3523 261
415 3300054114 Ga0501084_0027973 Ga0501084_0027973_2197_2982 261
416 3300054114 Ga0501084_0038240 Ga0501084_0038240_76_894 261
417 3300059423 Ga0590074_005345 Ga0590074_005345_1215_2000 261
418 3300059424 Ga0590075_000190 Ga0590075_000190_6588_7373 261
419 3300059426 Ga0590077_000428 Ga0590077_000428_6916_7701 261
420 3300059426 Ga0590077_000559 Ga0590077_000559_4724_5509 261
421 3300060353 Ga0501082_0114093 Ga0501082_0114093_1268_2086 261
422 3300060353 Ga0501082_0200978 Ga0501082_0200978_720_1505 261
423 3300061734 Ga0530510_0083716 Ga0530510_0083716_1183_1968 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00290

Trp_syntA

Tryptophan synthase alpha chain

15

278

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e9p-assembly2.cif.gz_C crystal structure of tryptophan synthase from m. tuberculosis - open form with brd0059 bound 0.9657 1 260
5tcf-assembly2.cif.gz_E crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form 0.9656 1 260
1wdw-assembly3.cif.gz_K structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, pyrococcus furiosus 0.965 15 259
5e0k-assembly3.cif.gz_K x-ray crystal structure of tryptophan synthase complex from pyrococcus furiosus at 2.76 a 0.9619 18 259
5ocw-assembly1.cif.gz_A structure of mycobacterium tuberculosis tryptophan synthase in space group f222 0.9612 1 260
ID Description Score Start End Superfamily
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9668 2 259 3.20.20.70
6du1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9591 1 260 3.20.20.70
af_B4F800_73_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.957 4 260 3.20.20.70
1wdwE00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.955 15 259 3.20.20.70
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9523 2 259 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7Y5WVA3-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.988 1 175 GO:0004834
GO:0005829
GO:0006568
AF-A0A3N5XWI8-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9847 3 259 GO:0004834
GO:0005829
GO:0006568
AF-A0A2V9R529-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9826 27 241 GO:0004834
GO:0005829
GO:0006568
AF-T1M3U0-F1-model_v4 deleted 0.9819 18 175
AF-A0A7W1TER6-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9808 1 174 GO:0004834
GO:0005829
GO:0006568

Feature Viewer

pLDDT pTM Quality
92.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map