F440592

General Info

Members Datasets Scaffolds Average Seq Length
423 213 421 369

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0051369|Ga0495621_0051369_84_1442
Length 452
Sequence MGLVNQVVPKDQLETFTRDYAQTMARNAPLTLKAAKASVDQLVKPAAQRDTAMLDKLIADCFNSEDYQEGVRAFSEKRRPQFKVRVESVDAIAVEIPLTRNFGGSTYSVLKRSTVVTRLRTDAGLVSEVYNGDNREHGAEIVRLIREDLGPRLHGVDVLAIEQIWDDLFTLSHASRDRKTLMEAIACVDCALWDVIGKACSLTVAELLGGKARPMPIISIGGYYMPGKTLADIGREMEAYRRAGMAGCKFKVGGLTPEADAERVQVARDAAGDDFVLAVDANRGWSLGDAVRFAKLVEPLDIRWFEEPCHWHDDAAMMADVRRATRIPVTAGQSEITSQGVRRLLQAGAVDVVNVDASECGGVTEWRRAAALCAATGVEMAHHEESQIARHLMAAAPRGTYVECFADPERDPVWQSMWANRPLIKDGMLGASSDAGFGLVLDDAMVRRYRVA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
166 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.24
Rhizoplane 2.36
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016315 3300003203 Unclassified 3099
2 Ga0070683_100078017 3300005329 Unclassified 3098
3 Ga0070690_100186085 3300005330 Unclassified 1437
4 Ga0070670_100004645 3300005331 Bacteria 11519
5 Ga0070670_100013818 3300005331 Bacteria 6921
6 Ga0068869_100001452 3300005334 Bacteria 14017
7 Ga0068869_100083798 3300005334 Unclassified 2385
8 Ga0068869_100123458 3300005334 Unclassified 1983
9 Ga0070666_10090322 3300005335 Bacteria 2104
10 Ga0070680_100011658 3300005336 Bacteria 6812
11 Ga0070682_100002509 3300005337 Bacteria 10128
12 Ga0070660_100016239 3300005339 Bacteria 5399
13 Ga0070689_100027061 3300005340 Bacteria 4321
14 Ga0070691_10003047 3300005341 Bacteria 7499
15 Ga0070691_10015614 3300005341 Bacteria 3488
16 Ga0070661_100023730 3300005344 Bacteria 4399
17 Ga0070692_10002198 3300005345 Bacteria 7468
18 Ga0070668_100009121 3300005347 Bacteria 7364
19 Ga0070669_100028792 3300005353 Bacteria 4001
20 Ga0070669_100035470 3300005353 Bacteria 3614
21 Ga0070674_100289102 3300005356 Bacteria 1302
22 Ga0070673_100027608 3300005364 Bacteria 4210
23 Ga0070688_100061009 3300005365 Bacteria 2383
24 Ga0070659_100000377 3300005366 Bacteria 33695
25 Ga0070703_10006396 3300005406 Bacteria 3303
26 Ga0070713_100056037 3300005436 Bacteria 3278
27 Ga0070701_10006518 3300005438 Bacteria 4918
28 Ga0070701_10014965 3300005438 Unclassified 3569
29 Ga0070701_10099002 3300005438 Bacteria 1611
30 Ga0070705_100009495 3300005440 Bacteria 4839
31 Ga0070700_100020135 3300005441 Unclassified 3859
32 Ga0070694_100032698 3300005444 Bacteria 3417
33 Ga0070708_100014332 3300005445 Bacteria 6520
34 Ga0070708_100037746 3300005445 Bacteria 4218
35 Ga0070708_100047472 3300005445 Bacteria 3793
36 Ga0070708_100066444 3300005445 Bacteria 3237
37 Ga0070708_100140076 3300005445 Unclassified 2243
38 Ga0070708_100200539 3300005445 Unclassified 1868
39 Ga0070663_100001821 3300005455 Bacteria 11866
40 Ga0070678_100023444 3300005456 Bacteria 4113
41 Ga0070678_100057376 3300005456 Bacteria 2852
42 Ga0070662_100007534 3300005457 Bacteria 7061
43 Ga0070681_10021724 3300005458 Bacteria 6436
44 Ga0070681_10078947 3300005458 Bacteria 3248
45 Ga0070681_10157715 3300005458 Bacteria 2194
46 Ga0068867_100003302 3300005459 Bacteria 11361
47 Ga0068867_100014150 3300005459 Bacteria 5651
48 Ga0068867_100092123 3300005459 Bacteria 2301
49 Ga0070706_100013791 3300005467 Bacteria 7474
50 Ga0070706_100049412 3300005467 Bacteria 3882
51 Ga0070706_100127002 3300005467 Bacteria 2378
52 Ga0070706_100190304 3300005467 Bacteria 1917
53 Ga0070706_100363544 3300005467 Bacteria 1348
54 Ga0070707_100002180 3300005468 Bacteria 18721
55 Ga0070707_100016652 3300005468 Bacteria 6900
56 Ga0070707_100019107 3300005468 Bacteria 6453
57 Ga0070707_100059173 3300005468 Bacteria 3675
58 Ga0070707_100114956 3300005468 Bacteria 2611
59 Ga0070707_100146863 3300005468 Bacteria 2295
60 Ga0070698_100001010 3300005471 Bacteria 30910
61 Ga0070698_100004229 3300005471 Bacteria 15783
62 Ga0070698_100057246 3300005471 Bacteria 3945
63 Ga0070698_100065735 3300005471 Bacteria 3651
64 Ga0070698_100095682 3300005471 Bacteria 2947
65 Ga0070699_100002611 3300005518 Bacteria 16093
66 Ga0070699_100008788 3300005518 Bacteria 8754
67 Ga0070679_100021385 3300005530 Bacteria 6315
68 Ga0070697_100028318 3300005536 Bacteria 4485
69 Ga0070697_100030636 3300005536 Bacteria 4322
70 Ga0070697_100043773 3300005536 Bacteria 3626
71 Ga0070697_100151817 3300005536 Bacteria 1953
72 Ga0068853_100012895 3300005539 Bacteria 6811
73 Ga0070672_100033462 3300005543 Unclassified 3893
74 Ga0070686_100054527 3300005544 Bacteria 2557
75 Ga0070695_100002346 3300005545 Bacteria 10861
76 Ga0070695_100040087 3300005545 Bacteria 2963
77 Ga0070696_100002742 3300005546 Bacteria 11687
78 Ga0070696_100047989 3300005546 Bacteria 2964
79 Ga0070693_100000929 3300005547 Bacteria 12998
80 Ga0070693_100129032 3300005547 Bacteria 1578
81 Ga0070665_100008084 3300005548 Bacteria 10648
82 Ga0070704_100006964 3300005549 Bacteria 6706
83 Ga0070704_100024745 3300005549 Bacteria 3943
84 Ga0070704_100050215 3300005549 Unclassified 2930
85 Ga0068855_100006654 3300005563 Bacteria 14037
86 Ga0070664_100160066 3300005564 Unclassified 1991
87 Ga0070664_100218588 3300005564 Unclassified 1704
88 Ga0070664_100243031 3300005564 Bacteria 1616
89 Ga0068857_100033329 3300005577 Bacteria 4555
90 Ga0068857_100048685 3300005577 Bacteria 3762
91 Ga0068854_100008989 3300005578 Bacteria 6439
92 Ga0068856_100001687 3300005614 Bacteria 23089
93 Ga0068856_100128838 3300005614 Bacteria 2534
94 Ga0068852_100093674 3300005616 Bacteria 2693
95 Ga0068859_100007912 3300005617 Bacteria 10781
96 Ga0068859_100039159 3300005617 Bacteria 4755
97 Ga0068859_100381636 3300005617 Unclassified 1504
98 Ga0068864_100015072 3300005618 Bacteria 6425
99 Ga0068866_10002306 3300005718 Bacteria 7903
100 Ga0068861_100054895 3300005719 Unclassified 3037
101 Ga0068870_10001427 3300005840 Bacteria 9660
102 Ga0068870_10015890 3300005840 Plasmid 3583
103 Ga0068863_100051268 3300005841 Bacteria 3911
104 Ga0068863_100164786 3300005841 Bacteria 2125
105 Ga0068863_100274804 3300005841 Unclassified 1631
106 Ga0068858_100016518 3300005842 Bacteria 6933
107 Ga0068858_100042880 3300005842 Bacteria 4195
108 Ga0068860_100013265 3300005843 Bacteria 8086
109 Ga0068860_100035345 3300005843 Bacteria 4792
110 Ga0068862_100013621 3300005844 Bacteria 6735
111 Ga0068862_100016348 3300005844 Bacteria 6175
112 Ga0068862_100018122 3300005844 Bacteria 5862
113 Ga0068862_100223302 3300005844 Bacteria 1706
114 Ga0081539_10000020 3300005985 Bacteria 366549
115 Ga0081539_10066305 3300005985 Bacteria 1957
116 Ga0070717_10107012 3300006028 Bacteria 2381
117 Ga0097621_100033667 3300006237 Bacteria 4082
118 Ga0068871_100062440 3300006358 Bacteria 3044
119 Ga0075428_100019877 3300006844 Bacteria 7435
120 Ga0075428_100364531 3300006844 Bacteria 1550
121 Ga0075430_100001918 3300006846 Bacteria 17059
122 Ga0075431_100006917 3300006847 Bacteria 11276
123 Ga0075431_100012693 3300006847 Bacteria 8509
124 Ga0075431_100069245 3300006847 Bacteria 3641
125 Ga0075431_100087885 3300006847 Bacteria 3207
126 Ga0075431_100126719 3300006847 Bacteria 2635
127 Ga0075431_100388185 3300006847 Bacteria 1399
128 Ga0075433_10000319 3300006852 Bacteria 29346
129 Ga0075433_10000948 3300006852 Bacteria 20482
130 Ga0075433_10099341 3300006852 Bacteria 2576
131 Ga0075434_100000404 3300006871 Bacteria 31777
132 Ga0075434_100043691 3300006871 Bacteria 4444
133 Ga0075434_100223751 3300006871 Bacteria 1901
134 Ga0075434_100337622 3300006871 Unclassified 1527
135 Ga0075434_100393588 3300006871 Bacteria 1406
136 Ga0075434_100435018 3300006871 Bacteria 1333
137 Ga0075429_100022735 3300006880 Bacteria 5436
138 Ga0075429_100080143 3300006880 Bacteria 2846
139 Ga0075429_100080595 3300006880 Bacteria 2838
140 Ga0075429_100154915 3300006880 Bacteria 2006
141 Ga0075429_100209229 3300006880 Bacteria 1709
142 Ga0075429_100245613 3300006880 Bacteria 1567
143 Ga0068865_100011487 3300006881 Bacteria 5548
144 Ga0075436_100000794 3300006914 Bacteria 20924
145 Ga0075436_100059172 3300006914 Bacteria 2647
146 Ga0075436_100062974 3300006914 Bacteria 2564
147 Ga0097620_100007912 3300006931 Bacteria 10781
148 Ga0097620_100039158 3300006931 Bacteria 4755
149 Ga0097620_100381609 3300006931 Unclassified 1504
150 Ga0075435_100002255 3300007076 Bacteria 12730
151 Ga0075435_100005866 3300007076 Bacteria 8644
152 Ga0075435_100011023 3300007076 Bacteria 6630
153 Ga0075435_100025455 3300007076 Bacteria 4607
154 Ga0099794_10005722 3300007265 Bacteria 5009
155 Ga0099795_10006587 3300007788 Bacteria 3180
156 Ga0111539_10009439 3300009094 Bacteria 12312
157 Ga0111539_10015922 3300009094 Bacteria 9340
158 Ga0111539_10019508 3300009094 Bacteria 8366
159 Ga0114129_10000541 3300009147 Bacteria 46363
160 Ga0114129_10002669 3300009147 Bacteria 24835
161 Ga0114129_10002813 3300009147 Bacteria 24271
162 Ga0114129_10007717 3300009147 Bacteria 15305
163 Ga0114129_10014072 3300009147 Bacteria 11399
164 Ga0114129_10561614 3300009147 Unclassified 1483
165 Ga0105248_10047162 3300009177 Bacteria 4831
166 Ga0105248_10260580 3300009177 Unclassified 1952
167 Ga0105249_10368311 3300009553 Unclassified 1460
168 Ga0105246_10018554 3300011119 Bacteria 4435
169 Ga0157373_10015577 3300013100 Bacteria 5557
170 Ga0157369_10010014 3300013105 Bacteria 10828
171 Ga0157374_10301409 3300013296 Unclassified 1585
172 Ga0163162_10647624 3300013306 Bacteria 1180
173 Ga0157372_10000646 3300013307 Bacteria 38275
174 Ga0157375_10166539 3300013308 Unclassified 2349
175 Ga0157375_10193589 3300013308 Unclassified 2188
176 Ga0157380_10059685 3300014326 Unclassified 3045
177 Ga0182008_10055546 3300014497 Bacteria 1958
178 Ga0157379_10121286 3300014968 Unclassified 2352
179 Ga0163161_10067426 3300017792 Bacteria 2614
180 Ga0163161_10275178 3300017792 Bacteria 1319
181 Ga0213875_10000755 3300021388 Bacteria 24416
182 Ga0213871_10005735 3300021441 Bacteria 2584
183 Ga0207653_10004309 3300025885 Bacteria 4469
184 Ga0207653_10009269 3300025885 Bacteria 3064
185 Ga0207688_10003821 3300025901 Bacteria 8215
186 Ga0207688_10023301 3300025901 Bacteria 3389
187 Ga0207680_10042300 3300025903 Bacteria 2664
188 Ga0207647_10047460 3300025904 Bacteria 2671
189 Ga0207699_10005641 3300025906 Bacteria 6007
190 Ga0207699_10144291 3300025906 Bacteria 1568
191 Ga0207645_10003896 3300025907 Bacteria 11157
192 Ga0207645_10010845 3300025907 Bacteria 6244
193 Ga0207643_10000355 3300025908 Bacteria 30699
194 Ga0207643_10009641 3300025908 Bacteria 5185
195 Ga0207684_10001301 3300025910 Bacteria 27465
196 Ga0207684_10014343 3300025910 Bacteria 6835
197 Ga0207684_10023833 3300025910 Bacteria 5222
198 Ga0207684_10025457 3300025910 Bacteria 5041
199 Ga0207684_10078372 3300025910 Bacteria 2810
200 Ga0207684_10110211 3300025910 Bacteria 2356
201 Ga0207654_10007146 3300025911 Bacteria 5622
202 Ga0207707_10000047 3300025912 Bacteria 118016
203 Ga0207707_10027568 3300025912 Bacteria 4967
204 Ga0207660_10048966 3300025917 Bacteria 2992
205 Ga0207662_10020651 3300025918 Bacteria 3759
206 Ga0207662_10180307 3300025918 Bacteria 1359
207 Ga0207657_10000021 3300025919 Bacteria 155900
208 Ga0207649_10021028 3300025920 Bacteria 3749
209 Ga0207652_10042855 3300025921 Bacteria 3853
210 Ga0207646_10001330 3300025922 Bacteria 30700
211 Ga0207646_10001785 3300025922 Bacteria 26056
212 Ga0207646_10010669 3300025922 Bacteria 8947
213 Ga0207646_10035268 3300025922 Bacteria 4518
214 Ga0207646_10056416 3300025922 Bacteria 3511
215 Ga0207681_10191395 3300025923 Unclassified 1565
216 Ga0207681_10297315 3300025923 Bacteria 1276
217 Ga0207650_10030625 3300025925 Bacteria 3877
218 Ga0207650_10109826 3300025925 Bacteria 2133
219 Ga0207700_10022663 3300025928 Bacteria 4313
220 Ga0207664_10006264 3300025929 Bacteria 8174
221 Ga0207690_10000789 3300025932 Bacteria 20419
222 Ga0207706_10016654 3300025933 Bacteria 6634
223 Ga0207709_10011171 3300025935 Bacteria 4953
224 Ga0207709_10166663 3300025935 Bacteria 1542
225 Ga0207670_10132762 3300025936 Unclassified 1826
226 Ga0207665_10000411 3300025939 Bacteria 29470
227 Ga0207665_10015550 3300025939 Bacteria 4993
228 Ga0207691_10023772 3300025940 Bacteria 5768
229 Ga0207689_10000697 3300025942 Bacteria 32204
230 Ga0207689_10032358 3300025942 Bacteria 4352
231 Ga0207689_10036916 3300025942 Bacteria 4055
232 Ga0207661_10080777 3300025944 Unclassified 2684
233 Ga0207679_10004712 3300025945 Bacteria 8491
234 Ga0207679_10028623 3300025945 Bacteria 3869
235 Ga0207679_10149787 3300025945 Bacteria 1897
236 Ga0207667_10000620 3300025949 Bacteria 45914
237 Ga0207651_10031312 3300025960 Bacteria 3398
238 Ga0207651_10058815 3300025960 Unclassified 2658
239 Ga0207640_10068509 3300025981 Unclassified 2378
240 Ga0207677_10133747 3300026023 Unclassified 1887
241 Ga0207703_10015250 3300026035 Bacteria 5995
242 Ga0207639_10042501 3300026041 Bacteria 3406
243 Ga0207678_10007778 3300026067 Bacteria 9469
244 Ga0207708_10020587 3300026075 Bacteria 4975
245 Ga0207708_10075760 3300026075 Unclassified 2580
246 Ga0207702_10009066 3300026078 Bacteria 8375
247 Ga0207702_10049264 3300026078 Bacteria 3555
248 Ga0207641_10018246 3300026088 Bacteria 5751
249 Ga0207641_10080235 3300026088 Bacteria 2830
250 Ga0207641_10223569 3300026088 Bacteria 1747
251 Ga0207641_10252234 3300026088 Unclassified 1648
252 Ga0207648_10001227 3300026089 Bacteria 28750
253 Ga0207648_10171913 3300026089 Bacteria 1915
254 Ga0207648_10337882 3300026089 Bacteria 1356
255 Ga0207676_10015486 3300026095 Bacteria 5501
256 Ga0207676_10021716 3300026095 Bacteria 4710
257 Ga0207676_10179947 3300026095 Bacteria 1850
258 Ga0207676_10232303 3300026095 Unclassified 1649
259 Ga0207674_10042446 3300026116 Bacteria 4697
260 Ga0207674_10112021 3300026116 Bacteria 2702
261 Ga0207674_10265887 3300026116 Unclassified 1662
262 Ga0207674_10293473 3300026116 Bacteria 1574
263 Ga0207675_100053855 3300026118 Unclassified 3753
264 Ga0207675_100064101 3300026118 Bacteria 3434
265 Ga0207675_100088331 3300026118 Unclassified 2911
266 Ga0207675_100153501 3300026118 Bacteria 2193
267 Ga0209588_1002397 3300027671 Bacteria 5075
268 Ga0207428_10000029 3300027907 Bacteria 241338
269 Ga0207428_10047823 3300027907 Bacteria 3434
270 Ga0207428_10181689 3300027907 Unclassified 1589
271 Ga0268265_10001200 3300028380 Bacteria 22559
272 Ga0268265_10048595 3300028380 Bacteria 3185
273 Ga0268264_10077096 3300028381 Bacteria 2838
274 Ga0265318_10011943 3300028577 Bacteria 3713
275 Ga0265330_10007808 3300031235 Bacteria 5192
276 Ga0265332_10002055 3300031238 Bacteria 10528
277 Ga0265328_10002786 3300031239 Bacteria 7823
278 Ga0265320_10093129 3300031240 Bacteria 1394
279 Ga0265331_10002356 3300031250 Bacteria 12840
280 Ga0265327_10062581 3300031251 Bacteria 1893
281 Ga0265314_10004077 3300031711 Bacteria 13784
282 Ga0265342_10024638 3300031712 Bacteria 3796
283 Ga0307410_10133934 3300031852 Bacteria 1824
284 Ga0307416_100065186 3300032002 Bacteria 2992
285 Ga0307411_10269011 3300032005 Bacteria 1350
286 Ga0373932_0026638 3300035112 Bacteria 1574
287 Ga0373939_0032179 3300035114 Unclassified 1522
288 Ga0373931_0036893 3300035691 Bacteria 2550
289 Ga0373931_0038100 3300035691 Bacteria 2513
290 Ga0373935_0108887 3300035692 Bacteria 1837
291 Ga0373927_0236361 3300035695 Bacteria 1201
292 Ga0395899_0035751 3300037312 Bacteria 3728
293 Ga0395900_0001429 3300037418 Bacteria 28495
294 Ga0395900_0036108 3300037418 Bacteria 5094
295 Ga0395898_0010686 3300037466 Bacteria 9590
296 Ga0436364_0572636 3300037853 Bacteria 21241
297 Ga0436364_1119186 3300037853 Bacteria 34885
298 Ga0436365_0015172 3300039437 Bacteria 3159
299 Ga0439448_0012291 3300042005 Unclassified 2560
300 Ga0439455_0003931 3300042012 Bacteria 2896
301 Ga0439455_0019613 3300042012 Bacteria 1596
302 Ga0450889_000713 3300042144 Bacteria 3588
303 Ga0439458_0016440 3300042157 Unclassified 1683
304 Ga0451577_0019760 3300042876 Bacteria 6190
305 Ga0451577_0102879 3300042876 Unclassified 2552
306 Ga0453683_0039465 3300044673 Bacteria 2967
307 Ga0453683_0059833 3300044673 Unclassified 2381
308 Ga0453684_0075215 3300044712 Bacteria 4246
309 Ga0451576_0011896 3300045051 Bacteria 9840
310 Ga0451576_0031213 3300045051 Bacteria 5683
311 Ga0451576_0179653 3300045051 Bacteria 2209
312 Ga0451576_0219726 3300045051 Bacteria 1984
313 Ga0495580_0004319 3300046472 Bacteria 11947
314 Ga0495580_0236133 3300046472 Unclassified 1254
315 Ga0495584_0125817 3300046491 Bacteria 1299
316 Ga0495621_0051369 3300046539 Bacteria 1475
317 Ga0495656_0125761 3300046615 Bacteria 1215
318 Ga0495669_0042868 3300046684 Bacteria 2013
319 Ga0495669_0108100 3300046684 Bacteria 1297
320 Ga0496101_0091987 3300048904 Bacteria 2258
321 Ga0496102_0132817 3300048905 Unclassified 2331
322 Ga0496104_0002880 3300048907 Bacteria 14829
323 Ga0496106_0035395 3300048909 Bacteria 3734
324 Ga0496106_0123371 3300048909 Bacteria 2027
325 Ga0496108_0031126 3300048911 Bacteria 4425
326 Ga0496112_0021385 3300048915 Bacteria 6152
327 Ga0496112_0152426 3300048915 Bacteria 2279
328 Ga0496112_0276040 3300048915 Bacteria 1628
329 Ga0496115_0009533 3300048918 Bacteria 7211
330 Ga0501036_0061832 3300049572 Bacteria 3172
331 Ga0501038_0339134 3300049574 Bacteria 1172
332 Ga0501039_0032330 3300049575 Bacteria 4033
333 Ga0501039_0065246 3300049575 Bacteria 2824
334 Ga0501040_0035157 3300049576 Bacteria 3397
335 Ga0501040_0040719 3300049576 Bacteria 3162
336 Ga0501040_0062505 3300049576 Bacteria 2562
337 Ga0501041_0002039 3300049577 Bacteria 11366
338 Ga0501041_0007275 3300049577 Bacteria 6499
339 Ga0501041_0007621 3300049577 Bacteria 6358
340 Ga0501042_0005859 3300049578 Bacteria 7942
341 Ga0501042_0031531 3300049578 Bacteria 3750
342 Ga0501048_0087573 3300049582 Bacteria 2197
343 Ga0501071_0029229 3300049587 Bacteria 3889
344 Ga0501072_0022676 3300049588 Bacteria 4871
345 Ga0501072_0137189 3300049588 Bacteria 1950
346 Ga0501074_0095914 3300049590 Bacteria 2124
347 Ga0501074_0146192 3300049590 Bacteria 1690
348 Ga0501075_0016369 3300049591 Bacteria 5340
349 Ga0501075_0027053 3300049591 Bacteria 4226
350 Ga0501076_0009780 3300049592 Bacteria 7083
351 Ga0501076_0087415 3300049592 Bacteria 2506
352 Ga0501076_0152525 3300049592 Unclassified 1880
353 Ga0501076_0343150 3300049592 Unclassified 1226
354 Ga0501077_0009909 3300049593 Bacteria 5931
355 Ga0501077_0091333 3300049593 Bacteria 1929
356 Ga0501077_0102128 3300049593 Unclassified 1817
357 Ga0501079_0037980 3300049741 Bacteria 3713
358 Ga0501079_0190773 3300049741 Bacteria 1599
359 Ga0501079_0194807 3300049741 Bacteria 1582
360 Ga0501080_0004563 3300049742 Bacteria 12345
361 Ga0501081_0003238 3300049743 Bacteria 10359
362 Ga0501081_0005929 3300049743 Bacteria 7909
363 Ga0501081_0122495 3300049743 Unclassified 1853
364 Ga0501045_0111664 3300049824 Bacteria 2027
365 nmdc:mga05p37_176721_c1 3300050507 Bacteria 2601
366 nmdc:mga05p37_24894_c1 3300050507 Bacteria 7276
367 nmdc:mga05p37_553055_c1 3300050507 Bacteria 1310
368 nmdc:mga05p37_702_c1 3300050507 Bacteria 37071
369 nmdc:mga05p37_783_c1 3300050507 Bacteria 35363
370 nmdc:mga09592_137611_c1 3300050508 Bacteria 2104
371 nmdc:mga09592_191560_c1 3300050508 Bacteria 1770
372 nmdc:mga09592_34341_c1 3300050508 Bacteria 4239
373 nmdc:mga09592_59845_c1 3300050508 Bacteria 3220
374 nmdc:mga09592_82157_c1 3300050508 Bacteria 2746
375 nmdc:mga0qj67_12482_c1 3300050509 Bacteria 6400
376 nmdc:mga0qj67_47603_c1 3300050509 Bacteria 3387
377 nmdc:mga06r32_113184_c1 3300050510 Bacteria 2671
378 nmdc:mga06r32_125770_c1 3300050510 Bacteria 2532
379 nmdc:mga06r32_1728_c1 3300050510 Bacteria 19662
380 nmdc:mga06r32_323913_c1 3300050510 Bacteria 1526
381 nmdc:mga06r32_386057_c1 3300050510 Bacteria 1383
382 nmdc:mga06r32_60577_c1 3300050510 Bacteria 3643
383 nmdc:mga08y16_101427_c1 3300050511 Bacteria 2996
384 nmdc:mga08y16_234214_c1 3300050511 Unclassified 1899
385 nmdc:mga08y16_41470_c1 3300050511 Bacteria 4822
386 nmdc:mga0n895_12089_c1 3300050512 Bacteria 7725
387 nmdc:mga0n895_128304_c1 3300050512 Bacteria 2561
388 nmdc:mga0n895_186_c1 3300050512 Bacteria 38327
389 nmdc:mga0n895_70286_c1 3300050512 Bacteria 3470
390 nmdc:mga0n895_78012_c1 3300050512 Bacteria 3296
391 nmdc:mga0n895_88813_c1 3300050512 Bacteria 3091
392 nmdc:mga0rr50_12991_c1 3300050513 Bacteria 5404
393 nmdc:mga0rr50_185653_c1 3300050513 Bacteria 1702
394 nmdc:mga0rr50_3380_c1 3300050513 Bacteria 9169
395 nmdc:mga0rr50_36764_c1 3300050513 Bacteria 3529
396 nmdc:mga0rr50_62496_c1 3300050513 Bacteria 2810
397 nmdc:mga0rr50_629_c1 3300050513 Bacteria 18926
398 nmdc:mga0rr50_6480_c1 3300050513 Bacteria 7131
399 nmdc:mga08x19_2032_c1 3300050514 Bacteria 12404
400 nmdc:mga08x19_36938_c1 3300050514 Bacteria 3097
401 nmdc:mga08x19_46701_c1 3300050514 Bacteria 2770
402 nmdc:mga08x19_74863_c1 3300050514 Bacteria 2213
403 nmdc:mga0a205_135223_c1 3300050515 Bacteria 2366
404 nmdc:mga0a205_14767_c1 3300050515 Bacteria 6873
405 nmdc:mga0a205_198_c1 3300050515 Bacteria 41752
406 nmdc:mga0a205_267202_c1 3300050515 Bacteria 1588
407 nmdc:mga0a205_276626_c1 3300050515 Bacteria 1555
408 nmdc:mga0a205_38164_c1 3300050515 Bacteria 4621
409 nmdc:mga0a205_4159_c1 3300050515 Bacteria 12967
410 nmdc:mga0a205_47992_c1 3300050515 Bacteria 4121
411 Ga0501084_0015963 3300054114 Bacteria 6232
412 Ga0501084_0023468 3300054114 Bacteria 5147
413 Ga0501084_0046368 3300054114 Bacteria 3641
414 Ga0501082_0005783 3300060353 Bacteria 10731
415 Ga0501082_0024317 3300060353 Bacteria 5222
416 Ga0501082_0167370 3300060353 Bacteria 1910
417 Ga0530510_0001170 3300061734 Bacteria 17428
418 Ga0530510_0001217 3300061734 Bacteria 17190
419 Ga0530510_0053222 3300061734 Bacteria 2926
420 Ga0530510_0123518 3300061734 Bacteria 1902
421 Ga0530510_0154579 3300061734 Bacteria 1695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10047460 Ga0207647_100474603 340
2 3300025936 Ga0207670_10132762 Ga0207670_101327622 340
3 3300045051 Ga0451576_0179653 Ga0451576_0179653_116_1141 340
4 3300050512 nmdc:mga0n895_128304_c1 nmdc:mga0n895_128304_c1_1431_2540 347
5 3300050513 nmdc:mga0rr50_185653_c1 nmdc:mga0rr50_185653_c1_148_1257 347
6 3300050513 nmdc:mga0rr50_62496_c1 nmdc:mga0rr50_62496_c1_956_2065 347
7 3300050514 nmdc:mga08x19_74863_c1 nmdc:mga08x19_74863_c1_217_1326 347
8 3300050515 nmdc:mga0a205_38164_c1 nmdc:mga0a205_38164_c1_1371_2480 347
9 3300026089 Ga0207648_10171913 Ga0207648_101719132 362
10 3300005459 Ga0068867_100092123 Ga0068867_1000921232 364
11 3300050511 nmdc:mga08y16_234214_c1 nmdc:mga08y16_234214_c1_513_1634 364
12 iso_pu_bacteria 2508501050 2508727510 364
13 iso_pu_bacteria 8045864390 8045867346 365
14 3300009177 Ga0105248_10260580 Ga0105248_102605803 367
15 3300005329 Ga0070683_100078017 Ga0070683_1000780173 368
16 3300005330 Ga0070690_100186085 Ga0070690_1001860852 368
17 3300005331 Ga0070670_100004645 Ga0070670_1000046452 368
18 3300005331 Ga0070670_100013818 Ga0070670_1000138182 368
19 3300005334 Ga0068869_100001452 Ga0068869_10000145212 368
20 3300005334 Ga0068869_100083798 Ga0068869_1000837981 368
21 3300005334 Ga0068869_100123458 Ga0068869_1001234582 368
22 3300005335 Ga0070666_10090322 Ga0070666_100903222 368
23 3300005336 Ga0070680_100011658 Ga0070680_1000116585 368
24 3300005337 Ga0070682_100002509 Ga0070682_1000025095 368
25 3300005339 Ga0070660_100016239 Ga0070660_1000162393 368
26 3300005340 Ga0070689_100027061 Ga0070689_1000270612 368
27 3300005341 Ga0070691_10003047 Ga0070691_100030474 368
28 3300005341 Ga0070691_10015614 Ga0070691_100156143 368
29 3300005344 Ga0070661_100023730 Ga0070661_1000237303 368
30 3300005345 Ga0070692_10002198 Ga0070692_100021982 368
31 3300005347 Ga0070668_100009121 Ga0070668_1000091214 368
32 3300005353 Ga0070669_100028792 Ga0070669_1000287921 368
33 3300005353 Ga0070669_100035470 Ga0070669_1000354703 368
34 3300005356 Ga0070674_100289102 Ga0070674_1002891022 368
35 3300005364 Ga0070673_100027608 Ga0070673_1000276083 368
36 3300005366 Ga0070659_100000377 Ga0070659_1000003775 368
37 3300005406 Ga0070703_10006396 Ga0070703_100063963 368
38 3300005438 Ga0070701_10006518 Ga0070701_100065185 368
39 3300005438 Ga0070701_10099002 Ga0070701_100990022 368
40 3300005440 Ga0070705_100009495 Ga0070705_1000094952 368
41 3300005441 Ga0070700_100020135 Ga0070700_1000201353 368
42 3300005444 Ga0070694_100032698 Ga0070694_1000326983 368
43 3300005445 Ga0070708_100014332 Ga0070708_1000143322 368
44 3300005445 Ga0070708_100037746 Ga0070708_1000377465 368
45 3300005445 Ga0070708_100200539 Ga0070708_1002005392 368
46 3300005455 Ga0070663_100001821 Ga0070663_1000018212 368
47 3300005456 Ga0070678_100023444 Ga0070678_1000234444 368
48 3300005456 Ga0070678_100057376 Ga0070678_1000573762 368
49 3300005457 Ga0070662_100007534 Ga0070662_1000075346 368
50 3300005458 Ga0070681_10078947 Ga0070681_100789473 368
51 3300005458 Ga0070681_10157715 Ga0070681_101577152 368
52 3300005459 Ga0068867_100003302 Ga0068867_10000330211 368
53 3300005459 Ga0068867_100014150 Ga0068867_1000141501 368
54 3300005467 Ga0070706_100127002 Ga0070706_1001270022 368
55 3300005467 Ga0070706_100363544 Ga0070706_1003635442 368
56 3300005468 Ga0070707_100016652 Ga0070707_1000166523 368
57 3300005468 Ga0070707_100019107 Ga0070707_1000191075 368
58 3300005468 Ga0070707_100114956 Ga0070707_1001149562 368
59 3300005471 Ga0070698_100001010 Ga0070698_1000010109 368
60 3300005471 Ga0070698_100057246 Ga0070698_1000572464 368
61 3300005471 Ga0070698_100065735 Ga0070698_1000657353 368
62 3300005518 Ga0070699_100002611 Ga0070699_10000261115 368
63 3300005530 Ga0070679_100021385 Ga0070679_1000213854 368
64 3300005536 Ga0070697_100030636 Ga0070697_1000306363 368
65 3300005536 Ga0070697_100151817 Ga0070697_1001518172 368
66 3300005539 Ga0068853_100012895 Ga0068853_1000128953 368
67 3300005543 Ga0070672_100033462 Ga0070672_1000334623 368
68 3300005545 Ga0070695_100002346 Ga0070695_1000023464 368
69 3300005545 Ga0070695_100040087 Ga0070695_1000400873 368
70 3300005546 Ga0070696_100002742 Ga0070696_1000027423 368
71 3300005546 Ga0070696_100047989 Ga0070696_1000479894 368
72 3300005547 Ga0070693_100000929 Ga0070693_1000009295 368
73 3300005547 Ga0070693_100129032 Ga0070693_1001290322 368
74 3300005548 Ga0070665_100008084 Ga0070665_1000080842 368
75 3300005549 Ga0070704_100006964 Ga0070704_1000069643 368
76 3300005549 Ga0070704_100024745 Ga0070704_1000247452 368
77 3300005549 Ga0070704_100050215 Ga0070704_1000502151 368
78 3300005563 Ga0068855_100006654 Ga0068855_10000665414 368
79 3300005564 Ga0070664_100160066 Ga0070664_1001600662 368
80 3300005564 Ga0070664_100218588 Ga0070664_1002185882 368
81 3300005564 Ga0070664_100243031 Ga0070664_1002430312 368
82 3300005577 Ga0068857_100048685 Ga0068857_1000486853 368
83 3300005578 Ga0068854_100008989 Ga0068854_1000089893 368
84 3300005614 Ga0068856_100001687 Ga0068856_1000016878 368
85 3300005616 Ga0068852_100093674 Ga0068852_1000936742 368
86 3300005617 Ga0068859_100007912 Ga0068859_1000079128 368
87 3300005617 Ga0068859_100381636 Ga0068859_1003816362 368
88 3300005618 Ga0068864_100015072 Ga0068864_1000150722 368
89 3300005718 Ga0068866_10002306 Ga0068866_100023062 368
90 3300005719 Ga0068861_100054895 Ga0068861_1000548952 368
91 3300005840 Ga0068870_10001427 Ga0068870_100014276 368
92 3300005840 Ga0068870_10015890 Ga0068870_100158901 368
93 3300005841 Ga0068863_100051268 Ga0068863_1000512684 368
94 3300005841 Ga0068863_100274804 Ga0068863_1002748042 368
95 3300005842 Ga0068858_100016518 Ga0068858_1000165182 368
96 3300005842 Ga0068858_100042880 Ga0068858_1000428805 368
97 3300005843 Ga0068860_100035345 Ga0068860_1000353455 368
98 3300005844 Ga0068862_100016348 Ga0068862_1000163482 368
99 3300005844 Ga0068862_100018122 Ga0068862_1000181224 368
100 3300006237 Ga0097621_100033667 Ga0097621_1000336671 368
101 3300006358 Ga0068871_100062440 Ga0068871_1000624402 368
102 3300006852 Ga0075433_10099341 Ga0075433_100993411 368
103 3300006871 Ga0075434_100223751 Ga0075434_1002237512 368
104 3300006871 Ga0075434_100337622 Ga0075434_1003376221 368
105 3300006881 Ga0068865_100011487 Ga0068865_1000114873 368
106 3300006931 Ga0097620_100007912 Ga0097620_1000079125 368
107 3300006931 Ga0097620_100381609 Ga0097620_1003816091 368
108 3300007265 Ga0099794_10005722 Ga0099794_100057222 368
109 3300009177 Ga0105248_10047162 Ga0105248_100471623 368
110 3300009553 Ga0105249_10368311 Ga0105249_103683112 368
111 3300011119 Ga0105246_10018554 Ga0105246_100185543 368
112 3300013100 Ga0157373_10015577 Ga0157373_100155772 368
113 3300013105 Ga0157369_10010014 Ga0157369_100100146 368
114 3300013296 Ga0157374_10301409 Ga0157374_103014092 368
115 3300013307 Ga0157372_10000646 Ga0157372_1000064611 368
116 3300013308 Ga0157375_10166539 Ga0157375_101665392 368
117 3300013308 Ga0157375_10193589 Ga0157375_101935892 368
118 3300014326 Ga0157380_10059685 Ga0157380_100596853 368
119 3300014968 Ga0157379_10121286 Ga0157379_101212862 368
120 3300017792 Ga0163161_10067426 Ga0163161_100674262 368
121 3300021441 Ga0213871_10005735 Ga0213871_100057352 368
122 3300025885 Ga0207653_10004309 Ga0207653_100043092 368
123 3300025885 Ga0207653_10009269 Ga0207653_100092692 368
124 3300025901 Ga0207688_10003821 Ga0207688_100038217 368
125 3300025901 Ga0207688_10023301 Ga0207688_100233013 368
126 3300025903 Ga0207680_10042300 Ga0207680_100423002 368
127 3300025906 Ga0207699_10144291 Ga0207699_101442912 368
128 3300025907 Ga0207645_10003896 Ga0207645_100038966 368
129 3300025907 Ga0207645_10010845 Ga0207645_100108452 368
130 3300025908 Ga0207643_10000355 Ga0207643_100003552 368
131 3300025908 Ga0207643_10009641 Ga0207643_100096413 368
132 3300025910 Ga0207684_10023833 Ga0207684_100238333 368
133 3300025910 Ga0207684_10025457 Ga0207684_100254573 368
134 3300025910 Ga0207684_10078372 Ga0207684_100783722 368
135 3300025910 Ga0207684_10110211 Ga0207684_101102112 368
136 3300025911 Ga0207654_10007146 Ga0207654_100071464 368
137 3300025912 Ga0207707_10000047 Ga0207707_10000047124 368
138 3300025917 Ga0207660_10048966 Ga0207660_100489663 368
139 3300025918 Ga0207662_10020651 Ga0207662_100206512 368
140 3300025919 Ga0207657_10000021 Ga0207657_100000218 368
141 3300025920 Ga0207649_10021028 Ga0207649_100210282 368
142 3300025921 Ga0207652_10042855 Ga0207652_100428553 368
143 3300025922 Ga0207646_10001785 Ga0207646_1000178521 368
144 3300025922 Ga0207646_10035268 Ga0207646_100352685 368
145 3300025923 Ga0207681_10191395 Ga0207681_101913952 368
146 3300025925 Ga0207650_10030625 Ga0207650_100306253 368
147 3300025925 Ga0207650_10109826 Ga0207650_101098262 368
148 3300025932 Ga0207690_10000789 Ga0207690_1000078918 368
149 3300025933 Ga0207706_10016654 Ga0207706_100166542 368
150 3300025935 Ga0207709_10011171 Ga0207709_100111712 368
151 3300025939 Ga0207665_10000411 Ga0207665_1000041133 368
152 3300025942 Ga0207689_10000697 Ga0207689_100006976 368
153 3300025942 Ga0207689_10032358 Ga0207689_100323581 368
154 3300025942 Ga0207689_10036916 Ga0207689_100369164 368
155 3300025944 Ga0207661_10080777 Ga0207661_100807772 368
156 3300025945 Ga0207679_10004712 Ga0207679_100047129 368
157 3300025945 Ga0207679_10149787 Ga0207679_101497872 368
158 3300025949 Ga0207667_10000620 Ga0207667_1000062015 368
159 3300025960 Ga0207651_10031312 Ga0207651_100313122 368
160 3300025960 Ga0207651_10058815 Ga0207651_100588153 368
161 3300025981 Ga0207640_10068509 Ga0207640_100685092 368
162 3300026023 Ga0207677_10133747 Ga0207677_101337472 368
163 3300026035 Ga0207703_10015250 Ga0207703_100152505 368
164 3300026041 Ga0207639_10042501 Ga0207639_100425013 368
165 3300026067 Ga0207678_10007778 Ga0207678_100077784 368
166 3300026075 Ga0207708_10020587 Ga0207708_100205872 368
167 3300026075 Ga0207708_10075760 Ga0207708_100757602 368
168 3300026078 Ga0207702_10009066 Ga0207702_100090662 368
169 3300026088 Ga0207641_10018246 Ga0207641_100182461 368
170 3300026088 Ga0207641_10080235 Ga0207641_100802354 368
171 3300026088 Ga0207641_10252234 Ga0207641_102522341 368
172 3300026089 Ga0207648_10001227 Ga0207648_1000122718 368
173 3300026095 Ga0207676_10015486 Ga0207676_100154862 368
174 3300026095 Ga0207676_10021716 Ga0207676_100217161 368
175 3300026095 Ga0207676_10232303 Ga0207676_102323032 368
176 3300026116 Ga0207674_10112021 Ga0207674_101120213 368
177 3300026116 Ga0207674_10265887 Ga0207674_102658872 368
178 3300026116 Ga0207674_10293473 Ga0207674_102934732 368
179 3300026118 Ga0207675_100053855 Ga0207675_1000538552 368
180 3300026118 Ga0207675_100064101 Ga0207675_1000641013 368
181 3300026118 Ga0207675_100088331 Ga0207675_1000883313 368
182 3300027671 Ga0209588_1002397 Ga0209588_10023975 368
183 3300028380 Ga0268265_10001200 Ga0268265_1000120019 368
184 3300028577 Ga0265318_10011943 Ga0265318_100119434 368
185 3300031235 Ga0265330_10007808 Ga0265330_100078085 368
186 3300031238 Ga0265332_10002055 Ga0265332_100020552 368
187 3300031239 Ga0265328_10002786 Ga0265328_100027862 368
188 3300031240 Ga0265320_10093129 Ga0265320_100931291 368
189 3300031250 Ga0265331_10002356 Ga0265331_100023562 368
190 3300031251 Ga0265327_10062581 Ga0265327_100625812 368
191 3300031711 Ga0265314_10004077 Ga0265314_100040778 368
192 3300031712 Ga0265342_10024638 Ga0265342_100246385 368
193 3300042005 Ga0439448_0012291 Ga0439448_0012291_284_1393 368
194 3300042012 Ga0439455_0003931 Ga0439455_0003931_1718_2827 368
195 3300042144 Ga0450889_000713 Ga0450889_000713_2411_3520 368
196 3300042157 Ga0439458_0016440 Ga0439458_0016440_38_1147 368
197 3300042876 Ga0451577_0019760 Ga0451577_0019760_325_1434 368
198 3300042876 Ga0451577_0102879 Ga0451577_0102879_921_2030 368
199 3300044673 Ga0453683_0039465 Ga0453683_0039465_504_1613 368
200 3300044712 Ga0453684_0075215 Ga0453684_0075215_2339_3448 368
201 3300045051 Ga0451576_0011896 Ga0451576_0011896_3540_4649 368
202 3300045051 Ga0451576_0031213 Ga0451576_0031213_1582_2691 368
203 3300046472 Ga0495580_0236133 Ga0495580_0236133_62_1171 368
204 3300046491 Ga0495584_0125817 Ga0495584_0125817_129_1238 368
205 3300048905 Ga0496102_0132817 Ga0496102_0132817_939_2048 368
206 3300048909 Ga0496106_0035395 Ga0496106_0035395_81_1190 368
207 3300049592 Ga0501076_0087415 Ga0501076_0087415_30_1139 368
208 3300050512 nmdc:mga0n895_70286_c1 nmdc:mga0n895_70286_c1_1339_2448 368
209 3300050515 nmdc:mga0a205_47992_c1 nmdc:mga0a205_47992_c1_2881_3990 368
210 3300061734 Ga0530510_0123518 Ga0530510_0123518_777_1886 368
211 3300061734 Ga0530510_0154579 Ga0530510_0154579_204_1310 368
212 3300005365 Ga0070688_100061009 Ga0070688_1000610092 369
213 3300005436 Ga0070713_100056037 Ga0070713_1000560372 369
214 3300005438 Ga0070701_10014965 Ga0070701_100149652 369
215 3300005445 Ga0070708_100047472 Ga0070708_1000474723 369
216 3300005445 Ga0070708_100066444 Ga0070708_1000664442 369
217 3300005445 Ga0070708_100140076 Ga0070708_1001400763 369
218 3300005458 Ga0070681_10021724 Ga0070681_100217243 369
219 3300005467 Ga0070706_100013791 Ga0070706_1000137912 369
220 3300005467 Ga0070706_100049412 Ga0070706_1000494125 369
221 3300005467 Ga0070706_100190304 Ga0070706_1001903042 369
222 3300005468 Ga0070707_100002180 Ga0070707_1000021808 369
223 3300005468 Ga0070707_100059173 Ga0070707_1000591732 369
224 3300005468 Ga0070707_100146863 Ga0070707_1001468632 369
225 3300005471 Ga0070698_100095682 Ga0070698_1000956824 369
226 3300005536 Ga0070697_100028318 Ga0070697_1000283182 369
227 3300005536 Ga0070697_100043773 Ga0070697_1000437731 369
228 3300005544 Ga0070686_100054527 Ga0070686_1000545272 369
229 3300005577 Ga0068857_100033329 Ga0068857_1000333292 369
230 3300005614 Ga0068856_100128838 Ga0068856_1001288382 369
231 3300005617 Ga0068859_100039159 Ga0068859_1000391593 369
232 3300005841 Ga0068863_100164786 Ga0068863_1001647862 369
233 3300005843 Ga0068860_100013265 Ga0068860_1000132656 369
234 3300005844 Ga0068862_100013621 Ga0068862_1000136214 369
235 3300005844 Ga0068862_100223302 Ga0068862_1002233021 369
236 3300005985 Ga0081539_10066305 Ga0081539_100663052 369
237 3300006028 Ga0070717_10107012 Ga0070717_101070122 369
238 3300006844 Ga0075428_100019877 Ga0075428_1000198777 369
239 3300006844 Ga0075428_100364531 Ga0075428_1003645311 369
240 3300006846 Ga0075430_100001918 Ga0075430_1000019187 369
241 3300006847 Ga0075431_100006917 Ga0075431_1000069177 369
242 3300006847 Ga0075431_100012693 Ga0075431_1000126934 369
243 3300006847 Ga0075431_100087885 Ga0075431_1000878852 369
244 3300006847 Ga0075431_100126719 Ga0075431_1001267192 369
245 3300006847 Ga0075431_100388185 Ga0075431_1003881852 369
246 3300006852 Ga0075433_10000319 Ga0075433_1000031910 369
247 3300006871 Ga0075434_100000404 Ga0075434_1000004049 369
248 3300006871 Ga0075434_100393588 Ga0075434_1003935881 369
249 3300006871 Ga0075434_100435018 Ga0075434_1004350181 369
250 3300006880 Ga0075429_100022735 Ga0075429_1000227355 369
251 3300006880 Ga0075429_100080143 Ga0075429_1000801432 369
252 3300006880 Ga0075429_100080595 Ga0075429_1000805953 369
253 3300006880 Ga0075429_100154915 Ga0075429_1001549152 369
254 3300006880 Ga0075429_100209229 Ga0075429_1002092291 369
255 3300006914 Ga0075436_100059172 Ga0075436_1000591722 369
256 3300006914 Ga0075436_100062974 Ga0075436_1000629743 369
257 3300006931 Ga0097620_100039158 Ga0097620_1000391583 369
258 3300007076 Ga0075435_100011023 Ga0075435_1000110233 369
259 3300007076 Ga0075435_100025455 Ga0075435_1000254554 369
260 3300007788 Ga0099795_10006587 Ga0099795_100065871 369
261 3300009094 Ga0111539_10009439 Ga0111539_100094395 369
262 3300009094 Ga0111539_10015922 Ga0111539_100159229 369
263 3300009094 Ga0111539_10019508 Ga0111539_1001950810 369
264 3300009147 Ga0114129_10002669 Ga0114129_1000266919 369
265 3300009147 Ga0114129_10002813 Ga0114129_100028136 369
266 3300009147 Ga0114129_10014072 Ga0114129_100140725 369
267 3300009147 Ga0114129_10561614 Ga0114129_105616141 369
268 3300013306 Ga0163162_10647624 Ga0163162_106476241 369
269 3300014497 Ga0182008_10055546 Ga0182008_100555462 369
270 3300017792 Ga0163161_10275178 Ga0163161_102751781 369
271 3300025906 Ga0207699_10005641 Ga0207699_100056417 369
272 3300025910 Ga0207684_10001301 Ga0207684_1000130110 369
273 3300025910 Ga0207684_10014343 Ga0207684_100143436 369
274 3300025912 Ga0207707_10027568 Ga0207707_100275683 369
275 3300025918 Ga0207662_10180307 Ga0207662_101803071 369
276 3300025922 Ga0207646_10001330 Ga0207646_1000133021 369
277 3300025922 Ga0207646_10010669 Ga0207646_100106695 369
278 3300025922 Ga0207646_10056416 Ga0207646_100564163 369
279 3300025923 Ga0207681_10297315 Ga0207681_102973151 369
280 3300025928 Ga0207700_10022663 Ga0207700_100226633 369
281 3300025929 Ga0207664_10006264 Ga0207664_100062646 369
282 3300025935 Ga0207709_10166663 Ga0207709_101666632 369
283 3300025939 Ga0207665_10015550 Ga0207665_100155503 369
284 3300025940 Ga0207691_10023772 Ga0207691_100237724 369
285 3300025945 Ga0207679_10028623 Ga0207679_100286232 369
286 3300026078 Ga0207702_10049264 Ga0207702_100492643 369
287 3300026088 Ga0207641_10223569 Ga0207641_102235692 369
288 3300026089 Ga0207648_10337882 Ga0207648_103378821 369
289 3300026095 Ga0207676_10179947 Ga0207676_101799472 369
290 3300026116 Ga0207674_10042446 Ga0207674_100424464 369
291 3300026118 Ga0207675_100153501 Ga0207675_1001535012 369
292 3300027907 Ga0207428_10000029 Ga0207428_1000002949 369
293 3300027907 Ga0207428_10047823 Ga0207428_100478232 369
294 3300027907 Ga0207428_10181689 Ga0207428_101816892 369
295 3300028380 Ga0268265_10048595 Ga0268265_100485953 369
296 3300028381 Ga0268264_10077096 Ga0268264_100770962 369
297 3300031852 Ga0307410_10133934 Ga0307410_101339341 369
298 3300032002 Ga0307416_100065186 Ga0307416_1000651863 369
299 3300032005 Ga0307411_10269011 Ga0307411_102690112 369
300 3300035114 Ga0373939_0032179 Ga0373939_0032179_334_1443 369
301 3300035691 Ga0373931_0036893 Ga0373931_0036893_1207_2325 369
302 3300035691 Ga0373931_0038100 Ga0373931_0038100_774_1883 369
303 3300035692 Ga0373935_0108887 Ga0373935_0108887_221_1333 369
304 3300035695 Ga0373927_0236361 Ga0373927_0236361_81_1190 369
305 3300037312 Ga0395899_0035751 Ga0395899_0035751_729_1838 369
306 3300037418 Ga0395900_0001429 Ga0395900_0001429_127_1236 369
307 3300037418 Ga0395900_0036108 Ga0395900_0036108_671_1780 369
308 3300037466 Ga0395898_0010686 Ga0395898_0010686_6504_7613 369
309 3300037853 Ga0436364_0572636 Ga0436364_0572636_194_1309 369
310 3300037853 Ga0436364_1119186 Ga0436364_1119186_2002_3111 369
311 3300039437 Ga0436365_0015172 Ga0436365_0015172_1155_2267 369
312 3300042012 Ga0439455_0019613 Ga0439455_0019613_388_1500 369
313 3300044673 Ga0453683_0059833 Ga0453683_0059833_34_1143 369
314 3300045051 Ga0451576_0219726 Ga0451576_0219726_753_1862 369
315 3300046472 Ga0495580_0004319 Ga0495580_0004319_7567_8676 369
316 3300046615 Ga0495656_0125761 Ga0495656_0125761_68_1177 369
317 3300046684 Ga0495669_0042868 Ga0495669_0042868_179_1288 369
318 3300046684 Ga0495669_0108100 Ga0495669_0108100_156_1265 369
319 3300048909 Ga0496106_0123371 Ga0496106_0123371_727_1836 369
320 3300048911 Ga0496108_0031126 Ga0496108_0031126_3182_4291 369
321 3300048915 Ga0496112_0021385 Ga0496112_0021385_2878_3990 369
322 3300048915 Ga0496112_0152426 Ga0496112_0152426_607_1716 369
323 3300049574 Ga0501038_0339134 Ga0501038_0339134_24_1139 369
324 3300049575 Ga0501039_0032330 Ga0501039_0032330_1982_3094 369
325 3300049575 Ga0501039_0065246 Ga0501039_0065246_1062_2177 369
326 3300049576 Ga0501040_0035157 Ga0501040_0035157_1369_2478 369
327 3300049576 Ga0501040_0040719 Ga0501040_0040719_358_1470 369
328 3300049577 Ga0501041_0002039 Ga0501041_0002039_1272_2384 369
329 3300049577 Ga0501041_0007275 Ga0501041_0007275_4195_5310 369
330 3300049578 Ga0501042_0005859 Ga0501042_0005859_4240_5352 369
331 3300049578 Ga0501042_0031531 Ga0501042_0031531_683_1798 369
332 3300049582 Ga0501048_0087573 Ga0501048_0087573_400_1515 369
333 3300049587 Ga0501071_0029229 Ga0501071_0029229_433_1548 369
334 3300049588 Ga0501072_0022676 Ga0501072_0022676_365_1480 369
335 3300049588 Ga0501072_0137189 Ga0501072_0137189_74_1189 369
336 3300049590 Ga0501074_0095914 Ga0501074_0095914_884_1999 369
337 3300049590 Ga0501074_0146192 Ga0501074_0146192_556_1668 369
338 3300049591 Ga0501075_0027053 Ga0501075_0027053_324_1439 369
339 3300049592 Ga0501076_0009780 Ga0501076_0009780_1777_2892 369
340 3300049592 Ga0501076_0343150 Ga0501076_0343150_41_1156 369
341 3300049593 Ga0501077_0009909 Ga0501077_0009909_1457_2572 369
342 3300049741 Ga0501079_0037980 Ga0501079_0037980_297_1409 369
343 3300049741 Ga0501079_0190773 Ga0501079_0190773_414_1529 369
344 3300049742 Ga0501080_0004563 Ga0501080_0004563_4777_5889 369
345 3300049743 Ga0501081_0003238 Ga0501081_0003238_4028_5140 369
346 3300049743 Ga0501081_0005929 Ga0501081_0005929_2109_3224 369
347 3300050507 nmdc:mga05p37_176721_c1 nmdc:mga05p37_176721_c1_272_1381 369
348 3300050507 nmdc:mga05p37_553055_c1 nmdc:mga05p37_553055_c1_114_1223 369
349 3300050507 nmdc:mga05p37_783_c1 nmdc:mga05p37_783_c1_25576_26691 369
350 3300050508 nmdc:mga09592_137611_c1 nmdc:mga09592_137611_c1_456_1565 369
351 3300050508 nmdc:mga09592_191560_c1 nmdc:mga09592_191560_c1_191_1300 369
352 3300050508 nmdc:mga09592_59845_c1 nmdc:mga09592_59845_c1_1020_2129 369
353 3300050508 nmdc:mga09592_82157_c1 nmdc:mga09592_82157_c1_1097_2206 369
354 3300050509 nmdc:mga0qj67_12482_c1 nmdc:mga0qj67_12482_c1_620_1729 369
355 3300050509 nmdc:mga0qj67_47603_c1 nmdc:mga0qj67_47603_c1_1053_2162 369
356 3300050510 nmdc:mga06r32_113184_c1 nmdc:mga06r32_113184_c1_602_1711 369
357 3300050510 nmdc:mga06r32_1728_c1 nmdc:mga06r32_1728_c1_5229_6344 369
358 3300050510 nmdc:mga06r32_323913_c1 nmdc:mga06r32_323913_c1_344_1453 369
359 3300050510 nmdc:mga06r32_386057_c1 nmdc:mga06r32_386057_c1_28_1137 369
360 3300050510 nmdc:mga06r32_60577_c1 nmdc:mga06r32_60577_c1_1054_2163 369
361 3300050511 nmdc:mga08y16_101427_c1 nmdc:mga08y16_101427_c1_211_1320 369
362 3300050511 nmdc:mga08y16_41470_c1 nmdc:mga08y16_41470_c1_2160_3269 369
363 3300050512 nmdc:mga0n895_12089_c1 nmdc:mga0n895_12089_c1_678_1787 369
364 3300050512 nmdc:mga0n895_78012_c1 nmdc:mga0n895_78012_c1_1335_2444 369
365 3300050513 nmdc:mga0rr50_3380_c1 nmdc:mga0rr50_3380_c1_1738_2847 369
366 3300050513 nmdc:mga0rr50_36764_c1 nmdc:mga0rr50_36764_c1_959_2068 369
367 3300050513 nmdc:mga0rr50_6480_c1 nmdc:mga0rr50_6480_c1_2152_3261 369
368 3300050514 nmdc:mga08x19_36938_c1 nmdc:mga08x19_36938_c1_1869_2981 369
369 3300050514 nmdc:mga08x19_46701_c1 nmdc:mga08x19_46701_c1_408_1517 369
370 3300050515 nmdc:mga0a205_135223_c1 nmdc:mga0a205_135223_c1_597_1706 369
371 3300050515 nmdc:mga0a205_14767_c1 nmdc:mga0a205_14767_c1_519_1628 369
372 3300050515 nmdc:mga0a205_198_c1 nmdc:mga0a205_198_c1_19570_20679 369
373 3300050515 nmdc:mga0a205_267202_c1 nmdc:mga0a205_267202_c1_410_1519 369
374 3300054114 Ga0501084_0015963 Ga0501084_0015963_3835_4950 369
375 3300054114 Ga0501084_0046368 Ga0501084_0046368_2451_3563 369
376 3300060353 Ga0501082_0024317 Ga0501082_0024317_1409_2521 369
377 3300060353 Ga0501082_0167370 Ga0501082_0167370_92_1207 369
378 3300061734 Ga0530510_0053222 Ga0530510_0053222_226_1341 369
379 3300003203 JGI25406J46586_10016315 JGI25406J46586_100163152 371
380 3300005471 Ga0070698_100004229 Ga0070698_1000042292 371
381 3300005518 Ga0070699_100008788 Ga0070699_10000878812 371
382 3300005985 Ga0081539_10000020 Ga0081539_10000020277 371
383 3300006847 Ga0075431_100069245 Ga0075431_1000692456 371
384 3300006852 Ga0075433_10000948 Ga0075433_100009484 371
385 3300006871 Ga0075434_100043691 Ga0075434_1000436913 371
386 3300006880 Ga0075429_100245613 Ga0075429_1002456132 371
387 3300006914 Ga0075436_100000794 Ga0075436_10000079419 371
388 3300007076 Ga0075435_100002255 Ga0075435_10000225511 371
389 3300007076 Ga0075435_100005866 Ga0075435_1000058663 371
390 3300009147 Ga0114129_10000541 Ga0114129_1000054147 371
391 3300009147 Ga0114129_10007717 Ga0114129_100077178 371
392 3300021388 Ga0213875_10000755 Ga0213875_1000075520 371
393 3300035112 Ga0373932_0026638 Ga0373932_0026638_277_1536 371
394 3300046539 Ga0495621_0051369 Ga0495621_0051369_84_1442 371
395 3300048904 Ga0496101_0091987 Ga0496101_0091987_1034_2164 371
396 3300048907 Ga0496104_0002880 Ga0496104_0002880_5513_6643 371
397 3300048915 Ga0496112_0276040 Ga0496112_0276040_30_1160 371
398 3300048918 Ga0496115_0009533 Ga0496115_0009533_1809_2939 371
399 3300049572 Ga0501036_0061832 Ga0501036_0061832_1924_3048 371
400 3300049576 Ga0501040_0062505 Ga0501040_0062505_587_1711 371
401 3300049577 Ga0501041_0007621 Ga0501041_0007621_3294_4418 371
402 3300049591 Ga0501075_0016369 Ga0501075_0016369_2469_3593 371
403 3300049592 Ga0501076_0152525 Ga0501076_0152525_263_1387 371
404 3300049593 Ga0501077_0091333 Ga0501077_0091333_165_1340 371
405 3300049593 Ga0501077_0102128 Ga0501077_0102128_616_1740 371
406 3300049741 Ga0501079_0194807 Ga0501079_0194807_350_1474 371
407 3300049743 Ga0501081_0122495 Ga0501081_0122495_31_1155 371
408 3300049824 Ga0501045_0111664 Ga0501045_0111664_380_1504 371
409 3300050507 nmdc:mga05p37_24894_c1 nmdc:mga05p37_24894_c1_1029_2144 371
410 3300050507 nmdc:mga05p37_702_c1 nmdc:mga05p37_702_c1_18736_19851 371
411 3300050508 nmdc:mga09592_34341_c1 nmdc:mga09592_34341_c1_3033_4148 371
412 3300050510 nmdc:mga06r32_125770_c1 nmdc:mga06r32_125770_c1_262_1377 371
413 3300050512 nmdc:mga0n895_186_c1 nmdc:mga0n895_186_c1_29850_30965 371
414 3300050512 nmdc:mga0n895_88813_c1 nmdc:mga0n895_88813_c1_1271_2386 371
415 3300050513 nmdc:mga0rr50_12991_c1 nmdc:mga0rr50_12991_c1_3303_4496 371
416 3300050513 nmdc:mga0rr50_629_c1 nmdc:mga0rr50_629_c1_1086_2201 371
417 3300050514 nmdc:mga08x19_2032_c1 nmdc:mga08x19_2032_c1_8734_9849 371
418 3300050515 nmdc:mga0a205_276626_c1 nmdc:mga0a205_276626_c1_287_1402 371
419 3300050515 nmdc:mga0a205_4159_c1 nmdc:mga0a205_4159_c1_9158_10273 371
420 3300054114 Ga0501084_0023468 Ga0501084_0023468_1616_2740 371
421 3300060353 Ga0501082_0005783 Ga0501082_0005783_1310_2434 371
422 3300061734 Ga0530510_0001170 Ga0530510_0001170_12746_13870 371
423 3300061734 Ga0530510_0001217 Ga0530510_0001217_1862_2986 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

1

85

0.98

PF13378

MR_MLE_C

Enolase C-terminal domain-like

232

445

0.95

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

88

209

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h83-assembly1.cif.gz_E crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9656 4 371
4h83-assembly1.cif.gz_A crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9643 4 370
3no1-assembly1.cif.gz_C crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium 0.9642 4 371
4h83-assembly1.cif.gz_F crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9631 4 371
4h83-assembly3.cif.gz_C crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9625 4 371
ID Description Score Start End Superfamily
3no1D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9522 124 361 3.20.20.120
3no1D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9402 124 361 3.20.20.120
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9345 124 361 3.20.20.120
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9233 122 361 3.20.20.120
5xd9A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9215 122 361 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A2V6VDW9-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9805 168 370 GO:0000287
GO:0016052
GO:0016836
AF-A0A2V6VDW9-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9758 168 370 GO:0000287
GO:0016052
GO:0016836
AF-A0A2E6Z135-F1-model_v4 Mandelate racemase 0.9746 4 371 GO:0000287
GO:0016052
GO:0016836
AF-A0A2V2SJ55-F1-model_v4 deleted 0.9741 31 371
AF-A0A2W6B1A8-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9725 136 371 GO:0000287
GO:0009063
GO:0016052
GO:0016836

Feature Viewer

pLDDT pTM Quality
92.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map