F440718

General Info

Members Datasets Scaffolds Average Seq Length
424 250 848 196

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1110744|Ga0081540_11107442
Length 210
Sequence MPGMPPPAADERQSLLEFLRFNQNAFFAVAYGLSDEQARSTPSVSTLSIGGLIKHAAGVQKGWAQRAAFAPDFPPRDERPMEEIVAEYADQYLMRDDETLEHLLDELRKQNEETLRVFAEADLYTRVPVPHDVPWFPQDIDHWSVRWVALHLIEELTRHAGHADIVRELVDGTAGLRAGTSNLPGGDQAWWESYRARLQRVAELSTDRGT

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
238 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
239 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
246 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
247 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
248 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
249 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
250 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.31
Nodule 0.24
Rhizoplane 9.91
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1110744 3300005983 Bacteria 1161
2 JGI24746J21847_1011250 3300001977 Bacteria 1317
3 JGI24737J22298_10050680 3300001990 Bacteria 1261
4 JGI24743J22301_10000444 3300001991 Bacteria 4730
5 JGI24745J21846_1000671 3300002073 Bacteria 3087
6 JGI24749J21850_1015499 3300002076 Bacteria 1069
7 JGI24744J21845_10000472 3300002077 Bacteria 7140
8 JGI24744J21845_10002773 3300002077 Bacteria 3579
9 Ga0070676_10012022 3300005328 Bacteria 4718
10 Ga0070683_100440986 3300005329 Bacteria 1242
11 Ga0070690_100072521 3300005330 Bacteria 2239
12 Ga0070677_10103181 3300005333 Bacteria 1261
13 Ga0068869_100186290 3300005334 Bacteria 1629
14 Ga0070666_10074530 3300005335 Bacteria 2313
15 Ga0070666_10373530 3300005335 Bacteria 1023
16 Ga0068868_100001453 3300005338 Bacteria 16341
17 Ga0068868_100016326 3300005338 Bacteria 5512
18 Ga0068868_100218963 3300005338 Bacteria 1593
19 Ga0068868_100680550 3300005338 Bacteria 918
20 Ga0070660_100218419 3300005339 Bacteria 1549
21 Ga0070691_10008585 3300005341 Bacteria 4678
22 Ga0070691_10228877 3300005341 Bacteria 988
23 Ga0070691_10239641 3300005341 Bacteria 968
24 Ga0070687_100053168 3300005343 Bacteria 2105
25 Ga0070687_100251677 3300005343 Bacteria 1098
26 Ga0070668_100006407 3300005347 Bacteria 8722
27 Ga0070669_100627304 3300005353 Bacteria 902
28 Ga0070675_100789085 3300005354 Bacteria 868
29 Ga0070671_100104015 3300005355 Bacteria 2383
30 Ga0070671_100744681 3300005355 Bacteria 851
31 Ga0070674_100007936 3300005356 Bacteria 6284
32 Ga0070674_100654901 3300005356 Bacteria 893
33 Ga0070673_100104101 3300005364 Bacteria 2343
34 Ga0070688_100238480 3300005365 Bacteria 1289
35 Ga0070659_100080318 3300005366 Bacteria 2604
36 Ga0070659_100173257 3300005366 Bacteria 1768
37 Ga0070667_100003133 3300005367 Bacteria 14200
38 Ga0070667_100494275 3300005367 Bacteria 1121
39 Ga0070703_10022147 3300005406 Bacteria 1863
40 Ga0070709_10020567 3300005434 Bacteria 3830
41 Ga0070709_10024767 3300005434 Bacteria 3537
42 Ga0070714_100463717 3300005435 Bacteria 1205
43 Ga0070714_101090857 3300005435 Bacteria 778
44 Ga0070713_100041868 3300005436 Bacteria 3734
45 Ga0070713_100139409 3300005436 Bacteria 2147
46 Ga0070710_10001014 3300005437 Bacteria 13321
47 Ga0070701_10036479 3300005438 Bacteria 2477
48 Ga0070711_100000280 3300005439 Bacteria 26351
49 Ga0070711_100096702 3300005439 Bacteria 2140
50 Ga0070705_100179158 3300005440 Bacteria 1434
51 Ga0070700_100004174 3300005441 Bacteria 7533
52 Ga0070700_100049175 3300005441 Bacteria 2616
53 Ga0070694_100006083 3300005444 Bacteria 7322
54 Ga0070708_100782472 3300005445 Bacteria 897
55 Ga0070663_100002851 3300005455 Bacteria 9828
56 Ga0070663_100022570 3300005455 Bacteria 4209
57 Ga0070678_100000626 3300005456 Bacteria 17350
58 Ga0070678_100625694 3300005456 Bacteria 963
59 Ga0068867_100000835 3300005459 Bacteria 20725
60 Ga0068867_101354430 3300005459 Bacteria 658
61 Ga0070685_10029477 3300005466 Bacteria 3049
62 Ga0070685_10359211 3300005466 Bacteria 998
63 Ga0070707_100420023 3300005468 Bacteria 1298
64 Ga0070684_100144900 3300005535 Bacteria 2149
65 Ga0070697_100821620 3300005536 Bacteria 823
66 Ga0068853_100011755 3300005539 Bacteria 7115
67 Ga0070672_100100581 3300005543 Bacteria 2345
68 Ga0070686_100040113 3300005544 Bacteria 2920
69 Ga0070695_100080609 3300005545 Bacteria 2152
70 Ga0070696_100041424 3300005546 Bacteria 3182
71 Ga0070696_100112038 3300005546 Bacteria 1966
72 Ga0070693_100001856 3300005547 Bacteria 9655
73 Ga0070693_100123822 3300005547 Bacteria 1607
74 Ga0070693_100844752 3300005547 Bacteria 682
75 Ga0070665_100028263 3300005548 Bacteria 5648
76 Ga0070665_100149567 3300005548 Bacteria 2338
77 Ga0070665_101228472 3300005548 Bacteria 760
78 Ga0070704_100012290 3300005549 Bacteria 5286
79 Ga0070704_100135587 3300005549 Bacteria 1914
80 Ga0070704_100988686 3300005549 Bacteria 760
81 Ga0068855_100041253 3300005563 Bacteria 5471
82 Ga0068854_100000551 3300005578 Bacteria 22591
83 Ga0068854_100160510 3300005578 Bacteria 1740
84 Ga0068856_100222756 3300005614 Bacteria 1902
85 Ga0070702_100000921 3300005615 Bacteria 11514
86 Ga0068852_100045499 3300005616 Bacteria 3733
87 Ga0068852_100122541 3300005616 Bacteria 2383
88 Ga0068859_100096139 3300005617 Bacteria 3015
89 Ga0068859_100239718 3300005617 Bacteria 1902
90 Ga0068866_10007520 3300005718 Bacteria 4564
91 Ga0068861_100012218 3300005719 Bacteria 5987
92 Ga0068861_100030369 3300005719 Bacteria 3959
93 Ga0068870_10142640 3300005840 Bacteria 1403
94 Ga0068863_100639133 3300005841 Bacteria 1055
95 Ga0068858_100021054 3300005842 Bacteria 6091
96 Ga0068858_100284552 3300005842 Bacteria 1575
97 Ga0068860_100001259 3300005843 Bacteria 27632
98 Ga0068860_100047670 3300005843 Bacteria 4083
99 Ga0068860_100170286 3300005843 Bacteria 2103
100 Ga0068862_100063531 3300005844 Bacteria 3177
101 Ga0081455_10038392 3300005937 Bacteria 4241
102 Ga0081538_10065408 3300005981 Bacteria 2047
103 Ga0070717_10991503 3300006028 Bacteria 765
104 Ga0075365_10054183 3300006038 Bacteria 2659
105 Ga0075363_100189806 3300006048 Bacteria 1172
106 Ga0075364_10020084 3300006051 Bacteria 4200
107 Ga0075364_10622824 3300006051 Bacteria 737
108 Ga0070715_10000966 3300006163 Bacteria 8012
109 Ga0070716_100026066 3300006173 Bacteria 3126
110 Ga0070712_100000899 3300006175 Bacteria 17814
111 Ga0070712_100003164 3300006175 Bacteria 10143
112 Ga0075367_10299417 3300006178 Bacteria 1012
113 Ga0075367_10439320 3300006178 Bacteria 827
114 Ga0075369_10002129 3300006186 Bacteria 6998
115 Ga0075369_10002208 3300006186 Bacteria 6892
116 Ga0075369_10006876 3300006186 Bacteria 4319
117 Ga0075369_10032605 3300006186 Bacteria 2204
118 Ga0097621_100116191 3300006237 Bacteria 2265
119 Ga0075370_10055685 3300006353 Bacteria 2247
120 Ga0075370_10159152 3300006353 Bacteria 1325
121 Ga0068871_100220462 3300006358 Bacteria 1643
122 Ga0075430_100021855 3300006846 Bacteria 5437
123 Ga0075430_100290996 3300006846 Bacteria 1351
124 Ga0068865_100001854 3300006881 Bacteria 12409
125 Ga0068865_100121125 3300006881 Bacteria 1945
126 Ga0097620_100096128 3300006931 Bacteria 3015
127 Ga0097620_100239721 3300006931 Bacteria 1902
128 Ga0105250_10090533 3300009092 Bacteria 1244
129 Ga0105245_10017664 3300009098 Bacteria 6227
130 Ga0105245_10047102 3300009098 Bacteria 3853
131 Ga0105245_10341867 3300009098 Bacteria 1480
132 Ga0105247_10001612 3300009101 Bacteria 15971
133 Ga0105247_10622907 3300009101 Bacteria 803
134 Ga0105243_10013360 3300009148 Bacteria 6211
135 Ga0105243_10183824 3300009148 Bacteria 1820
136 Ga0105241_10160408 3300009174 Bacteria 1848
137 Ga0105242_10002300 3300009176 Bacteria 15088
138 Ga0105242_10105959 3300009176 Bacteria 2388
139 Ga0105248_10004806 3300009177 Bacteria 14951
140 Ga0105237_10025156 3300009545 Bacteria 6090
141 Ga0105237_10143692 3300009545 Bacteria 2380
142 Ga0105237_11005720 3300009545 Bacteria 840
143 Ga0105238_10446767 3300009551 Bacteria 1290
144 Ga0105238_11191741 3300009551 Bacteria 786
145 Ga0105249_10001128 3300009553 Bacteria 23740
146 Ga0105249_10127895 3300009553 Bacteria 2421
147 Ga0105249_10732259 3300009553 Bacteria 1050
148 Ga0105239_10012717 3300010375 Bacteria 9365
149 Ga0105246_10131243 3300011119 Bacteria 1872
150 Ga0105246_10279991 3300011119 Bacteria 1337
151 Ga0157371_10205117 3300013102 Bacteria 1414
152 Ga0157369_10229067 3300013105 Bacteria 1943
153 Ga0157374_10038816 3300013296 Bacteria 4379
154 Ga0157378_10001538 3300013297 Bacteria 20847
155 Ga0157378_10893198 3300013297 Bacteria 919
156 Ga0163162_10023272 3300013306 Bacteria 6113
157 Ga0163162_10993923 3300013306 Bacteria 948
158 Ga0157372_10016361 3300013307 Bacteria 7957
159 Ga0157375_10001296 3300013308 Bacteria 21510
160 Ga0157375_10108676 3300013308 Bacteria 2869
161 Ga0157380_10012747 3300014326 Bacteria 6105
162 Ga0157377_10004472 3300014745 Bacteria 6445
163 Ga0157377_10144191 3300014745 Bacteria 1466
164 Ga0157379_10075650 3300014968 Bacteria 3015
165 Ga0163161_10005267 3300017792 Bacteria 9003
166 Ga0163161_10028599 3300017792 Bacteria 3959
167 Ga0213876_10009975 3300021384 Bacteria 5104
168 Ga0213876_10013880 3300021384 Bacteria 4269
169 Ga0213875_10018290 3300021388 Bacteria 3379
170 Ga0207653_10021879 3300025885 Bacteria 2029
171 Ga0207682_10191357 3300025893 Bacteria 938
172 Ga0207692_10003160 3300025898 Bacteria 6392
173 Ga0207692_10534546 3300025898 Bacteria 747
174 Ga0207642_10000244 3300025899 Bacteria 16163
175 Ga0207642_10011989 3300025899 Bacteria 3114
176 Ga0207710_10021270 3300025900 Bacteria 2779
177 Ga0207688_10002485 3300025901 Bacteria 9922
178 Ga0207688_10021188 3300025901 Bacteria 3551
179 Ga0207680_10046828 3300025903 Bacteria 2558
180 Ga0207647_10126835 3300025904 Bacteria 1502
181 Ga0207699_10078807 3300025906 Bacteria 2036
182 Ga0207699_10472288 3300025906 Bacteria 902
183 Ga0207645_10077039 3300025907 Bacteria 2136
184 Ga0207643_10071949 3300025908 Bacteria 1991
185 Ga0207654_10159369 3300025911 Bacteria 1456
186 Ga0207671_10024709 3300025914 Bacteria 4513
187 Ga0207671_10080547 3300025914 Bacteria 2441
188 Ga0207693_10000638 3300025915 Bacteria 31340
189 Ga0207693_10002063 3300025915 Bacteria 17557
190 Ga0207663_10000215 3300025916 Bacteria 25655
191 Ga0207663_10315899 3300025916 Bacteria 1172
192 Ga0207663_10447130 3300025916 Bacteria 996
193 Ga0207662_10067860 3300025918 Bacteria 2152
194 Ga0207657_10172223 3300025919 Bacteria 1753
195 Ga0207657_10181405 3300025919 Bacteria 1702
196 Ga0207649_10382443 3300025920 Bacteria 1049
197 Ga0207681_10008948 3300025923 Bacteria 6114
198 Ga0207681_10130714 3300025923 Bacteria 1856
199 Ga0207694_10895228 3300025924 Bacteria 750
200 Ga0207687_10007421 3300025927 Bacteria 7220
201 Ga0207687_10068338 3300025927 Bacteria 2531
202 Ga0207644_10059227 3300025931 Bacteria 2770
203 Ga0207706_10411861 3300025933 Bacteria 1171
204 Ga0207686_10242385 3300025934 Bacteria 1313
205 Ga0207686_10293309 3300025934 Bacteria 1205
206 Ga0207709_10018535 3300025935 Bacteria 3899
207 Ga0207709_10137084 3300025935 Bacteria 1677
208 Ga0207670_10112489 3300025936 Bacteria 1965
209 Ga0207669_10000271 3300025937 Bacteria 23694
210 Ga0207669_10418658 3300025937 Bacteria 1054
211 Ga0207704_10001344 3300025938 Bacteria 10972
212 Ga0207665_10009948 3300025939 Bacteria 6241
213 Ga0207665_10012819 3300025939 Bacteria 5512
214 Ga0207689_10129864 3300025942 Bacteria 2074
215 Ga0207661_10301028 3300025944 Bacteria 1438
216 Ga0207667_10328234 3300025949 Bacteria 1562
217 Ga0207651_10060881 3300025960 Bacteria 2623
218 Ga0207712_10006159 3300025961 Bacteria 7563
219 Ga0207712_10547581 3300025961 Bacteria 995
220 Ga0207668_10004088 3300025972 Bacteria 8571
221 Ga0207640_10004670 3300025981 Bacteria 7435
222 Ga0207640_10230852 3300025981 Bacteria 1423
223 Ga0207658_10002751 3300025986 Bacteria 12686
224 Ga0207658_10466231 3300025986 Bacteria 1120
225 Ga0207677_10016402 3300026023 Bacteria 4387
226 Ga0207677_10030643 3300026023 Bacteria 3436
227 Ga0207677_10366817 3300026023 Bacteria 1211
228 Ga0207703_10002729 3300026035 Bacteria 15127
229 Ga0207703_10071873 3300026035 Bacteria 2858
230 Ga0207639_10008405 3300026041 Bacteria 7073
231 Ga0207639_10596419 3300026041 Bacteria 1018
232 Ga0207678_10008697 3300026067 Bacteria 8939
233 Ga0207678_10016320 3300026067 Bacteria 6519
234 Ga0207678_10078934 3300026067 Bacteria 2819
235 Ga0207708_10008676 3300026075 Bacteria 7524
236 Ga0207708_10015025 3300026075 Bacteria 5802
237 Ga0207702_10442852 3300026078 Bacteria 1259
238 Ga0207641_10440243 3300026088 Bacteria 1258
239 Ga0207648_10001982 3300026089 Bacteria 22367
240 Ga0207676_10348522 3300026095 Bacteria 1369
241 Ga0207675_100003213 3300026118 Bacteria 16025
242 Ga0207675_100138610 3300026118 Bacteria 2310
243 Ga0207675_100179340 3300026118 Bacteria 2028
244 Ga0207675_100696180 3300026118 Bacteria 1025
245 Ga0207675_100957824 3300026118 Bacteria 873
246 Ga0207683_10000874 3300026121 Bacteria 27618
247 Ga0207683_10094198 3300026121 Bacteria 2669
248 Ga0207698_10093802 3300026142 Bacteria 2466
249 Ga0207698_10266581 3300026142 Bacteria 1576
250 Ga0268266_10075534 3300028379 Bacteria 2927
251 Ga0268266_10383239 3300028379 Bacteria 1326
252 Ga0268266_10894315 3300028379 Bacteria 859
253 Ga0268265_10048422 3300028380 Bacteria 3190
254 Ga0268265_10050506 3300028380 Bacteria 3134
255 Ga0268264_10002334 3300028381 Bacteria 16769
256 Ga0268264_10482353 3300028381 Bacteria 1206
257 Ga0268264_10582534 3300028381 Bacteria 1101
258 Ga0307409_101720900 3300031995 Bacteria 656
259 Ga0307416_100948497 3300032002 Bacteria 962
260 Ga0373931_0112176 3300035691 Bacteria 1548
261 Ga0436364_0699371 3300037853 Bacteria 4336
262 Ga0436364_0946484 3300037853 Bacteria 1723
263 Ga0436364_1124629 3300037853 Bacteria 7056
264 Ga0436365_0437998 3300039437 Bacteria 29340
265 Ga0436365_0440716 3300039437 Bacteria 15038
266 Ga0436365_0681434 3300039437 Bacteria 1597
267 Ga0436365_1122234 3300039437 Bacteria 14155
268 Ga0436363_0172568 3300039450 Bacteria 676
269 Ga0436363_1676298 3300039450 Bacteria 1017
270 Ga0439461_0005667 3300041410 Bacteria 2141
271 Ga0439466_0014371 3300041411 Bacteria 2884
272 Ga0439466_0080398 3300041411 Bacteria 1028
273 Ga0439465_0005561 3300041413 Bacteria 4017
274 Ga0439465_0107896 3300041413 Bacteria 966
275 Ga0439431_0038034 3300041997 Bacteria 1216
276 Ga0439445_0005335 3300042004 Bacteria 2927
277 Ga0439445_0010081 3300042004 Bacteria 2231
278 Ga0439434_0084787 3300042435 Bacteria 1008
279 Ga0439459_0016602 3300042438 Bacteria 1362
280 Ga0466969_0181239 3300044656 Bacteria 964
281 Ga0466965_0092658 3300044683 Bacteria 1538
282 Ga0466966_0003701 3300044684 Bacteria 10082
283 Ga0466966_0024064 3300044684 Bacteria 3986
284 Ga0466966_0084336 3300044684 Bacteria 1976
285 Ga0466966_0599465 3300044684 Bacteria 663
286 Ga0466961_0121425 3300044693 Bacteria 1640
287 Ga0466963_0031021 3300044694 Bacteria 3453
288 Ga0466963_0104129 3300044694 Bacteria 1944
289 Ga0466963_0936216 3300044694 Bacteria 610
290 Ga0466964_0395572 3300044706 Bacteria 721
291 Ga0466971_0030636 3300044719 Bacteria 2408
292 Ga0466971_0099747 3300044719 Bacteria 1334
293 Ga0466968_0006930 3300044735 Bacteria 4291
294 Ga0466968_0063649 3300044735 Bacteria 1594
295 Ga0466968_0323826 3300044735 Bacteria 745
296 Ga0466970_0011211 3300044765 Bacteria 4567
297 Ga0466970_0019606 3300044765 Bacteria 3507
298 Ga0466970_0025776 3300044765 Bacteria 3080
299 Ga0466957_0023416 3300044842 Bacteria 3651
300 Ga0466957_0067930 3300044842 Bacteria 2200
301 Ga0466957_0075437 3300044842 Bacteria 2092
302 Ga0466957_0079857 3300044842 Bacteria 2036
303 Ga0466960_0000524 3300044901 Bacteria 13143
304 Ga0466960_0004253 3300044901 Bacteria 5577
305 Ga0466960_0021153 3300044901 Bacteria 2892
306 Ga0466959_0014120 3300045049 Bacteria 5796
307 Ga0466958_0050102 3300045836 Bacteria 2528
308 Ga0466958_0105300 3300045836 Bacteria 1757
309 Ga0466958_0346260 3300045836 Bacteria 956
310 Ga0466967_0015451 3300045976 Bacteria 5984
311 Ga0466967_0033996 3300045976 Bacteria 4321
312 Ga0466967_0052634 3300045976 Bacteria 3575
313 Ga0466967_0154139 3300045976 Bacteria 2150
314 Ga0466967_0660700 3300045976 Bacteria 1034
315 Ga0495638_0013470 3300046460 Bacteria 5566
316 Ga0495638_0072658 3300046460 Bacteria 2101
317 Ga0495672_0142282 3300047320 Bacteria 1252
318 Ga0495626_0075845 3300048091 Bacteria 1502
319 Ga0496100_0015136 3300048903 Bacteria 4500
320 Ga0496100_0023709 3300048903 Bacteria 3733
321 Ga0496100_0067024 3300048903 Bacteria 2383
322 Ga0496101_0000172 3300048904 Bacteria 53462
323 Ga0496101_0001046 3300048904 Bacteria 16358
324 Ga0496101_0060047 3300048904 Bacteria 2758
325 Ga0496101_0805095 3300048904 Bacteria 741
326 Ga0496101_0924982 3300048904 Bacteria 686
327 Ga0496102_0000003 3300048905 Bacteria 592263
328 Ga0496102_0020134 3300048905 Bacteria 5891
329 Ga0496102_0034019 3300048905 Bacteria 4583
330 Ga0496102_0045839 3300048905 Bacteria 3970
331 Ga0496102_0175535 3300048905 Bacteria 2017
332 Ga0496103_0000012 3300048906 Bacteria 301778
333 Ga0496103_0015221 3300048906 Bacteria 4573
334 Ga0496103_0686781 3300048906 Bacteria 649
335 Ga0496104_0106502 3300048907 Bacteria 2687
336 Ga0496104_0225499 3300048907 Bacteria 1786
337 Ga0496105_0096567 3300048908 Bacteria 2441
338 Ga0496106_0002202 3300048909 Bacteria 14552
339 Ga0496106_0034302 3300048909 Bacteria 3790
340 Ga0496106_0054709 3300048909 Bacteria 3015
341 Ga0496107_0011929 3300048910 Bacteria 6068
342 Ga0496107_0044602 3300048910 Bacteria 3188
343 Ga0496108_0000687 3300048911 Bacteria 26194
344 Ga0496108_0064031 3300048911 Bacteria 3097
345 Ga0496108_0531950 3300048911 Bacteria 1026
346 Ga0496109_0002791 3300048912 Bacteria 14627
347 Ga0496109_0187129 3300048912 Bacteria 1945
348 Ga0496110_0054171 3300048913 Bacteria 3528
349 Ga0496111_0266721 3300048914 Bacteria 1270
350 Ga0496112_0061803 3300048915 Bacteria 3693
351 Ga0496112_0194499 3300048915 Bacteria 1989
352 Ga0496112_0201250 3300048915 Bacteria 1951
353 Ga0496112_0312371 3300048915 Bacteria 1517
354 Ga0496112_0741130 3300048915 Bacteria 909
355 Ga0496113_0827103 3300048916 Bacteria 735
356 Ga0496114_0001860 3300048917 Bacteria 15987
357 Ga0496114_0120251 3300048917 Bacteria 2258
358 Ga0496114_0193338 3300048917 Bacteria 1781
359 Ga0496115_0000584 3300048918 Bacteria 27971
360 Ga0496115_0270236 3300048918 Bacteria 1397
361 Ga0496116_0000040 3300048919 Bacteria 346900
362 Ga0496117_0000003 3300048920 Bacteria 1881097
363 Ga0496118_0000001 3300048921 Bacteria 1881100
364 Ga0496118_0000452 3300048921 Bacteria 67982
365 Ga0496119_0000591 3300048922 Bacteria 49100
366 Ga0496119_0023085 3300048922 Bacteria 4427
367 Ga0496120_0000293 3300048923 Bacteria 83834
368 Ga0496120_0055759 3300048923 Bacteria 2233
369 Ga0496121_0000019 3300048924 Bacteria 499976
370 Ga0496123_0135145 3300048926 Bacteria 1358
371 Ga0496125_0068019 3300048928 Bacteria 2804
372 Ga0496126_0008979 3300048929 Bacteria 10697
373 Ga0496126_0016585 3300048929 Bacteria 7362
374 Ga0496126_0087550 3300048929 Bacteria 2744
375 Ga0496126_0412264 3300048929 Bacteria 1094
376 Ga0501031_0561182 3300049568 Bacteria 735
377 Ga0501032_0001855 3300049569 Bacteria 16721
378 Ga0501033_0012173 3300049570 Bacteria 6566
379 Ga0501034_0003235 3300049571 Bacteria 18642
380 Ga0501036_0330281 3300049572 Bacteria 1274
381 Ga0501037_0037184 3300049573 Bacteria 3588
382 Ga0501043_0017523 3300049579 Bacteria 5616
383 Ga0501046_0000969 3300049580 Bacteria 28158
384 Ga0501047_0003181 3300049581 Bacteria 15564
385 Ga0501047_0659771 3300049581 Bacteria 865
386 Ga0501048_0004345 3300049582 Bacteria 10789
387 Ga0501069_0005667 3300049585 Bacteria 6505
388 Ga0501070_0001271 3300049586 Bacteria 22663
389 Ga0501070_0029281 3300049586 Bacteria 4619
390 Ga0501070_0467161 3300049586 Bacteria 1016
391 Ga0501035_0001201 3300049822 Bacteria 26999
392 Ga0501035_0358338 3300049822 Bacteria 1219
393 Ga0501044_0002283 3300049823 Bacteria 21835
394 Ga0501044_0610743 3300049823 Bacteria 983
395 nmdc:mga03n38_146535_c1 3300050490 Bacteria 1184
396 nmdc:mga00v17_117947_c1 3300050491 Bacteria 1688
397 nmdc:mga00v17_2227_c1 3300050491 Bacteria 9954
398 nmdc:mga0yw44_56352_c1 3300050492 Bacteria 2394
399 nmdc:mga06z11_266237_c1 3300050494 Bacteria 1012
400 nmdc:mga07m45_120644_c1 3300050496 Bacteria 1514
401 nmdc:mga07m45_203489_c1 3300050496 Bacteria 1152
402 nmdc:mga0qj67_267578_c1 3300050509 Bacteria 1386
403 nmdc:mga0qj67_27086_c1 3300050509 Bacteria 4440
404 nmdc:mga0qj67_272615_c1 3300050509 Bacteria 1372
405 nmdc:mga0sz30_12554_c1 3300050516 Bacteria 3298
406 nmdc:mga0sz30_22037_c1 3300050516 Bacteria 2582
407 nmdc:mga0sz30_2281_c1 3300050516 Bacteria 6853
408 nmdc:mga0sz30_2817_c1 3300050516 Bacteria 6209
409 Ga0500643_009573 3300053087 Bacteria 3691
410 Ga0500641_0188657 3300053096 Bacteria 883
411 Ga0500562_001236 3300053108 Bacteria 6292
412 Ga0500642_0128415 3300053130 Bacteria 1187
413 Ga0500559_0064178 3300053136 Bacteria 1643
414 Ga0500568_0136457 3300053139 Bacteria 910
415 Ga0500577_0107447 3300053142 Bacteria 1148
416 Ga0500645_000070 3300053730 Bacteria 79917
417 Ga0466962_0077931 3300061719 Bacteria 1584
418 Ga0466962_0078248 3300061719 Bacteria 1581
419 2738704708 2738541274 Bacteria 6909446
420 2739329877 2738543028 Bacteria 6917070
421 2842136702 2842134933 Bacteria 5847019
422 2902792905 2902792274 Bacteria 7270173
423 2902841836 2902837492 Bacteria 6697721
424 2929213690 2929212328 Bacteria 7708288
425 Ga0081540_1110744
426 JGI24746J21847_1011250
427 JGI24737J22298_10050680
428 JGI24743J22301_10000444
429 JGI24745J21846_1000671
430 JGI24749J21850_1015499
431 JGI24744J21845_10000472
432 JGI24744J21845_10002773
433 Ga0070676_10012022
434 Ga0070683_100440986
435 Ga0070690_100072521
436 Ga0070677_10103181
437 Ga0068869_100186290
438 Ga0070666_10074530
439 Ga0070666_10373530
440 Ga0068868_100001453
441 Ga0068868_100016326
442 Ga0068868_100218963
443 Ga0068868_100680550
444 Ga0070660_100218419
445 Ga0070691_10008585
446 Ga0070691_10228877
447 Ga0070691_10239641
448 Ga0070687_100053168
449 Ga0070687_100251677
450 Ga0070668_100006407
451 Ga0070669_100627304
452 Ga0070675_100789085
453 Ga0070671_100104015
454 Ga0070671_100744681
455 Ga0070674_100007936
456 Ga0070674_100654901
457 Ga0070673_100104101
458 Ga0070688_100238480
459 Ga0070659_100080318
460 Ga0070659_100173257
461 Ga0070667_100003133
462 Ga0070667_100494275
463 Ga0070703_10022147
464 Ga0070709_10020567
465 Ga0070709_10024767
466 Ga0070714_100463717
467 Ga0070714_101090857
468 Ga0070713_100041868
469 Ga0070713_100139409
470 Ga0070710_10001014
471 Ga0070701_10036479
472 Ga0070711_100000280
473 Ga0070711_100096702
474 Ga0070705_100179158
475 Ga0070700_100004174
476 Ga0070700_100049175
477 Ga0070694_100006083
478 Ga0070708_100782472
479 Ga0070663_100002851
480 Ga0070663_100022570
481 Ga0070678_100000626
482 Ga0070678_100625694
483 Ga0068867_100000835
484 Ga0068867_101354430
485 Ga0070685_10029477
486 Ga0070685_10359211
487 Ga0070707_100420023
488 Ga0070684_100144900
489 Ga0070697_100821620
490 Ga0068853_100011755
491 Ga0070672_100100581
492 Ga0070686_100040113
493 Ga0070695_100080609
494 Ga0070696_100041424
495 Ga0070696_100112038
496 Ga0070693_100001856
497 Ga0070693_100123822
498 Ga0070693_100844752
499 Ga0070665_100028263
500 Ga0070665_100149567
501 Ga0070665_101228472
502 Ga0070704_100012290
503 Ga0070704_100135587
504 Ga0070704_100988686
505 Ga0068855_100041253
506 Ga0068854_100000551
507 Ga0068854_100160510
508 Ga0068856_100222756
509 Ga0070702_100000921
510 Ga0068852_100045499
511 Ga0068852_100122541
512 Ga0068859_100096139
513 Ga0068859_100239718
514 Ga0068866_10007520
515 Ga0068861_100012218
516 Ga0068861_100030369
517 Ga0068870_10142640
518 Ga0068863_100639133
519 Ga0068858_100021054
520 Ga0068858_100284552
521 Ga0068860_100001259
522 Ga0068860_100047670
523 Ga0068860_100170286
524 Ga0068862_100063531
525 Ga0081455_10038392
526 Ga0081538_10065408
527 Ga0070717_10991503
528 Ga0075365_10054183
529 Ga0075363_100189806
530 Ga0075364_10020084
531 Ga0075364_10622824
532 Ga0070715_10000966
533 Ga0070716_100026066
534 Ga0070712_100000899
535 Ga0070712_100003164
536 Ga0075367_10299417
537 Ga0075367_10439320
538 Ga0075369_10002129
539 Ga0075369_10002208
540 Ga0075369_10006876
541 Ga0075369_10032605
542 Ga0097621_100116191
543 Ga0075370_10055685
544 Ga0075370_10159152
545 Ga0068871_100220462
546 Ga0075430_100021855
547 Ga0075430_100290996
548 Ga0068865_100001854
549 Ga0068865_100121125
550 Ga0097620_100096128
551 Ga0097620_100239721
552 Ga0105250_10090533
553 Ga0105245_10017664
554 Ga0105245_10047102
555 Ga0105245_10341867
556 Ga0105247_10001612
557 Ga0105247_10622907
558 Ga0105243_10013360
559 Ga0105243_10183824
560 Ga0105241_10160408
561 Ga0105242_10002300
562 Ga0105242_10105959
563 Ga0105248_10004806
564 Ga0105237_10025156
565 Ga0105237_10143692
566 Ga0105237_11005720
567 Ga0105238_10446767
568 Ga0105238_11191741
569 Ga0105249_10001128
570 Ga0105249_10127895
571 Ga0105249_10732259
572 Ga0105239_10012717
573 Ga0105246_10131243
574 Ga0105246_10279991
575 Ga0157371_10205117
576 Ga0157369_10229067
577 Ga0157374_10038816
578 Ga0157378_10001538
579 Ga0157378_10893198
580 Ga0163162_10023272
581 Ga0163162_10993923
582 Ga0157372_10016361
583 Ga0157375_10001296
584 Ga0157375_10108676
585 Ga0157380_10012747
586 Ga0157377_10004472
587 Ga0157377_10144191
588 Ga0157379_10075650
589 Ga0163161_10005267
590 Ga0163161_10028599
591 Ga0213876_10009975
592 Ga0213876_10013880
593 Ga0213875_10018290
594 Ga0207653_10021879
595 Ga0207682_10191357
596 Ga0207692_10003160
597 Ga0207692_10534546
598 Ga0207642_10000244
599 Ga0207642_10011989
600 Ga0207710_10021270
601 Ga0207688_10002485
602 Ga0207688_10021188
603 Ga0207680_10046828
604 Ga0207647_10126835
605 Ga0207699_10078807
606 Ga0207699_10472288
607 Ga0207645_10077039
608 Ga0207643_10071949
609 Ga0207654_10159369
610 Ga0207671_10024709
611 Ga0207671_10080547
612 Ga0207693_10000638
613 Ga0207693_10002063
614 Ga0207663_10000215
615 Ga0207663_10315899
616 Ga0207663_10447130
617 Ga0207662_10067860
618 Ga0207657_10172223
619 Ga0207657_10181405
620 Ga0207649_10382443
621 Ga0207681_10008948
622 Ga0207681_10130714
623 Ga0207694_10895228
624 Ga0207687_10007421
625 Ga0207687_10068338
626 Ga0207644_10059227
627 Ga0207706_10411861
628 Ga0207686_10242385
629 Ga0207686_10293309
630 Ga0207709_10018535
631 Ga0207709_10137084
632 Ga0207670_10112489
633 Ga0207669_10000271
634 Ga0207669_10418658
635 Ga0207704_10001344
636 Ga0207665_10009948
637 Ga0207665_10012819
638 Ga0207689_10129864
639 Ga0207661_10301028
640 Ga0207667_10328234
641 Ga0207651_10060881
642 Ga0207712_10006159
643 Ga0207712_10547581
644 Ga0207668_10004088
645 Ga0207640_10004670
646 Ga0207640_10230852
647 Ga0207658_10002751
648 Ga0207658_10466231
649 Ga0207677_10016402
650 Ga0207677_10030643
651 Ga0207677_10366817
652 Ga0207703_10002729
653 Ga0207703_10071873
654 Ga0207639_10008405
655 Ga0207639_10596419
656 Ga0207678_10008697
657 Ga0207678_10016320
658 Ga0207678_10078934
659 Ga0207708_10008676
660 Ga0207708_10015025
661 Ga0207702_10442852
662 Ga0207641_10440243
663 Ga0207648_10001982
664 Ga0207676_10348522
665 Ga0207675_100003213
666 Ga0207675_100138610
667 Ga0207675_100179340
668 Ga0207675_100696180
669 Ga0207675_100957824
670 Ga0207683_10000874
671 Ga0207683_10094198
672 Ga0207698_10093802
673 Ga0207698_10266581
674 Ga0268266_10075534
675 Ga0268266_10383239
676 Ga0268266_10894315
677 Ga0268265_10048422
678 Ga0268265_10050506
679 Ga0268264_10002334
680 Ga0268264_10482353
681 Ga0268264_10582534
682 Ga0307409_101720900
683 Ga0307416_100948497
684 Ga0373931_0112176
685 Ga0436364_0699371
686 Ga0436364_0946484
687 Ga0436364_1124629
688 Ga0436365_0437998
689 Ga0436365_0440716
690 Ga0436365_0681434
691 Ga0436365_1122234
692 Ga0436363_0172568
693 Ga0436363_1676298
694 Ga0439461_0005667
695 Ga0439466_0014371
696 Ga0439466_0080398
697 Ga0439465_0005561
698 Ga0439465_0107896
699 Ga0439431_0038034
700 Ga0439445_0005335
701 Ga0439445_0010081
702 Ga0439434_0084787
703 Ga0439459_0016602
704 Ga0466969_0181239
705 Ga0466965_0092658
706 Ga0466966_0003701
707 Ga0466966_0024064
708 Ga0466966_0084336
709 Ga0466966_0599465
710 Ga0466961_0121425
711 Ga0466963_0031021
712 Ga0466963_0104129
713 Ga0466963_0936216
714 Ga0466964_0395572
715 Ga0466971_0030636
716 Ga0466971_0099747
717 Ga0466968_0006930
718 Ga0466968_0063649
719 Ga0466968_0323826
720 Ga0466970_0011211
721 Ga0466970_0019606
722 Ga0466970_0025776
723 Ga0466957_0023416
724 Ga0466957_0067930
725 Ga0466957_0075437
726 Ga0466957_0079857
727 Ga0466960_0000524
728 Ga0466960_0004253
729 Ga0466960_0021153
730 Ga0466959_0014120
731 Ga0466958_0050102
732 Ga0466958_0105300
733 Ga0466958_0346260
734 Ga0466967_0015451
735 Ga0466967_0033996
736 Ga0466967_0052634
737 Ga0466967_0154139
738 Ga0466967_0660700
739 Ga0495638_0013470
740 Ga0495638_0072658
741 Ga0495672_0142282
742 Ga0495626_0075845
743 Ga0496100_0015136
744 Ga0496100_0023709
745 Ga0496100_0067024
746 Ga0496101_0000172
747 Ga0496101_0001046
748 Ga0496101_0060047
749 Ga0496101_0805095
750 Ga0496101_0924982
751 Ga0496102_0000003
752 Ga0496102_0020134
753 Ga0496102_0034019
754 Ga0496102_0045839
755 Ga0496102_0175535
756 Ga0496103_0000012
757 Ga0496103_0015221
758 Ga0496103_0686781
759 Ga0496104_0106502
760 Ga0496104_0225499
761 Ga0496105_0096567
762 Ga0496106_0002202
763 Ga0496106_0034302
764 Ga0496106_0054709
765 Ga0496107_0011929
766 Ga0496107_0044602
767 Ga0496108_0000687
768 Ga0496108_0064031
769 Ga0496108_0531950
770 Ga0496109_0002791
771 Ga0496109_0187129
772 Ga0496110_0054171
773 Ga0496111_0266721
774 Ga0496112_0061803
775 Ga0496112_0194499
776 Ga0496112_0201250
777 Ga0496112_0312371
778 Ga0496112_0741130
779 Ga0496113_0827103
780 Ga0496114_0001860
781 Ga0496114_0120251
782 Ga0496114_0193338
783 Ga0496115_0000584
784 Ga0496115_0270236
785 Ga0496116_0000040
786 Ga0496117_0000003
787 Ga0496118_0000001
788 Ga0496118_0000452
789 Ga0496119_0000591
790 Ga0496119_0023085
791 Ga0496120_0000293
792 Ga0496120_0055759
793 Ga0496121_0000019
794 Ga0496123_0135145
795 Ga0496125_0068019
796 Ga0496126_0008979
797 Ga0496126_0016585
798 Ga0496126_0087550
799 Ga0496126_0412264
800 Ga0501031_0561182
801 Ga0501032_0001855
802 Ga0501033_0012173
803 Ga0501034_0003235
804 Ga0501036_0330281
805 Ga0501037_0037184
806 Ga0501043_0017523
807 Ga0501046_0000969
808 Ga0501047_0003181
809 Ga0501047_0659771
810 Ga0501048_0004345
811 Ga0501069_0005667
812 Ga0501070_0001271
813 Ga0501070_0029281
814 Ga0501070_0467161
815 Ga0501035_0001201
816 Ga0501035_0358338
817 Ga0501044_0002283
818 Ga0501044_0610743
819 nmdc:mga03n38_146535_c1
820 nmdc:mga00v17_117947_c1
821 nmdc:mga00v17_2227_c1
822 nmdc:mga0yw44_56352_c1
823 nmdc:mga06z11_266237_c1
824 nmdc:mga07m45_120644_c1
825 nmdc:mga07m45_203489_c1
826 nmdc:mga0qj67_267578_c1
827 nmdc:mga0qj67_27086_c1
828 nmdc:mga0qj67_272615_c1
829 nmdc:mga0sz30_12554_c1
830 nmdc:mga0sz30_22037_c1
831 nmdc:mga0sz30_2281_c1
832 nmdc:mga0sz30_2817_c1
833 Ga0500643_009573
834 Ga0500641_0188657
835 Ga0500562_001236
836 Ga0500642_0128415
837 Ga0500559_0064178
838 Ga0500568_0136457
839 Ga0500577_0107447
840 Ga0500645_000070
841 Ga0466962_0077931
842 Ga0466962_0078248
843 2738704708
844 2739329877
845 2842136702
846 2902792905
847 2902841836
848 2929213690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

14

172

0.94

PF12867

DinB_2

DinB superfamily

19

163

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.769 7 164
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.7534 10 151
5cof-assembly1.cif.gz_A crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 0.7532 12 161
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.7527 10 151
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7443 11 152
ID Description Score Start End Superfamily
5civA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7538 8 163 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7534 10 151 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7397 1 160 1.20.120.450
5cofA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7278 12 161 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7236 8 153 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1A3NKP4-F1-model_v4 DinB family protein 0.9188 8 185
AF-A0A2S9FH80-F1-model_v4 DinB family protein 0.8836 1 143
AF-A0A6I6GFS1-F1-model_v4 DinB-like domain-containing protein 0.879 1 174
AF-A0A5C4LYS5-F1-model_v4 DinB family protein 0.8656 1 187
AF-A0A7Y9JR28-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.8641 1 187

Map