F440671

General Info

Members Datasets Scaffolds Average Seq Length
424 218 848 260

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10019045|Ga0070658_100190457
Length 301
Sequence MNGIAFLRSGSRWLLVTAGEYGACLRTLCLFPIIRALYRRLTLNSVVCIAQVPDTETRIKIGGDGRHIDETGVKYIVSPYDEYALEEAIRLKEKQGGDVTVLGFGPDRVQQALRESLARGATKALHIKGESADADSLGIAKVLAAAIKTLSHDLVFFGKQGVGTDNSLVGPMVAELLGYPQVNVVTHLEAGDGKVTAHREIEGAEEIIEASTPAVITAQKGLNEPRYASLKGIMAAKKITIDTKSIADLGLSDSDIVNQRVTVVALALPPEKSGGRKIDGADPQAAAKEIVRYIKEEAKAL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.36
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10019045 3300005327 Bacteria 5498
2 Ga0065707_10093593 3300005295 Bacteria 3605
3 Ga0070683_100000109 3300005329 Bacteria 54186
4 Ga0070683_100131164 3300005329 Bacteria 2372
5 Ga0070690_100160834 3300005330 Bacteria 1539
6 Ga0070670_100000143 3300005331 Bacteria 66979
7 Ga0068869_100020790 3300005334 Bacteria 4506
8 Ga0068869_100497702 3300005334 Bacteria 1017
9 Ga0070666_10000683 3300005335 Bacteria 20555
10 Ga0070680_100213303 3300005336 Bacteria 1629
11 Ga0070682_100000015 3300005337 Bacteria 249390
12 Ga0068868_100000038 3300005338 Bacteria 71746
13 Ga0068868_100000813 3300005338 Bacteria 21171
14 Ga0070689_100001260 3300005340 Bacteria 16093
15 Ga0070689_100002312 3300005340 Bacteria 12404
16 Ga0070687_100095522 3300005343 Bacteria 1653
17 Ga0070661_100316191 3300005344 Bacteria 1218
18 Ga0070692_10014351 3300005345 Bacteria 3720
19 Ga0070669_100064237 3300005353 Bacteria 2703
20 Ga0070675_100683930 3300005354 Bacteria 934
21 Ga0070671_100041822 3300005355 Bacteria 3809
22 Ga0070674_100662587 3300005356 Unclassified 888
23 Ga0070673_100002970 3300005364 Bacteria 10463
24 Ga0070673_100044562 3300005364 Bacteria 3436
25 Ga0070667_100005116 3300005367 Bacteria 10975
26 Ga0070709_10240085 3300005434 Unclassified 1301
27 Ga0070713_100040439 3300005436 Bacteria 3790
28 Ga0070701_10000213 3300005438 Bacteria 18202
29 Ga0070701_10012820 3300005438 Bacteria 3792
30 Ga0070711_100012306 3300005439 Bacteria 5338
31 Ga0070694_100220936 3300005444 Bacteria 1421
32 Ga0070708_100008723 3300005445 Bacteria 8147
33 Ga0070708_100072300 3300005445 Bacteria 3107
34 Ga0070708_100108992 3300005445 Bacteria 2544
35 Ga0070663_100023984 3300005455 Bacteria 4098
36 Ga0070662_100151362 3300005457 Bacteria 1806
37 Ga0070662_100350218 3300005457 Bacteria 1210
38 Ga0068867_100158177 3300005459 Unclassified 1785
39 Ga0070685_10069808 3300005466 Bacteria 2079
40 Ga0070706_100002630 3300005467 Bacteria 17990
41 Ga0070706_100028591 3300005467 Bacteria 5133
42 Ga0070706_100031993 3300005467 Bacteria 4851
43 Ga0070706_100048310 3300005467 Bacteria 3928
44 Ga0070706_100075082 3300005467 Bacteria 3129
45 Ga0070706_100211232 3300005467 Bacteria 1812
46 Ga0070706_100316809 3300005467 Unclassified 1455
47 Ga0070707_100003446 3300005468 Bacteria 14948
48 Ga0070707_100023457 3300005468 Bacteria 5837
49 Ga0070707_100026928 3300005468 Bacteria 5465
50 Ga0070707_100080691 3300005468 Bacteria 3140
51 Ga0070707_100102686 3300005468 Bacteria 2770
52 Ga0070707_100360701 3300005468 Bacteria 1412
53 Ga0070707_100654079 3300005468 Unclassified 1014
54 Ga0070698_100000020 3300005471 Bacteria 106237
55 Ga0070698_100047091 3300005471 Bacteria 4408
56 Ga0070698_100391475 3300005471 Bacteria 1323
57 Ga0070698_100456972 3300005471 Bacteria 1213
58 Ga0070699_100000001 3300005518 Bacteria 910751
59 Ga0070699_100113746 3300005518 Bacteria 2377
60 Ga0070684_100000090 3300005535 Bacteria 59104
61 Ga0070684_100283428 3300005535 Bacteria 1518
62 Ga0070697_100032267 3300005536 Bacteria 4213
63 Ga0070697_100403684 3300005536 Bacteria 1186
64 Ga0070672_100000238 3300005543 Bacteria 30785
65 Ga0070672_100041345 3300005543 Bacteria 3544
66 Ga0070672_100158459 3300005543 Bacteria 1876
67 Ga0070686_100008197 3300005544 Bacteria 5848
68 Ga0070695_100040368 3300005545 Bacteria 2954
69 Ga0070696_100583154 3300005546 Bacteria 900
70 Ga0070693_100022079 3300005547 Bacteria 3379
71 Ga0070693_100125865 3300005547 Bacteria 1595
72 Ga0070665_100087833 3300005548 Bacteria 3115
73 Ga0070704_100249179 3300005549 Bacteria 1458
74 Ga0070704_100372427 3300005549 Bacteria 1211
75 Ga0070704_100433589 3300005549 Bacteria 1128
76 Ga0070664_100561568 3300005564 Bacteria 1056
77 Ga0068857_100085120 3300005577 Bacteria 2825
78 Ga0068854_100000978 3300005578 Bacteria 17195
79 Ga0068854_100006094 3300005578 Bacteria 7646
80 Ga0068856_100001576 3300005614 Bacteria 23872
81 Ga0070702_100162723 3300005615 Bacteria 1444
82 Ga0070702_100417047 3300005615 Unclassified 965
83 Ga0068859_100007458 3300005617 Bacteria 11104
84 Ga0068859_100024578 3300005617 Bacteria 6044
85 Ga0068859_100089977 3300005617 Bacteria 3120
86 Ga0068864_100205734 3300005618 Bacteria 1810
87 Ga0068861_100105049 3300005719 Bacteria 2254
88 Ga0068861_100149545 3300005719 Bacteria 1915
89 Ga0068870_10142850 3300005840 Bacteria 1402
90 Ga0068863_100293684 3300005841 Bacteria 1576
91 Ga0068858_100000486 3300005842 Bacteria 41451
92 Ga0068858_100001267 3300005842 Bacteria 26131
93 Ga0068860_100002153 3300005843 Bacteria 20744
94 Ga0068860_100010154 3300005843 Bacteria 9329
95 Ga0070717_10000053 3300006028 Bacteria 99942
96 Ga0070717_10056026 3300006028 Bacteria 3255
97 Ga0070717_10527189 3300006028 Bacteria 1069
98 Ga0070716_100039816 3300006173 Bacteria 2611
99 Ga0070716_100178455 3300006173 Bacteria 1392
100 Ga0097621_100124302 3300006237 Bacteria 2191
101 Ga0097621_100224828 3300006237 Bacteria 1636
102 Ga0097621_100274011 3300006237 Bacteria 1484
103 Ga0068871_100074103 3300006358 Bacteria 2808
104 Ga0075428_100001031 3300006844 Bacteria 29511
105 Ga0075428_100019797 3300006844 Bacteria 7448
106 Ga0075428_100170832 3300006844 Bacteria 2356
107 Ga0075428_100202412 3300006844 Bacteria 2146
108 Ga0075428_100674345 3300006844 Bacteria 1102
109 Ga0075431_100272833 3300006847 Bacteria 1714
110 Ga0075433_10018263 3300006852 Bacteria 5825
111 Ga0075433_10056416 3300006852 Bacteria 3431
112 Ga0075433_10325200 3300006852 Bacteria 1360
113 Ga0075433_10403901 3300006852 Bacteria 1205
114 Ga0075434_100017789 3300006871 Bacteria 6856
115 Ga0075434_100094940 3300006871 Bacteria 2988
116 Ga0075434_100171132 3300006871 Bacteria 2192
117 Ga0075429_100154284 3300006880 Bacteria 2011
118 Ga0068865_100118960 3300006881 Bacteria 1961
119 Ga0075436_100018154 3300006914 Bacteria 4817
120 Ga0075436_100217341 3300006914 Bacteria 1356
121 Ga0075436_100256207 3300006914 Bacteria 1247
122 Ga0097620_100024578 3300006931 Bacteria 6044
123 Ga0097620_100089980 3300006931 Bacteria 3120
124 Ga0075435_100002999 3300007076 Bacteria 11364
125 Ga0075435_100180861 3300007076 Bacteria 1782
126 Ga0075435_100221949 3300007076 Bacteria 1605
127 Ga0075435_100406918 3300007076 Bacteria 1171
128 Ga0105240_10022349 3300009093 Bacteria 8386
129 Ga0105245_10000003 3300009098 Bacteria 488207
130 Ga0105245_10000214 3300009098 Bacteria 55083
131 Ga0114129_10001394 3300009147 Bacteria 32556
132 Ga0114129_10020529 3300009147 Bacteria 9395
133 Ga0114129_10022802 3300009147 Bacteria 8876
134 Ga0114129_10201239 3300009147 Bacteria 2697
135 Ga0105243_10117143 3300009148 Unclassified 2239
136 Ga0105243_10250081 3300009148 Bacteria 1582
137 Ga0105248_10015921 3300009177 Bacteria 8282
138 Ga0105248_10286812 3300009177 Bacteria 1853
139 Ga0105237_10636265 3300009545 Bacteria 1073
140 Ga0105238_10000041 3300009551 Bacteria 155330
141 Ga0105249_10144953 3300009553 Bacteria 2280
142 Ga0105246_10567261 3300011119 Unclassified 975
143 Ga0157369_10001219 3300013105 Bacteria 31990
144 Ga0157374_10000006 3300013296 Bacteria 640284
145 Ga0157378_10000633 3300013297 Bacteria 33010
146 Ga0157378_10013434 3300013297 Bacteria 7158
147 Ga0157378_10068219 3300013297 Bacteria 3189
148 Ga0157378_10229547 3300013297 Bacteria 1768
149 Ga0157378_10602319 3300013297 Bacteria 1110
150 Ga0163162_10066525 3300013306 Bacteria 3652
151 Ga0157375_10000011 3300013308 Bacteria 334557
152 Ga0157375_10000024 3300013308 Bacteria 231767
153 Ga0157375_10000640 3300013308 Bacteria 31052
154 Ga0157375_10042695 3300013308 Bacteria 4391
155 Ga0163163_10044665 3300014325 Bacteria 4348
156 Ga0157380_10031093 3300014326 Bacteria 4096
157 Ga0157377_10000011 3300014745 Bacteria 305350
158 Ga0157377_10000057 3300014745 Bacteria 87502
159 Ga0157379_10004423 3300014968 Bacteria 12047
160 Ga0157379_10117697 3300014968 Bacteria 2390
161 Ga0157376_10000009 3300014969 Bacteria 340244
162 Ga0157376_10001102 3300014969 Bacteria 17696
163 Ga0213873_10000004 3300021358 Bacteria 774374
164 Ga0213873_10018172 3300021358 Bacteria 1614
165 Ga0213876_10000007 3300021384 Bacteria 670340
166 Ga0213876_10000018 3300021384 Bacteria 282299
167 Ga0213876_10010261 3300021384 Bacteria 5030
168 Ga0213876_10035634 3300021384 Bacteria 2624
169 Ga0207642_10064084 3300025899 Bacteria 1721
170 Ga0207680_10009532 3300025903 Bacteria 4820
171 Ga0207645_10304264 3300025907 Bacteria 1062
172 Ga0207643_10164789 3300025908 Bacteria 1335
173 Ga0207705_10015302 3300025909 Bacteria 5506
174 Ga0207684_10027066 3300025910 Bacteria 4890
175 Ga0207684_10035870 3300025910 Bacteria 4209
176 Ga0207684_10039432 3300025910 Bacteria 4006
177 Ga0207684_10053086 3300025910 Bacteria 3441
178 Ga0207684_10074565 3300025910 Bacteria 2882
179 Ga0207684_10119881 3300025910 Bacteria 2255
180 Ga0207684_10356058 3300025910 Unclassified 1260
181 Ga0207660_10128578 3300025917 Bacteria 1926
182 Ga0207662_10005496 3300025918 Bacteria 6763
183 Ga0207662_10092493 3300025918 Bacteria 1862
184 Ga0207646_10005047 3300025922 Bacteria 14044
185 Ga0207646_10032759 3300025922 Bacteria 4702
186 Ga0207646_10105826 3300025922 Bacteria 2523
187 Ga0207646_10126691 3300025922 Bacteria 2296
188 Ga0207646_10223753 3300025922 Bacteria 1700
189 Ga0207646_10232508 3300025922 Unclassified 1666
190 Ga0207646_10281928 3300025922 Bacteria 1502
191 Ga0207646_10466001 3300025922 Bacteria 1139
192 Ga0207694_10000001 3300025924 Bacteria 4078485
193 Ga0207650_10000460 3300025925 Bacteria 34271
194 Ga0207687_10000002 3300025927 Bacteria 975489
195 Ga0207687_10007779 3300025927 Bacteria 7030
196 Ga0207700_10035063 3300025928 Bacteria 3610
197 Ga0207700_10513951 3300025928 Bacteria 1061
198 Ga0207644_10049755 3300025931 Bacteria 3002
199 Ga0207706_10124283 3300025933 Bacteria 2270
200 Ga0207709_10022628 3300025935 Bacteria 3566
201 Ga0207709_10088353 3300025935 Unclassified 2017
202 Ga0207670_10004671 3300025936 Bacteria 7426
203 Ga0207670_10022676 3300025936 Bacteria 3894
204 Ga0207669_10054493 3300025937 Bacteria 2416
205 Ga0207704_10320129 3300025938 Bacteria 1196
206 Ga0207665_10061730 3300025939 Bacteria 2541
207 Ga0207665_10235347 3300025939 Bacteria 1347
208 Ga0207691_10019760 3300025940 Bacteria 6370
209 Ga0207691_10020394 3300025940 Bacteria 6265
210 Ga0207691_10080163 3300025940 Bacteria 2936
211 Ga0207691_10266607 3300025940 Unclassified 1475
212 Ga0207711_10002090 3300025941 Bacteria 18033
213 Ga0207689_10004202 3300025942 Bacteria 13095
214 Ga0207689_10046983 3300025942 Bacteria 3566
215 Ga0207661_10000013 3300025944 Bacteria 348811
216 Ga0207661_10086571 3300025944 Bacteria 2601
217 Ga0207679_10151706 3300025945 Unclassified 1887
218 Ga0207679_10728100 3300025945 Bacteria 901
219 Ga0207651_10008251 3300025960 Bacteria 5614
220 Ga0207651_10035040 3300025960 Bacteria 3258
221 Ga0207651_10225974 3300025960 Bacteria 1516
222 Ga0207712_10494703 3300025961 Bacteria 1044
223 Ga0207640_10000942 3300025981 Bacteria 16236
224 Ga0207658_10006885 3300025986 Bacteria 7740
225 Ga0207677_10000081 3300026023 Bacteria 78954
226 Ga0207677_10000179 3300026023 Bacteria 50536
227 Ga0207703_10000213 3300026035 Bacteria 67884
228 Ga0207703_10013008 3300026035 Bacteria 6484
229 Ga0207639_10000026 3300026041 Bacteria 205256
230 Ga0207678_10038172 3300026067 Bacteria 4174
231 Ga0207708_10137933 3300026075 Bacteria 1911
232 Ga0207702_10012840 3300026078 Bacteria 6969
233 Ga0207702_10173002 3300026078 Bacteria 1982
234 Ga0207641_10065198 3300026088 Bacteria 3115
235 Ga0207641_10189190 3300026088 Bacteria 1891
236 Ga0207648_10210207 3300026089 Unclassified 1727
237 Ga0207674_10624160 3300026116 Bacteria 1041
238 Ga0207675_100010379 3300026118 Bacteria 8727
239 Ga0207675_100149313 3300026118 Bacteria 2224
240 Ga0209970_1005084 3300027614 Bacteria 2173
241 Ga0209983_1011898 3300027665 Bacteria 1782
242 Ga0209971_1000368 3300027682 Bacteria 12300
243 Ga0209998_10016209 3300027717 Bacteria 1567
244 Ga0268266_10036369 3300028379 Bacteria 4191
245 Ga0268265_10106232 3300028380 Bacteria 2280
246 Ga0268265_10167353 3300028380 Bacteria 1875
247 Ga0268265_10260491 3300028380 Bacteria 1541
248 Ga0268264_10004906 3300028381 Bacteria 11334
249 Ga0307511_10000461 3300030521 Bacteria 43998
250 Ga0265332_10039244 3300031238 Bacteria 2051
251 Ga0265328_10102048 3300031239 Bacteria 1063
252 Ga0265339_10102660 3300031249 Bacteria 1486
253 Ga0265327_10084867 3300031251 Bacteria 1556
254 Ga0316576_10059134 3300031727 Bacteria 2805
255 Ga0316576_10153384 3300031727 Bacteria 1736
256 Ga0316576_10202419 3300031727 Bacteria 1495
257 Ga0316578_10003484 3300031728 Bacteria 7211
258 Ga0316577_10011041 3300031733 Bacteria 4886
259 Ga0316583_10006579 3300032133 Bacteria 4178
260 Ga0373932_0000023 3300035112 Bacteria 46650
261 Ga0373941_0056389 3300035115 Bacteria 1265
262 Ga0373943_0010708 3300035170 Bacteria 4114
263 Ga0373955_0223207 3300035172 Bacteria 1126
264 Ga0316574_0007620 3300035398 Bacteria 5947
265 Ga0373947_0318065 3300035725 Bacteria 1040
266 Ga0316582_0014027 3300036647 Bacteria 4534
267 Ga0316582_0352018 3300036647 Bacteria 1013
268 Ga0316584_0348673 3300036712 Bacteria 1063
269 Ga0395901_0631478 3300038443 Bacteria 1077
270 Ga0436365_0073603 3300039437 Bacteria 250590
271 Ga0436365_0414850 3300039437 Bacteria 153664
272 Ga0436365_0551265 3300039437 Bacteria 1943
273 Ga0436365_1912838 3300039437 Bacteria 5826
274 Ga0436362_0290430 3300039453 Bacteria 772596
275 Ga0436362_0418817 3300039453 Bacteria 32130
276 Ga0451577_0001283 3300042876 Bacteria 34539
277 Ga0451577_0006429 3300042876 Bacteria 11720
278 Ga0451577_0010257 3300042876 Bacteria 8971
279 Ga0451577_0080521 3300042876 Bacteria 2904
280 Ga0451577_0458829 3300042876 Bacteria 1157
281 Ga0453684_0000188 3300044712 Bacteria 270311
282 Ga0453684_0039640 3300044712 Bacteria 6414
283 Ga0453684_0054414 3300044712 Bacteria 5212
284 Ga0453684_0277473 3300044712 Bacteria 1912
285 Ga0451576_0303981 3300045051 Bacteria 1669
286 Ga0451576_0444009 3300045051 Bacteria 1362
287 Ga0451576_0446555 3300045051 Bacteria 1357
288 Ga0451576_0669979 3300045051 Bacteria 1090
289 Ga0495629_0000012 3300046459 Bacteria 230331
290 Ga0495580_0003116 3300046472 Bacteria 14206
291 Ga0495580_0053652 3300046472 Bacteria 2844
292 Ga0495580_0066473 3300046472 Bacteria 2524
293 Ga0495580_0225816 3300046472 Bacteria 1286
294 Ga0495639_0015553 3300046475 Bacteria 3300
295 Ga0495594_0004998 3300046499 Bacteria 6823
296 Ga0495635_0001451 3300046663 Bacteria 15860
297 Ga0495647_0002437 3300046681 Bacteria 5863
298 Ga0495647_0007160 3300046681 Bacteria 3727
299 Ga0495658_0000057 3300046683 Bacteria 56081
300 Ga0495613_0002697 3300046689 Bacteria 13325
301 Ga0495581_0000007 3300047315 Bacteria 67949
302 Ga0495679_028392 3300047446 Bacteria 1836
303 Ga0495614_0002627 3300048089 Bacteria 7986
304 Ga0496100_0092287 3300048903 Bacteria 2069
305 Ga0496101_0013167 3300048904 Bacteria 5536
306 Ga0496102_0001586 3300048905 Bacteria 20050
307 Ga0496102_0107084 3300048905 Bacteria 2603
308 Ga0496103_0023211 3300048906 Bacteria 3740
309 Ga0496106_0001599 3300048909 Bacteria 17032
310 Ga0496107_0003584 3300048910 Bacteria 10407
311 Ga0496109_0423945 3300048912 Bacteria 1257
312 Ga0496111_0024740 3300048914 Bacteria 4234
313 Ga0496115_0115956 3300048918 Bacteria 2203
314 Ga0501031_0137122 3300049568 Bacteria 1598
315 Ga0501033_0003699 3300049570 Bacteria 12439
316 Ga0501033_0104374 3300049570 Bacteria 2066
317 Ga0501033_0186816 3300049570 Bacteria 1484
318 Ga0501036_0004283 3300049572 Bacteria 11523
319 Ga0501036_0012285 3300049572 Bacteria 7091
320 Ga0501037_0174087 3300049573 Bacteria 1529
321 Ga0501038_0012800 3300049574 Bacteria 7661
322 Ga0501038_0027033 3300049574 Bacteria 5107
323 Ga0501038_0159339 3300049574 Bacteria 1835
324 Ga0501038_0349936 3300049574 Bacteria 1151
325 Ga0501039_0005160 3300049575 Bacteria 9898
326 Ga0501039_0008359 3300049575 Bacteria 7887
327 Ga0501040_0005091 3300049576 Bacteria 8495
328 Ga0501040_0017589 3300049576 Bacteria 4746
329 Ga0501040_0067622 3300049576 Bacteria 2463
330 Ga0501040_0187053 3300049576 Bacteria 1469
331 Ga0501041_0000806 3300049577 Bacteria 16769
332 Ga0501041_0010071 3300049577 Bacteria 5570
333 Ga0501041_0347216 3300049577 Unclassified 937
334 Ga0501042_0001007 3300049578 Bacteria 16003
335 Ga0501042_0181506 3300049578 Bacteria 1518
336 Ga0501042_0205679 3300049578 Bacteria 1419
337 Ga0501043_0204898 3300049579 Bacteria 1530
338 Ga0501046_0032676 3300049580 Unclassified 4212
339 Ga0501046_0080400 3300049580 Bacteria 2519
340 Ga0501046_0133156 3300049580 Bacteria 1884
341 Ga0501046_0214095 3300049580 Bacteria 1429
342 Ga0501046_0357262 3300049580 Bacteria 1060
343 Ga0501048_0002397 3300049582 Bacteria 14307
344 Ga0501048_0031487 3300049582 Bacteria 3837
345 Ga0501048_0167972 3300049582 Bacteria 1553
346 Ga0501068_0026231 3300049584 Bacteria 3432
347 Ga0501068_0121471 3300049584 Bacteria 1629
348 Ga0501069_0093836 3300049585 Bacteria 1698
349 Ga0501070_0212441 3300049586 Bacteria 1588
350 Ga0501071_0001061 3300049587 Bacteria 15220
351 Ga0501071_0021824 3300049587 Bacteria 4462
352 Ga0501071_0094247 3300049587 Bacteria 2202
353 Ga0501072_0001478 3300049588 Bacteria 17623
354 Ga0501072_0014537 3300049588 Bacteria 6031
355 Ga0501072_0098034 3300049588 Bacteria 2330
356 Ga0501073_0010112 3300049589 Bacteria 6935
357 Ga0501074_0024169 3300049590 Bacteria 4416
358 Ga0501075_0000004 3300049591 Bacteria 148813
359 Ga0501075_0005136 3300049591 Bacteria 8952
360 Ga0501075_0059814 3300049591 Bacteria 2870
361 Ga0501075_0066323 3300049591 Bacteria 2724
362 Ga0501075_0095173 3300049591 Bacteria 2260
363 Ga0501075_0117926 3300049591 Bacteria 2018
364 Ga0501076_0000453 3300049592 Bacteria 25975
365 Ga0501076_0010046 3300049592 Bacteria 7003
366 Ga0501076_0124073 3300049592 Bacteria 2092
367 Ga0501076_0471802 3300049592 Bacteria 1034
368 Ga0501077_0001372 3300049593 Bacteria 14659
369 Ga0501079_0009777 3300049741 Bacteria 7271
370 Ga0501079_0044000 3300049741 Bacteria 3446
371 Ga0501079_0095047 3300049741 Bacteria 2310
372 Ga0501079_0177084 3300049741 Bacteria 1663
373 Ga0501079_0305541 3300049741 Bacteria 1245
374 Ga0501079_0325332 3300049741 Unclassified 1204
375 Ga0501080_0005288 3300049742 Bacteria 11497
376 Ga0501080_0050002 3300049742 Bacteria 3891
377 Ga0501080_0145294 3300049742 Bacteria 2192
378 Ga0501081_0000794 3300049743 Bacteria 18588
379 Ga0501081_0006020 3300049743 Bacteria 7851
380 Ga0501081_0015045 3300049743 Bacteria 5105
381 Ga0501081_0082813 3300049743 Bacteria 2248
382 Ga0501081_0172869 3300049743 Bacteria 1560
383 Ga0501081_0287219 3300049743 Bacteria 1205
384 Ga0501083_0036367 3300049744 Bacteria 3359
385 Ga0501083_0139026 3300049744 Bacteria 1590
386 Ga0501035_0026996 3300049822 Bacteria 5251
387 Ga0501035_0114697 3300049822 Bacteria 2359
388 Ga0501035_0304840 3300049822 Bacteria 1341
389 Ga0501035_0336846 3300049822 Bacteria 1265
390 Ga0501045_0000980 3300049824 Bacteria 18688
391 Ga0501045_0005887 3300049824 Bacteria 8484
392 Ga0501045_0019682 3300049824 Bacteria 4816
393 Ga0501045_0152185 3300049824 Bacteria 1721
394 nmdc:mga05p37_165182_c1 3300050507 Bacteria 2702
395 nmdc:mga05p37_245_c1 3300050507 Bacteria 55562
396 nmdc:mga05p37_373808_c1 3300050507 Bacteria 1672
397 nmdc:mga05p37_48573_c1 3300050507 Bacteria 5218
398 nmdc:mga05p37_505925_c1 3300050507 Bacteria 1385
399 nmdc:mga09592_437480_c1 3300050508 Bacteria 1129
400 nmdc:mga08y16_119552_c1 3300050511 Bacteria 2742
401 nmdc:mga0n895_216274_c1 3300050512 Bacteria 1946
402 nmdc:mga0rr50_1605_c1 3300050513 Bacteria 12456
403 nmdc:mga0rr50_176879_c1 3300050513 Bacteria 1742
404 nmdc:mga0rr50_20248_c1 3300050513 Bacteria 4511
405 nmdc:mga0rr50_234815_c1 3300050513 Bacteria 1518
406 nmdc:mga0rr50_46677_c1 3300050513 Bacteria 3190
407 nmdc:mga0rr50_66934_c1 3300050513 Bacteria 2727
408 nmdc:mga08x19_198698_c1 3300050514 Bacteria 1374
409 nmdc:mga08x19_6831_c1 3300050514 Bacteria 6777
410 nmdc:mga0a205_14656_c1 3300050515 Bacteria 7314
411 nmdc:mga0a205_239036_c1 3300050515 Bacteria 1697
412 nmdc:mga0a205_41705_c1 3300050515 Bacteria 4421
413 Ga0495655_0001652 3300053083 Bacteria 3452
414 Ga0495619_0004587 3300053085 Bacteria 8824
415 Ga0501084_0001260 3300054114 Bacteria 19946
416 Ga0501084_0007592 3300054114 Bacteria 8943
417 Ga0501084_0010829 3300054114 Bacteria 7553
418 Ga0501082_0000769 3300060353 Bacteria 28102
419 Ga0501082_0001881 3300060353 Bacteria 18474
420 Ga0501082_0024837 3300060353 Bacteria 5165
421 Ga0501082_0305122 3300060353 Unclassified 1386
422 Ga0530510_0000044 3300061734 Bacteria 56867
423 Ga0530510_0028796 3300061734 Bacteria 3982
424 Ga0530510_0050177 3300061734 Bacteria 3014
425 Ga0070658_10019045
426 Ga0065707_10093593
427 Ga0070683_100000109
428 Ga0070683_100131164
429 Ga0070690_100160834
430 Ga0070670_100000143
431 Ga0068869_100020790
432 Ga0068869_100497702
433 Ga0070666_10000683
434 Ga0070680_100213303
435 Ga0070682_100000015
436 Ga0068868_100000038
437 Ga0068868_100000813
438 Ga0070689_100001260
439 Ga0070689_100002312
440 Ga0070687_100095522
441 Ga0070661_100316191
442 Ga0070692_10014351
443 Ga0070669_100064237
444 Ga0070675_100683930
445 Ga0070671_100041822
446 Ga0070674_100662587
447 Ga0070673_100002970
448 Ga0070673_100044562
449 Ga0070667_100005116
450 Ga0070709_10240085
451 Ga0070713_100040439
452 Ga0070701_10000213
453 Ga0070701_10012820
454 Ga0070711_100012306
455 Ga0070694_100220936
456 Ga0070708_100008723
457 Ga0070708_100072300
458 Ga0070708_100108992
459 Ga0070663_100023984
460 Ga0070662_100151362
461 Ga0070662_100350218
462 Ga0068867_100158177
463 Ga0070685_10069808
464 Ga0070706_100002630
465 Ga0070706_100028591
466 Ga0070706_100031993
467 Ga0070706_100048310
468 Ga0070706_100075082
469 Ga0070706_100211232
470 Ga0070706_100316809
471 Ga0070707_100003446
472 Ga0070707_100023457
473 Ga0070707_100026928
474 Ga0070707_100080691
475 Ga0070707_100102686
476 Ga0070707_100360701
477 Ga0070707_100654079
478 Ga0070698_100000020
479 Ga0070698_100047091
480 Ga0070698_100391475
481 Ga0070698_100456972
482 Ga0070699_100000001
483 Ga0070699_100113746
484 Ga0070684_100000090
485 Ga0070684_100283428
486 Ga0070697_100032267
487 Ga0070697_100403684
488 Ga0070672_100000238
489 Ga0070672_100041345
490 Ga0070672_100158459
491 Ga0070686_100008197
492 Ga0070695_100040368
493 Ga0070696_100583154
494 Ga0070693_100022079
495 Ga0070693_100125865
496 Ga0070665_100087833
497 Ga0070704_100249179
498 Ga0070704_100372427
499 Ga0070704_100433589
500 Ga0070664_100561568
501 Ga0068857_100085120
502 Ga0068854_100000978
503 Ga0068854_100006094
504 Ga0068856_100001576
505 Ga0070702_100162723
506 Ga0070702_100417047
507 Ga0068859_100007458
508 Ga0068859_100024578
509 Ga0068859_100089977
510 Ga0068864_100205734
511 Ga0068861_100105049
512 Ga0068861_100149545
513 Ga0068870_10142850
514 Ga0068863_100293684
515 Ga0068858_100000486
516 Ga0068858_100001267
517 Ga0068860_100002153
518 Ga0068860_100010154
519 Ga0070717_10000053
520 Ga0070717_10056026
521 Ga0070717_10527189
522 Ga0070716_100039816
523 Ga0070716_100178455
524 Ga0097621_100124302
525 Ga0097621_100224828
526 Ga0097621_100274011
527 Ga0068871_100074103
528 Ga0075428_100001031
529 Ga0075428_100019797
530 Ga0075428_100170832
531 Ga0075428_100202412
532 Ga0075428_100674345
533 Ga0075431_100272833
534 Ga0075433_10018263
535 Ga0075433_10056416
536 Ga0075433_10325200
537 Ga0075433_10403901
538 Ga0075434_100017789
539 Ga0075434_100094940
540 Ga0075434_100171132
541 Ga0075429_100154284
542 Ga0068865_100118960
543 Ga0075436_100018154
544 Ga0075436_100217341
545 Ga0075436_100256207
546 Ga0097620_100024578
547 Ga0097620_100089980
548 Ga0075435_100002999
549 Ga0075435_100180861
550 Ga0075435_100221949
551 Ga0075435_100406918
552 Ga0105240_10022349
553 Ga0105245_10000003
554 Ga0105245_10000214
555 Ga0114129_10001394
556 Ga0114129_10020529
557 Ga0114129_10022802
558 Ga0114129_10201239
559 Ga0105243_10117143
560 Ga0105243_10250081
561 Ga0105248_10015921
562 Ga0105248_10286812
563 Ga0105237_10636265
564 Ga0105238_10000041
565 Ga0105249_10144953
566 Ga0105246_10567261
567 Ga0157369_10001219
568 Ga0157374_10000006
569 Ga0157378_10000633
570 Ga0157378_10013434
571 Ga0157378_10068219
572 Ga0157378_10229547
573 Ga0157378_10602319
574 Ga0163162_10066525
575 Ga0157375_10000011
576 Ga0157375_10000024
577 Ga0157375_10000640
578 Ga0157375_10042695
579 Ga0163163_10044665
580 Ga0157380_10031093
581 Ga0157377_10000011
582 Ga0157377_10000057
583 Ga0157379_10004423
584 Ga0157379_10117697
585 Ga0157376_10000009
586 Ga0157376_10001102
587 Ga0213873_10000004
588 Ga0213873_10018172
589 Ga0213876_10000007
590 Ga0213876_10000018
591 Ga0213876_10010261
592 Ga0213876_10035634
593 Ga0207642_10064084
594 Ga0207680_10009532
595 Ga0207645_10304264
596 Ga0207643_10164789
597 Ga0207705_10015302
598 Ga0207684_10027066
599 Ga0207684_10035870
600 Ga0207684_10039432
601 Ga0207684_10053086
602 Ga0207684_10074565
603 Ga0207684_10119881
604 Ga0207684_10356058
605 Ga0207660_10128578
606 Ga0207662_10005496
607 Ga0207662_10092493
608 Ga0207646_10005047
609 Ga0207646_10032759
610 Ga0207646_10105826
611 Ga0207646_10126691
612 Ga0207646_10223753
613 Ga0207646_10232508
614 Ga0207646_10281928
615 Ga0207646_10466001
616 Ga0207694_10000001
617 Ga0207650_10000460
618 Ga0207687_10000002
619 Ga0207687_10007779
620 Ga0207700_10035063
621 Ga0207700_10513951
622 Ga0207644_10049755
623 Ga0207706_10124283
624 Ga0207709_10022628
625 Ga0207709_10088353
626 Ga0207670_10004671
627 Ga0207670_10022676
628 Ga0207669_10054493
629 Ga0207704_10320129
630 Ga0207665_10061730
631 Ga0207665_10235347
632 Ga0207691_10019760
633 Ga0207691_10020394
634 Ga0207691_10080163
635 Ga0207691_10266607
636 Ga0207711_10002090
637 Ga0207689_10004202
638 Ga0207689_10046983
639 Ga0207661_10000013
640 Ga0207661_10086571
641 Ga0207679_10151706
642 Ga0207679_10728100
643 Ga0207651_10008251
644 Ga0207651_10035040
645 Ga0207651_10225974
646 Ga0207712_10494703
647 Ga0207640_10000942
648 Ga0207658_10006885
649 Ga0207677_10000081
650 Ga0207677_10000179
651 Ga0207703_10000213
652 Ga0207703_10013008
653 Ga0207639_10000026
654 Ga0207678_10038172
655 Ga0207708_10137933
656 Ga0207702_10012840
657 Ga0207702_10173002
658 Ga0207641_10065198
659 Ga0207641_10189190
660 Ga0207648_10210207
661 Ga0207674_10624160
662 Ga0207675_100010379
663 Ga0207675_100149313
664 Ga0209970_1005084
665 Ga0209983_1011898
666 Ga0209971_1000368
667 Ga0209998_10016209
668 Ga0268266_10036369
669 Ga0268265_10106232
670 Ga0268265_10167353
671 Ga0268265_10260491
672 Ga0268264_10004906
673 Ga0307511_10000461
674 Ga0265332_10039244
675 Ga0265328_10102048
676 Ga0265339_10102660
677 Ga0265327_10084867
678 Ga0316576_10059134
679 Ga0316576_10153384
680 Ga0316576_10202419
681 Ga0316578_10003484
682 Ga0316577_10011041
683 Ga0316583_10006579
684 Ga0373932_0000023
685 Ga0373941_0056389
686 Ga0373943_0010708
687 Ga0373955_0223207
688 Ga0316574_0007620
689 Ga0373947_0318065
690 Ga0316582_0014027
691 Ga0316582_0352018
692 Ga0316584_0348673
693 Ga0395901_0631478
694 Ga0436365_0073603
695 Ga0436365_0414850
696 Ga0436365_0551265
697 Ga0436365_1912838
698 Ga0436362_0290430
699 Ga0436362_0418817
700 Ga0451577_0001283
701 Ga0451577_0006429
702 Ga0451577_0010257
703 Ga0451577_0080521
704 Ga0451577_0458829
705 Ga0453684_0000188
706 Ga0453684_0039640
707 Ga0453684_0054414
708 Ga0453684_0277473
709 Ga0451576_0303981
710 Ga0451576_0444009
711 Ga0451576_0446555
712 Ga0451576_0669979
713 Ga0495629_0000012
714 Ga0495580_0003116
715 Ga0495580_0053652
716 Ga0495580_0066473
717 Ga0495580_0225816
718 Ga0495639_0015553
719 Ga0495594_0004998
720 Ga0495635_0001451
721 Ga0495647_0002437
722 Ga0495647_0007160
723 Ga0495658_0000057
724 Ga0495613_0002697
725 Ga0495581_0000007
726 Ga0495679_028392
727 Ga0495614_0002627
728 Ga0496100_0092287
729 Ga0496101_0013167
730 Ga0496102_0001586
731 Ga0496102_0107084
732 Ga0496103_0023211
733 Ga0496106_0001599
734 Ga0496107_0003584
735 Ga0496109_0423945
736 Ga0496111_0024740
737 Ga0496115_0115956
738 Ga0501031_0137122
739 Ga0501033_0003699
740 Ga0501033_0104374
741 Ga0501033_0186816
742 Ga0501036_0004283
743 Ga0501036_0012285
744 Ga0501037_0174087
745 Ga0501038_0012800
746 Ga0501038_0027033
747 Ga0501038_0159339
748 Ga0501038_0349936
749 Ga0501039_0005160
750 Ga0501039_0008359
751 Ga0501040_0005091
752 Ga0501040_0017589
753 Ga0501040_0067622
754 Ga0501040_0187053
755 Ga0501041_0000806
756 Ga0501041_0010071
757 Ga0501041_0347216
758 Ga0501042_0001007
759 Ga0501042_0181506
760 Ga0501042_0205679
761 Ga0501043_0204898
762 Ga0501046_0032676
763 Ga0501046_0080400
764 Ga0501046_0133156
765 Ga0501046_0214095
766 Ga0501046_0357262
767 Ga0501048_0002397
768 Ga0501048_0031487
769 Ga0501048_0167972
770 Ga0501068_0026231
771 Ga0501068_0121471
772 Ga0501069_0093836
773 Ga0501070_0212441
774 Ga0501071_0001061
775 Ga0501071_0021824
776 Ga0501071_0094247
777 Ga0501072_0001478
778 Ga0501072_0014537
779 Ga0501072_0098034
780 Ga0501073_0010112
781 Ga0501074_0024169
782 Ga0501075_0000004
783 Ga0501075_0005136
784 Ga0501075_0059814
785 Ga0501075_0066323
786 Ga0501075_0095173
787 Ga0501075_0117926
788 Ga0501076_0000453
789 Ga0501076_0010046
790 Ga0501076_0124073
791 Ga0501076_0471802
792 Ga0501077_0001372
793 Ga0501079_0009777
794 Ga0501079_0044000
795 Ga0501079_0095047
796 Ga0501079_0177084
797 Ga0501079_0305541
798 Ga0501079_0325332
799 Ga0501080_0005288
800 Ga0501080_0050002
801 Ga0501080_0145294
802 Ga0501081_0000794
803 Ga0501081_0006020
804 Ga0501081_0015045
805 Ga0501081_0082813
806 Ga0501081_0172869
807 Ga0501081_0287219
808 Ga0501083_0036367
809 Ga0501083_0139026
810 Ga0501035_0026996
811 Ga0501035_0114697
812 Ga0501035_0304840
813 Ga0501035_0336846
814 Ga0501045_0000980
815 Ga0501045_0005887
816 Ga0501045_0019682
817 Ga0501045_0152185
818 nmdc:mga05p37_165182_c1
819 nmdc:mga05p37_245_c1
820 nmdc:mga05p37_373808_c1
821 nmdc:mga05p37_48573_c1
822 nmdc:mga05p37_505925_c1
823 nmdc:mga09592_437480_c1
824 nmdc:mga08y16_119552_c1
825 nmdc:mga0n895_216274_c1
826 nmdc:mga0rr50_1605_c1
827 nmdc:mga0rr50_176879_c1
828 nmdc:mga0rr50_20248_c1
829 nmdc:mga0rr50_234815_c1
830 nmdc:mga0rr50_46677_c1
831 nmdc:mga0rr50_66934_c1
832 nmdc:mga08x19_198698_c1
833 nmdc:mga08x19_6831_c1
834 nmdc:mga0a205_14656_c1
835 nmdc:mga0a205_239036_c1
836 nmdc:mga0a205_41705_c1
837 Ga0495655_0001652
838 Ga0495619_0004587
839 Ga0501084_0001260
840 Ga0501084_0007592
841 Ga0501084_0010829
842 Ga0501082_0000769
843 Ga0501082_0001881
844 Ga0501082_0024837
845 Ga0501082_0305122
846 Ga0530510_0000044
847 Ga0530510_0028796
848 Ga0530510_0050177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

66

249

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xiw-assembly1.cif.gz_B-2 crystal structure of the sac7d-derived igg1-binder c3-c24s 0.9204 144 170
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9127 1 231
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9113 1 231
1o95-assembly1.cif.gz_C ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9108 1 230
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9075 1 231
ID Description Score Start End Superfamily
af_A0A0R0G2M3_144_398_3.30.70.1990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9222 144 170 3.30.70.1990
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9113 1 231 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.911 1 230 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9075 1 231 3.40.50.620
1fr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9036 143 170 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7V5AK68-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9734 1 89 GO:0009055
AF-A0A800BP14-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9671 1 129 GO:0009055
AF-A0A3N5R1B1-F1-model_v4 Electron transfer flavoprotein beta subunit/FixA family protein 0.965 1 170 GO:0009055
AF-A0A7V4HBD7-F1-model_v4 Electron transfer flavoprotein beta subunit/FixA family protein 0.9631 1 128 GO:0009055
AF-A0A354XUL2-F1-model_v4 deleted 0.9597 1 86

Map