F440746

General Info

Members Datasets Scaffolds Average Seq Length
424 218 424 129

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10001964|Ga0105248_100019642
Length 147
Sequence MVSPAALAACRFAAMSRMVLAAASAALVGVSILALGACSKKVTPPGDAGVCYNVTFRANGELIYHRLVKAPNLETCAANLEAMRIKFLRLGGTAQEILGAYQSNFIFVQKTGIFSGASLNGPRYPALVRTGDGRLAIPGAMPQQPTQ

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
192 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
193 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
196 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
199 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
200 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
207 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
208 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
209 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
210 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
213 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
216 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
217 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
218 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.39
Nodule 0.24
Rhizoplane 4.01
Rhizosphere 78.07
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10001202 3300003794 Bacteria 19850
2 Ga0055531_10035051 3300003794 Bacteria 1579
3 Ga0065165_1000238 3300005262 Bacteria 95406
4 Ga0070658_10072166 3300005327 Bacteria 2828
5 Ga0070658_10301323 3300005327 Bacteria 1367
6 Ga0070658_10790132 3300005327 Bacteria 825
7 Ga0070658_11658696 3300005327 Bacteria 554
8 Ga0070683_100691258 3300005329 Bacteria 977
9 Ga0070670_100000128 3300005331 Bacteria 71585
10 Ga0070670_100136342 3300005331 Bacteria 2121
11 Ga0070670_101310118 3300005331 Bacteria 663
12 Ga0070666_10014900 3300005335 Bacteria 4953
13 Ga0070666_10217804 3300005335 Bacteria 1346
14 Ga0070680_100009960 3300005336 Bacteria 7321
15 Ga0070680_100332466 3300005336 Bacteria 1290
16 Ga0068868_100196964 3300005338 Bacteria 1678
17 Ga0068868_100530260 3300005338 Unclassified 1035
18 Ga0070660_100021896 3300005339 Bacteria 4720
19 Ga0070660_100067860 3300005339 Bacteria 2779
20 Ga0070660_100121366 3300005339 Bacteria 2086
21 Ga0070691_10003012 3300005341 Bacteria 7540
22 Ga0070661_100362775 3300005344 Bacteria 1139
23 Ga0070668_100000584 3300005347 Bacteria 24454
24 Ga0070668_100004146 3300005347 Bacteria 10732
25 Ga0070669_100001021 3300005353 Bacteria 20402
26 Ga0070671_100000209 3300005355 Bacteria 38883
27 Ga0070671_100057897 3300005355 Bacteria 3226
28 Ga0070671_100072739 3300005355 Bacteria 2871
29 Ga0070671_100826992 3300005355 Bacteria 807
30 Ga0070673_100117223 3300005364 Bacteria 2216
31 Ga0070673_101719603 3300005364 Unclassified 594
32 Ga0070659_100005496 3300005366 Bacteria 9103
33 Ga0070659_100008686 3300005366 Bacteria 7429
34 Ga0070659_101970671 3300005366 Unclassified 524
35 Ga0070667_100000169 3300005367 Bacteria 81539
36 Ga0070667_100002073 3300005367 Bacteria 17732
37 Ga0070667_100100932 3300005367 Bacteria 2492
38 Ga0070667_101003643 3300005367 Bacteria 779
39 Ga0070662_100535829 3300005457 Bacteria 980
40 Ga0070681_10006518 3300005458 Bacteria 11361
41 Ga0070681_10007397 3300005458 Bacteria 10737
42 Ga0070681_10180475 3300005458 Bacteria 2032
43 Ga0070681_11290137 3300005458 Unclassified 653
44 Ga0070706_100653461 3300005467 Bacteria 976
45 Ga0070679_100024513 3300005530 Bacteria 5912
46 Ga0070679_100037636 3300005530 Bacteria 4807
47 Ga0068853_100018374 3300005539 Bacteria 5786
48 Ga0068853_100099031 3300005539 Bacteria 2575
49 Ga0068853_100289449 3300005539 Bacteria 1512
50 Ga0068853_101494309 3300005539 Bacteria 654
51 Ga0070665_100000166 3300005548 Bacteria 120121
52 Ga0070665_100001054 3300005548 Bacteria 34499
53 Ga0070665_100001083 3300005548 Bacteria 33888
54 Ga0070665_100022410 3300005548 Bacteria 6356
55 Ga0070665_100034481 3300005548 Bacteria 5090
56 Ga0068855_100015798 3300005563 Bacteria 9083
57 Ga0068855_100091379 3300005563 Bacteria 3511
58 Ga0068855_100111548 3300005563 Bacteria 3139
59 Ga0068855_100134234 3300005563 Bacteria 2824
60 Ga0068855_100142356 3300005563 Bacteria 2732
61 Ga0068855_100790996 3300005563 Bacteria 1009
62 Ga0068855_101236793 3300005563 Bacteria 775
63 Ga0070664_100975846 3300005564 Bacteria 796
64 Ga0068857_100756841 3300005577 Bacteria 926
65 Ga0068857_100925315 3300005577 Bacteria 837
66 Ga0068857_102226301 3300005577 Bacteria 538
67 Ga0068854_100190939 3300005578 Bacteria 1605
68 Ga0068854_101485744 3300005578 Bacteria 615
69 Ga0068856_100051983 3300005614 Bacteria 4040
70 Ga0068856_100415151 3300005614 Bacteria 1366
71 Ga0068856_100523361 3300005614 Bacteria 1207
72 Ga0068852_100052121 3300005616 Bacteria 3516
73 Ga0068852_101461988 3300005616 Bacteria 706
74 Ga0068859_100014692 3300005617 Bacteria 7869
75 Ga0068864_100000461 3300005618 Bacteria 35261
76 Ga0068864_100006430 3300005618 Bacteria 9628
77 Ga0068864_100017078 3300005618 Bacteria 6049
78 Ga0068864_100231267 3300005618 Bacteria 1710
79 Ga0068864_100503440 3300005618 Bacteria 1166
80 Ga0068864_100590470 3300005618 Bacteria 1077
81 Ga0068861_101497273 3300005719 Bacteria 662
82 Ga0068863_100000101 3300005841 Bacteria 92384
83 Ga0068863_100000185 3300005841 Bacteria 66169
84 Ga0068863_100004288 3300005841 Bacteria 14042
85 Ga0068863_100197578 3300005841 Bacteria 1934
86 Ga0068863_100426359 3300005841 Bacteria 1300
87 Ga0068863_101326405 3300005841 Bacteria 727
88 Ga0068858_100000271 3300005842 Bacteria 55626
89 Ga0068858_100017927 3300005842 Bacteria 6631
90 Ga0068858_100037391 3300005842 Bacteria 4502
91 Ga0068860_100000211 3300005843 Bacteria 91286
92 Ga0068860_100902930 3300005843 Bacteria 899
93 Ga0068862_100004607 3300005844 Bacteria 11619
94 Ga0068862_100018538 3300005844 Bacteria 5797
95 Ga0068862_100168930 3300005844 Bacteria 1957
96 Ga0075364_10006432 3300006051 Bacteria 6900
97 Ga0075362_10007026 3300006177 Bacteria 4230
98 Ga0075367_10000091 3300006178 Bacteria 24634
99 Ga0075369_10179383 3300006186 Unclassified 974
100 Ga0075370_10124952 3300006353 Bacteria 1499
101 Ga0075370_10230327 3300006353 Bacteria 1096
102 Ga0075370_10439346 3300006353 Bacteria 785
103 Ga0068871_100202995 3300006358 Bacteria 1712
104 Ga0068871_100749079 3300006358 Bacteria 898
105 Ga0068865_100000477 3300006881 Bacteria 22364
106 Ga0097620_100014692 3300006931 Bacteria 7869
107 Ga0079104_1006342 3300006946 Bacteria 4499
108 Ga0105240_10014610 3300009093 Bacteria 10714
109 Ga0105240_10021821 3300009093 Bacteria 8509
110 Ga0105240_10124497 3300009093 Bacteria 3100
111 Ga0105240_10188267 3300009093 Bacteria 2429
112 Ga0105240_10335001 3300009093 Bacteria 1720
113 Ga0105240_10940865 3300009093 Bacteria 927
114 Ga0105247_10593842 3300009101 Bacteria 820
115 Ga0105247_10756694 3300009101 Bacteria 737
116 Ga0105241_10092021 3300009174 Bacteria 2394
117 Ga0105241_10565146 3300009174 Bacteria 1023
118 Ga0105242_10292775 3300009176 Bacteria 1483
119 Ga0105248_10000349 3300009177 Bacteria 54104
120 Ga0105248_10001964 3300009177 Bacteria 22859
121 Ga0105248_10002901 3300009177 Bacteria 19023
122 Ga0105248_10152147 3300009177 Bacteria 2611
123 Ga0105237_11032870 3300009545 Bacteria 829
124 Ga0105237_12036728 3300009545 Bacteria 583
125 Ga0105238_10008802 3300009551 Bacteria 10098
126 Ga0105238_10022843 3300009551 Bacteria 6376
127 Ga0105238_10062342 3300009551 Bacteria 3729
128 Ga0105238_10120825 3300009551 Bacteria 2599
129 Ga0105238_10212646 3300009551 Bacteria 1910
130 Ga0105238_11148204 3300009551 Bacteria 800
131 Ga0105238_11186018 3300009551 Bacteria 788
132 Ga0105249_10011669 3300009553 Bacteria 7726
133 Ga0105249_10230915 3300009553 Bacteria 1825
134 Ga0105249_10332894 3300009553 Bacteria 1533
135 Ga0105249_10588763 3300009553 Bacteria 1166
136 Ga0105239_10322009 3300010375 Bacteria 1743
137 Ga0105239_10794894 3300010375 Bacteria 1084
138 Ga0105239_10919170 3300010375 Bacteria 1004
139 Ga0105239_11069072 3300010375 Bacteria 929
140 Ga0157373_10128569 3300013100 Bacteria 1782
141 Ga0157373_11124161 3300013100 Bacteria 590
142 Ga0157370_10702671 3300013104 Bacteria 923
143 Ga0157370_11243838 3300013104 Bacteria 671
144 Ga0157370_11243839 3300013104 Bacteria 671
145 Ga0157369_10577299 3300013105 Bacteria 1161
146 Ga0157369_10885416 3300013105 Bacteria 916
147 Ga0157369_11859755 3300013105 Bacteria 611
148 Ga0157374_10346912 3300013296 Bacteria 1474
149 Ga0157374_11366378 3300013296 Bacteria 731
150 Ga0163162_10030710 3300013306 Bacteria 5324
151 Ga0163162_10071116 3300013306 Bacteria 3532
152 Ga0163162_10200294 3300013306 Bacteria 2125
153 Ga0163162_10521947 3300013306 Bacteria 1317
154 Ga0163162_11184139 3300013306 Bacteria 867
155 Ga0163162_11208013 3300013306 Bacteria 858
156 Ga0157372_10317811 3300013307 Bacteria 1813
157 Ga0157372_11090951 3300013307 Bacteria 924
158 Ga0157375_10072533 3300013308 Bacteria 3460
159 Ga0157375_10230725 3300013308 Bacteria 2010
160 Ga0163163_10005594 3300014325 Bacteria 10887
161 Ga0163163_10046696 3300014325 Bacteria 4254
162 Ga0163163_10142988 3300014325 Bacteria 2435
163 Ga0163163_10230021 3300014325 Bacteria 1903
164 Ga0157379_10000119 3300014968 Bacteria 54670
165 Ga0157379_10026246 3300014968 Bacteria 5185
166 Ga0157379_10164251 3300014968 Bacteria 2004
167 Ga0157379_10318815 3300014968 Bacteria 1419
168 Ga0157379_10628459 3300014968 Bacteria 1004
169 Ga0157376_11503099 3300014969 Unclassified 706
170 Ga0157376_12109894 3300014969 Unclassified 602
171 Ga0163161_10128981 3300017792 Bacteria 1906
172 Ga0163161_11551996 3300017792 Unclassified 583
173 Ga0213876_10010735 3300021384 Bacteria 4908
174 Ga0209026_1000438 3300025250 Bacteria 34415
175 Ga0209148_1009219 3300025254 Bacteria 1936
176 Ga0209758_1002163 3300025297 Bacteria 20648
177 Ga0209050_1000031 3300025298 Bacteria 458181
178 Ga0209257_1000073 3300025304 Bacteria 325833
179 Ga0209257_1003363 3300025304 Bacteria 13812
180 Ga0207710_10520875 3300025900 Bacteria 618
181 Ga0207680_10013586 3300025903 Bacteria 4189
182 Ga0207647_10427003 3300025904 Bacteria 745
183 Ga0207705_10002325 3300025909 Bacteria 14703
184 Ga0207705_10116433 3300025909 Bacteria 1979
185 Ga0207705_10168677 3300025909 Bacteria 1647
186 Ga0207654_10045443 3300025911 Bacteria 2499
187 Ga0207707_10013900 3300025912 Bacteria 7019
188 Ga0207707_10050870 3300025912 Bacteria 3608
189 Ga0207695_10008571 3300025913 Bacteria 12778
190 Ga0207695_10010341 3300025913 Bacteria 11422
191 Ga0207695_10038076 3300025913 Bacteria 5183
192 Ga0207695_10053103 3300025913 Bacteria 4241
193 Ga0207695_10064182 3300025913 Bacteria 3782
194 Ga0207695_10568772 3300025913 Bacteria 1015
195 Ga0207695_10768595 3300025913 Bacteria 844
196 Ga0207695_11134501 3300025913 Bacteria 662
197 Ga0207671_11267322 3300025914 Bacteria 575
198 Ga0207660_10000991 3300025917 Bacteria 18818
199 Ga0207660_10067517 3300025917 Bacteria 2590
200 Ga0207660_10072765 3300025917 Bacteria 2504
201 Ga0207660_11253134 3300025917 Bacteria 603
202 Ga0207657_10022898 3300025919 Bacteria 5830
203 Ga0207657_10025186 3300025919 Bacteria 5491
204 Ga0207657_10035152 3300025919 Bacteria 4497
205 Ga0207649_10310394 3300025920 Bacteria 1156
206 Ga0207652_10003485 3300025921 Bacteria 12965
207 Ga0207652_10098460 3300025921 Bacteria 2579
208 Ga0207681_10067749 3300025923 Bacteria 2476
209 Ga0207681_10902883 3300025923 Bacteria 740
210 Ga0207694_10006764 3300025924 Bacteria 8706
211 Ga0207694_10015710 3300025924 Bacteria 5710
212 Ga0207694_10038044 3300025924 Bacteria 3699
213 Ga0207694_10472772 3300025924 Bacteria 1048
214 Ga0207650_10000315 3300025925 Bacteria 47489
215 Ga0207650_10066714 3300025925 Bacteria 2699
216 Ga0207650_10071049 3300025925 Bacteria 2618
217 Ga0207687_11154543 3300025927 Bacteria 665
218 Ga0207644_10000679 3300025931 Bacteria 21492
219 Ga0207644_11324580 3300025931 Bacteria 605
220 Ga0207690_10000110 3300025932 Bacteria 67145
221 Ga0207706_10143324 3300025933 Bacteria 2102
222 Ga0207686_10181759 3300025934 Bacteria 1492
223 Ga0207704_10053659 3300025938 Bacteria 2452
224 Ga0207691_10764346 3300025940 Bacteria 813
225 Ga0207711_10001488 3300025941 Bacteria 21817
226 Ga0207711_10002092 3300025941 Bacteria 18020
227 Ga0207711_10030505 3300025941 Bacteria 4547
228 Ga0207711_10083758 3300025941 Bacteria 2790
229 Ga0207711_10095107 3300025941 Bacteria 2627
230 Ga0207679_10603880 3300025945 Bacteria 989
231 Ga0207667_10030621 3300025949 Bacteria 5818
232 Ga0207667_10054954 3300025949 Bacteria 4187
233 Ga0207667_10080956 3300025949 Bacteria 3364
234 Ga0207667_10118117 3300025949 Bacteria 2733
235 Ga0207651_10105381 3300025960 Bacteria 2103
236 Ga0207712_10000203 3300025961 Bacteria 59867
237 Ga0207712_10200669 3300025961 Bacteria 1581
238 Ga0207712_10237659 3300025961 Bacteria 1466
239 Ga0207712_10589677 3300025961 Bacteria 960
240 Ga0207668_10000007 3300025972 Bacteria 190613
241 Ga0207668_10000427 3300025972 Bacteria 26560
242 Ga0207668_10015262 3300025972 Bacteria 4768
243 Ga0207640_12115474 3300025981 Unclassified 510
244 Ga0207658_10000052 3300025986 Bacteria 128748
245 Ga0207658_10001368 3300025986 Bacteria 19037
246 Ga0207658_10002402 3300025986 Bacteria 13707
247 Ga0207703_10000105 3300026035 Bacteria 99702
248 Ga0207703_10002806 3300026035 Bacteria 14880
249 Ga0207703_10003669 3300026035 Bacteria 12795
250 Ga0207703_10805048 3300026035 Bacteria 897
251 Ga0207639_10020203 3300026041 Bacteria 4764
252 Ga0207639_10032985 3300026041 Bacteria 3817
253 Ga0207639_10733818 3300026041 Bacteria 918
254 Ga0207678_10667327 3300026067 Bacteria 914
255 Ga0207702_10044955 3300026078 Bacteria 3714
256 Ga0207702_10234947 3300026078 Bacteria 1715
257 Ga0207702_10521776 3300026078 Bacteria 1160
258 Ga0207702_11347822 3300026078 Bacteria 707
259 Ga0207641_10000109 3300026088 Bacteria 121126
260 Ga0207641_10002888 3300026088 Bacteria 15554
261 Ga0207641_10048330 3300026088 Bacteria 3590
262 Ga0207641_11226491 3300026088 Bacteria 750
263 Ga0207641_12153552 3300026088 Unclassified 558
264 Ga0207676_10000159 3300026095 Bacteria 59242
265 Ga0207676_10000380 3300026095 Bacteria 37876
266 Ga0207676_10642068 3300026095 Bacteria 1023
267 Ga0207676_10671857 3300026095 Bacteria 1001
268 Ga0207676_11302553 3300026095 Bacteria 721
269 Ga0207676_11747748 3300026095 Bacteria 620
270 Ga0207674_10629654 3300026116 Bacteria 1036
271 Ga0207675_100245098 3300026118 Bacteria 1733
272 Ga0207675_101521849 3300026118 Bacteria 690
273 Ga0207698_10049003 3300026142 Bacteria 3212
274 Ga0207698_10681816 3300026142 Bacteria 1021
275 Ga0209981_1024681 3300027378 Bacteria 868
276 Ga0210000_1014333 3300027462 Bacteria 1187
277 Ga0209999_1050393 3300027543 Bacteria 786
278 Ga0209983_1014102 3300027665 Bacteria 1645
279 Ga0209813_10025991 3300027866 Bacteria 1689
280 Ga0268266_10000005 3300028379 Bacteria 1448194
281 Ga0268266_10002189 3300028379 Bacteria 21374
282 Ga0268266_10016087 3300028379 Bacteria 6395
283 Ga0268266_10117572 3300028379 Bacteria 2363
284 Ga0268266_10313179 3300028379 Bacteria 1467
285 Ga0268266_10747761 3300028379 Bacteria 943
286 Ga0268265_10043150 3300028380 Bacteria 3350
287 Ga0268265_10122275 3300028380 Bacteria 2146
288 Ga0268264_10000270 3300028381 Bacteria 90954
289 Ga0268264_10062103 3300028381 Bacteria 3136
290 Ga0307517_10002579 3300028786 Bacteria 28853
291 Ga0307517_10202890 3300028786 Bacteria 1236
292 Ga0307517_10304502 3300028786 Bacteria 891
293 Ga0265327_10041467 3300031251 Bacteria 2481
294 Ga0307513_10000082 3300031456 Bacteria 131779
295 Ga0307513_10001556 3300031456 Bacteria 32890
296 Ga0307513_10063077 3300031456 Bacteria 3912
297 Ga0307513_10805389 3300031456 Bacteria 645
298 Ga0307414_10109182 3300032004 Bacteria 2101
299 Ga0307510_10002252 3300033180 Bacteria 21803
300 Ga0373926_0034141 3300035083 Bacteria 1800
301 Ga0373936_0117928 3300035113 Bacteria 1131
302 Ga0373941_0112017 3300035115 Bacteria 963
303 Ga0373946_0030169 3300035171 Bacteria 2163
304 Ga0373935_0256700 3300035692 Bacteria 1225
305 Ga0373927_0000296 3300035695 Bacteria 39241
306 Ga0373925_0000022 3300037068 Bacteria 160046
307 Ga0373925_0016787 3300037068 Bacteria 5301
308 Ga0395900_0000010 3300037418 Bacteria 461364
309 Ga0395900_0189122 3300037418 Bacteria 2089
310 Ga0395898_0011688 3300037466 Bacteria 9105
311 Ga0395898_0035191 3300037466 Bacteria 4984
312 Ga0395905_0006685 3300037471 Bacteria 11554
313 Ga0395905_0027996 3300037471 Bacteria 5313
314 Ga0395905_0216090 3300037471 Bacteria 1795
315 Ga0395905_0563739 3300037471 Bacteria 1040
316 Ga0395905_0726188 3300037471 Bacteria 896
317 Ga0395905_0797833 3300037471 Bacteria 847
318 Ga0395901_0000007 3300038443 Bacteria 497408
319 Ga0395901_0069664 3300038443 Bacteria 3663
320 Ga0436365_0434950 3300039437 Bacteria 6979
321 Ga0439445_0114771 3300042004 Bacteria 770
322 Ga0466961_0644410 3300044693 Bacteria 636
323 Ga0466964_0236439 3300044706 Unclassified 894
324 Ga0466960_0067936 3300044901 Bacteria 1767
325 Ga0466960_0711481 3300044901 Bacteria 603
326 Ga0495629_0013275 3300046459 Bacteria 5947
327 Ga0495651_0571732 3300046462 Bacteria 716
328 Ga0495650_0132728 3300046471 Bacteria 907
329 Ga0495583_0333355 3300046506 Unclassified 600
330 Ga0495628_0487141 3300046516 Bacteria 892
331 Ga0495630_0560066 3300046517 Bacteria 876
332 Ga0495643_0030203 3300046522 Bacteria 3028
333 Ga0495642_0045730 3300046528 Bacteria 1789
334 Ga0495642_0201814 3300046528 Bacteria 867
335 Ga0495642_0266762 3300046528 Bacteria 749
336 Ga0495586_0859640 3300046535 Bacteria 523
337 Ga0495597_0006638 3300046542 Bacteria 5962
338 Ga0495645_0556780 3300046543 Bacteria 710
339 Ga0495622_0019238 3300046557 Bacteria 3180
340 Ga0495656_0549586 3300046615 Bacteria 615
341 Ga0495668_0067408 3300046616 Bacteria 1969
342 Ga0495668_0081273 3300046616 Bacteria 1778
343 Ga0495668_0127482 3300046616 Bacteria 1393
344 Ga0495668_0509955 3300046616 Unclassified 663
345 Ga0495668_0712595 3300046616 Bacteria 555
346 Ga0495611_0015583 3300046648 Bacteria 3249
347 Ga0495661_0626559 3300046665 Bacteria 504
348 Ga0495669_0041634 3300046684 Bacteria 2040
349 Ga0495669_0064675 3300046684 Bacteria 1660
350 Ga0495669_0104016 3300046684 Bacteria 1321
351 Ga0495670_0808650 3300046691 Unclassified 512
352 Ga0495677_0030583 3300047445 Bacteria 1960
353 Ga0495686_0003065 3300047472 Bacteria 14814
354 Ga0496100_0542686 3300048903 Bacteria 899
355 Ga0496101_0028839 3300048904 Bacteria 3879
356 Ga0496101_1347823 3300048904 Bacteria 557
357 Ga0496102_0057530 3300048905 Bacteria 3551
358 Ga0496103_0068639 3300048906 Bacteria 2215
359 Ga0496106_0925955 3300048909 Bacteria 687
360 Ga0496107_0694339 3300048910 Bacteria 749
361 Ga0496109_0958044 3300048912 Bacteria 794
362 Ga0496111_0120161 3300048914 Bacteria 1941
363 Ga0496111_0862728 3300048914 Bacteria 653
364 Ga0496112_0014104 3300048915 Bacteria 7400
365 Ga0496112_0059653 3300048915 Bacteria 3760
366 Ga0496112_0680038 3300048915 Bacteria 958
367 Ga0496112_1641089 3300048915 Bacteria 556
368 Ga0496113_1097959 3300048916 Bacteria 624
369 Ga0496115_0002044 3300048918 Bacteria 14436
370 Ga0496115_0002144 3300048918 Bacteria 14121
371 Ga0496117_0073143 3300048920 Bacteria 2288
372 Ga0496119_0003951 3300048922 Bacteria 15019
373 Ga0496121_0000009 3300048924 Bacteria 836971
374 Ga0501038_1028277 3300049574 Bacteria 604
375 Ga0501047_0010553 3300049581 Bacteria 8736
376 Ga0501047_0604733 3300049581 Bacteria 918
377 Ga0501048_0202928 3300049582 Bacteria 1406
378 Ga0501073_0544981 3300049589 Bacteria 802
379 Ga0501080_0479431 3300049742 Bacteria 1113
380 nmdc:mga03683_62060_c1 3300050489 Bacteria 1582
381 nmdc:mga00v17_282_c1 3300050491 Bacteria 30074
382 nmdc:mga0k408_87838_c1 3300050493 Bacteria 1826
383 nmdc:mga06z11_59941_c1 3300050494 Bacteria 1980
384 nmdc:mga04h51_46637_c1 3300050495 Bacteria 1437
385 nmdc:mga07m45_123096_c1 3300050496 Bacteria 1499
386 nmdc:mga0sz30_167401_c1 3300050516 Unclassified 974
387 Ga0500635_0000052 3300053080 Bacteria 75372
388 Ga0500643_012677 3300053087 Bacteria 3012
389 Ga0500583_0045239 3300053092 Bacteria 2020
390 Ga0500651_0010541 3300053093 Bacteria 5544
391 Ga0500566_0099819 3300053094 Bacteria 1593
392 Ga0500641_0012838 3300053096 Bacteria 3067
393 Ga0500554_314258 3300053102 Unclassified 504
394 Ga0500555_047388 3300053103 Bacteria 1182
395 Ga0500562_000175 3300053108 Bacteria 17715
396 Ga0500562_084929 3300053108 Bacteria 857
397 Ga0500569_015733 3300053109 Bacteria 1900
398 Ga0500572_045849 3300053111 Bacteria 1286
399 Ga0500595_032751 3300053119 Bacteria 1731
400 Ga0500607_032303 3300053121 Bacteria 2874
401 Ga0500608_004959 3300053122 Bacteria 5222
402 Ga0500614_080258 3300053123 Bacteria 911
403 Ga0500642_0224044 3300053130 Bacteria 870
404 Ga0500642_0252762 3300053130 Bacteria 809
405 Ga0500655_028759 3300053133 Bacteria 1065
406 Ga0500658_0011742 3300053134 Bacteria 3227
407 Ga0500559_0118042 3300053136 Bacteria 1232
408 Ga0500568_0153365 3300053139 Bacteria 852
409 Ga0500590_087200 3300053148 Bacteria 1521
410 Ga0500620_136214 3300053155 Bacteria 859
411 Ga0500624_005299 3300053157 Bacteria 1712
412 Ga0500638_087466 3300053162 Bacteria 1472
413 Ga0500639_211742 3300053163 Bacteria 820
414 Ga0500636_0057624 3300053177 Bacteria 2273
415 Ga0500636_0149862 3300053177 Bacteria 1282
416 Ga0500637_0003599 3300053178 Bacteria 7194
417 Ga0500637_0033584 3300053178 Bacteria 2866
418 Ga0500625_166460 3300053729 Bacteria 799
419 Ga0500645_006132 3300053730 Bacteria 4326
420 Ga0500645_041221 3300053730 Bacteria 1364
421 Ga0500596_001514 3300053735 Bacteria 4703
422 Ga0500599_038724 3300053736 Bacteria 730
423 Ga0500601_030106 3300053737 Unclassified 643
424 Ga0500661_084005 3300055283 Unclassified 592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10230915 Ga0105249_102309153 116
2 3300005618 Ga0068864_100503440 Ga0068864_1005034402 117
3 3300005841 Ga0068863_100426359 Ga0068863_1004263591 117
4 3300009553 Ga0105249_10588763 Ga0105249_105887632 117
5 3300010375 Ga0105239_11069072 Ga0105239_110690722 117
6 3300025961 Ga0207712_10237659 Ga0207712_102376593 117
7 3300026088 Ga0207641_11226491 Ga0207641_112264912 117
8 3300031456 Ga0307513_10805389 Ga0307513_108053892 119
9 3300009093 Ga0105240_10124497 Ga0105240_101244974 120
10 3300025913 Ga0207695_10064182 Ga0207695_100641823 120
11 3300053736 Ga0500599_038724 Ga0500599_038724_285_659 120
12 3300005331 Ga0070670_101310118 Ga0070670_1013101182 122
13 3300005347 Ga0070668_100004146 Ga0070668_1000041461 122
14 3300005353 Ga0070669_100001021 Ga0070669_1000010215 122
15 3300005355 Ga0070671_100000209 Ga0070671_1000002095 122
16 3300005367 Ga0070667_100100932 Ga0070667_1001009324 122
17 3300005841 Ga0068863_100004288 Ga0068863_1000042884 122
18 3300005842 Ga0068858_100037391 Ga0068858_1000373913 122
19 3300005843 Ga0068860_100902930 Ga0068860_1009029302 122
20 3300005844 Ga0068862_100168930 Ga0068862_1001689303 122
21 3300009101 Ga0105247_10756694 Ga0105247_107566941 122
22 3300009177 Ga0105248_10000349 Ga0105248_1000034938 122
23 3300009551 Ga0105238_11148204 Ga0105238_111482041 122
24 3300009553 Ga0105249_10332894 Ga0105249_103328943 122
25 3300013306 Ga0163162_10030710 Ga0163162_100307105 122
26 3300014325 Ga0163163_10005594 Ga0163163_100055946 122
27 3300014968 Ga0157379_10000119 Ga0157379_1000011927 122
28 3300025923 Ga0207681_10067749 Ga0207681_100677492 122
29 3300025925 Ga0207650_10066714 Ga0207650_100667143 122
30 3300025931 Ga0207644_10000679 Ga0207644_100006798 122
31 3300025941 Ga0207711_10002092 Ga0207711_1000209210 122
32 3300025972 Ga0207668_10015262 Ga0207668_100152623 122
33 3300025986 Ga0207658_10001368 Ga0207658_1000136815 122
34 3300026035 Ga0207703_10003669 Ga0207703_100036693 122
35 3300026088 Ga0207641_10002888 Ga0207641_1000288815 122
36 3300026118 Ga0207675_100245098 Ga0207675_1002450983 122
37 3300028381 Ga0268264_10062103 Ga0268264_100621032 122
38 3300048904 Ga0496101_1347823 Ga0496101_1347823_78_467 122
39 3300048914 Ga0496111_0862728 Ga0496111_0862728_45_437 122
40 3300048920 Ga0496117_0073143 Ga0496117_0073143_85_477 122
41 3300048922 Ga0496119_0003951 Ga0496119_0003951_2902_3294 122
42 3300048924 Ga0496121_0000009 Ga0496121_0000009_502910_503302 122
43 3300053108 Ga0500562_000175 Ga0500562_000175_13428_13820 122
44 3300005331 Ga0070670_100000128 Ga0070670_10000012822 123
45 3300005347 Ga0070668_100000584 Ga0070668_10000058420 123
46 3300005366 Ga0070659_101970671 Ga0070659_1019706711 123
47 3300005367 Ga0070667_100000169 Ga0070667_10000016961 123
48 3300005367 Ga0070667_101003643 Ga0070667_1010036432 123
49 3300005548 Ga0070665_100001083 Ga0070665_10000108323 123
50 3300005577 Ga0068857_102226301 Ga0068857_1022263011 123
51 3300005617 Ga0068859_100014692 Ga0068859_1000146926 123
52 3300005618 Ga0068864_100000461 Ga0068864_10000046113 123
53 3300005719 Ga0068861_101497273 Ga0068861_1014972732 123
54 3300005841 Ga0068863_100000185 Ga0068863_10000018513 123
55 3300005841 Ga0068863_101326405 Ga0068863_1013264051 123
56 3300005842 Ga0068858_100017927 Ga0068858_1000179272 123
57 3300005843 Ga0068860_100000211 Ga0068860_10000021164 123
58 3300005844 Ga0068862_100018538 Ga0068862_1000185384 123
59 3300006051 Ga0075364_10006432 Ga0075364_100064326 123
60 3300006178 Ga0075367_10000091 Ga0075367_100000913 123
61 3300006186 Ga0075369_10179383 Ga0075369_101793832 123
62 3300006353 Ga0075370_10124952 Ga0075370_101249522 123
63 3300006353 Ga0075370_10230327 Ga0075370_102303272 123
64 3300006358 Ga0068871_100749079 Ga0068871_1007490792 123
65 3300006931 Ga0097620_100014692 Ga0097620_1000146926 123
66 3300006946 Ga0079104_1006342 Ga0079104_10063424 123
67 3300009177 Ga0105248_10152147 Ga0105248_101521472 123
68 3300009553 Ga0105249_10011669 Ga0105249_100116695 123
69 3300013306 Ga0163162_10200294 Ga0163162_102002942 123
70 3300014325 Ga0163163_10230021 Ga0163163_102300212 123
71 3300014968 Ga0157379_10318815 Ga0157379_103188152 123
72 3300014969 Ga0157376_11503099 Ga0157376_115030992 123
73 3300017792 Ga0163161_10128981 Ga0163161_101289812 123
74 3300025920 Ga0207649_10310394 Ga0207649_103103941 123
75 3300025923 Ga0207681_10902883 Ga0207681_109028832 123
76 3300025925 Ga0207650_10000315 Ga0207650_1000031525 123
77 3300025941 Ga0207711_10095107 Ga0207711_100951073 123
78 3300025961 Ga0207712_10000203 Ga0207712_100002034 123
79 3300025972 Ga0207668_10000427 Ga0207668_100004274 123
80 3300025986 Ga0207658_10000052 Ga0207658_10000052130 123
81 3300026035 Ga0207703_10002806 Ga0207703_100028062 123
82 3300026088 Ga0207641_10048330 Ga0207641_100483305 123
83 3300026095 Ga0207676_10000159 Ga0207676_1000015937 123
84 3300026118 Ga0207675_101521849 Ga0207675_1015218491 123
85 3300027866 Ga0209813_10025991 Ga0209813_100259911 123
86 3300028379 Ga0268266_10117572 Ga0268266_101175723 123
87 3300028380 Ga0268265_10122275 Ga0268265_101222753 123
88 3300028381 Ga0268264_10000270 Ga0268264_1000027029 123
89 3300028786 Ga0307517_10202890 Ga0307517_102028902 123
90 3300031456 Ga0307513_10000082 Ga0307513_1000008236 123
91 3300044901 Ga0466960_0711481 Ga0466960_0711481_67_465 123
92 3300046684 Ga0495669_0104016 Ga0495669_0104016_560_949 123
93 3300048906 Ga0496103_0068639 Ga0496103_0068639_1108_1500 123
94 3300048909 Ga0496106_0925955 Ga0496106_0925955_92_484 123
95 3300049581 Ga0501047_0604733 Ga0501047_0604733_56_427 123
96 3300050491 nmdc:mga00v17_282_c1 nmdc:mga00v17_282_c1_5572_5961 123
97 3300050493 nmdc:mga0k408_87838_c1 nmdc:mga0k408_87838_c1_81_470 123
98 3300050494 nmdc:mga06z11_59941_c1 nmdc:mga06z11_59941_c1_933_1322 123
99 3300050495 nmdc:mga04h51_46637_c1 nmdc:mga04h51_46637_c1_1030_1419 123
100 3300050496 nmdc:mga07m45_123096_c1 nmdc:mga07m45_123096_c1_708_1097 123
101 3300050516 nmdc:mga0sz30_167401_c1 nmdc:mga0sz30_167401_c1_543_932 123
102 3300053130 Ga0500642_0224044 Ga0500642_0224044_47_430 123
103 3300005327 Ga0070658_10072166 Ga0070658_100721663 124
104 3300005327 Ga0070658_10301323 Ga0070658_103013232 124
105 3300005327 Ga0070658_10790132 Ga0070658_107901321 124
106 3300005327 Ga0070658_11658696 Ga0070658_116586961 124
107 3300005329 Ga0070683_100691258 Ga0070683_1006912582 124
108 3300005331 Ga0070670_100136342 Ga0070670_1001363423 124
109 3300005335 Ga0070666_10014900 Ga0070666_100149004 124
110 3300005335 Ga0070666_10217804 Ga0070666_102178042 124
111 3300005336 Ga0070680_100009960 Ga0070680_1000099605 124
112 3300005336 Ga0070680_100332466 Ga0070680_1003324662 124
113 3300005338 Ga0068868_100196964 Ga0068868_1001969643 124
114 3300005338 Ga0068868_100530260 Ga0068868_1005302601 124
115 3300005339 Ga0070660_100021896 Ga0070660_1000218964 124
116 3300005339 Ga0070660_100067860 Ga0070660_1000678603 124
117 3300005339 Ga0070660_100121366 Ga0070660_1001213661 124
118 3300005355 Ga0070671_100057897 Ga0070671_1000578973 124
119 3300005355 Ga0070671_100072739 Ga0070671_1000727393 124
120 3300005355 Ga0070671_100826992 Ga0070671_1008269921 124
121 3300005364 Ga0070673_100117223 Ga0070673_1001172233 124
122 3300005364 Ga0070673_101719603 Ga0070673_1017196031 124
123 3300005366 Ga0070659_100005496 Ga0070659_1000054966 124
124 3300005366 Ga0070659_100008686 Ga0070659_1000086868 124
125 3300005457 Ga0070662_100535829 Ga0070662_1005358291 124
126 3300005458 Ga0070681_10007397 Ga0070681_100073979 124
127 3300005458 Ga0070681_10180475 Ga0070681_101804752 124
128 3300005458 Ga0070681_11290137 Ga0070681_112901371 124
129 3300005467 Ga0070706_100653461 Ga0070706_1006534612 124
130 3300005530 Ga0070679_100024513 Ga0070679_1000245134 124
131 3300005539 Ga0068853_100018374 Ga0068853_1000183744 124
132 3300005539 Ga0068853_100289449 Ga0068853_1002894492 124
133 3300005539 Ga0068853_101494309 Ga0068853_1014943092 124
134 3300005548 Ga0070665_100000166 Ga0070665_1000001664 124
135 3300005548 Ga0070665_100022410 Ga0070665_1000224105 124
136 3300005563 Ga0068855_100015798 Ga0068855_1000157986 124
137 3300005563 Ga0068855_100134234 Ga0068855_1001342343 124
138 3300005563 Ga0068855_100142356 Ga0068855_1001423563 124
139 3300005564 Ga0070664_100975846 Ga0070664_1009758461 124
140 3300005577 Ga0068857_100756841 Ga0068857_1007568412 124
141 3300005577 Ga0068857_100925315 Ga0068857_1009253152 124
142 3300005578 Ga0068854_101485744 Ga0068854_1014857441 124
143 3300005616 Ga0068852_100052121 Ga0068852_1000521211 124
144 3300005616 Ga0068852_101461988 Ga0068852_1014619881 124
145 3300005618 Ga0068864_100006430 Ga0068864_1000064304 124
146 3300005618 Ga0068864_100017078 Ga0068864_1000170784 124
147 3300005618 Ga0068864_100231267 Ga0068864_1002312672 124
148 3300005618 Ga0068864_100590470 Ga0068864_1005904702 124
149 3300005841 Ga0068863_100000101 Ga0068863_10000010130 124
150 3300005841 Ga0068863_100197578 Ga0068863_1001975781 124
151 3300005842 Ga0068858_100000271 Ga0068858_1000002714 124
152 3300006358 Ga0068871_100202995 Ga0068871_1002029953 124
153 3300006881 Ga0068865_100000477 Ga0068865_1000004776 124
154 3300009093 Ga0105240_10021821 Ga0105240_100218213 124
155 3300009093 Ga0105240_10335001 Ga0105240_103350012 124
156 3300009101 Ga0105247_10593842 Ga0105247_105938422 124
157 3300009174 Ga0105241_10565146 Ga0105241_105651462 124
158 3300009551 Ga0105238_10022843 Ga0105238_100228434 124
159 3300009551 Ga0105238_10212646 Ga0105238_102126462 124
160 3300009551 Ga0105238_11186018 Ga0105238_111860181 124
161 3300010375 Ga0105239_10322009 Ga0105239_103220093 124
162 3300010375 Ga0105239_10794894 Ga0105239_107948942 124
163 3300013100 Ga0157373_10128569 Ga0157373_101285693 124
164 3300013100 Ga0157373_11124161 Ga0157373_111241611 124
165 3300013104 Ga0157370_10702671 Ga0157370_107026712 124
166 3300013104 Ga0157370_11243838 Ga0157370_112438381 124
167 3300013104 Ga0157370_11243839 Ga0157370_112438391 124
168 3300013105 Ga0157369_10577299 Ga0157369_105772992 124
169 3300013296 Ga0157374_10346912 Ga0157374_103469123 124
170 3300013296 Ga0157374_11366378 Ga0157374_113663782 124
171 3300013306 Ga0163162_10071116 Ga0163162_100711163 124
172 3300013306 Ga0163162_10521947 Ga0163162_105219472 124
173 3300013306 Ga0163162_11184139 Ga0163162_111841391 124
174 3300013306 Ga0163162_11208013 Ga0163162_112080132 124
175 3300013307 Ga0157372_10317811 Ga0157372_103178112 124
176 3300013308 Ga0157375_10072533 Ga0157375_100725333 124
177 3300014325 Ga0163163_10046696 Ga0163163_100466963 124
178 3300014325 Ga0163163_10142988 Ga0163163_101429883 124
179 3300014968 Ga0157379_10026246 Ga0157379_100262466 124
180 3300014968 Ga0157379_10164251 Ga0157379_101642512 124
181 3300014969 Ga0157376_12109894 Ga0157376_121098941 124
182 3300017792 Ga0163161_11551996 Ga0163161_115519962 124
183 3300025254 Ga0209148_1009219 Ga0209148_10092193 124
184 3300025900 Ga0207710_10520875 Ga0207710_105208751 124
185 3300025903 Ga0207680_10013586 Ga0207680_100135863 124
186 3300025909 Ga0207705_10002325 Ga0207705_100023256 124
187 3300025909 Ga0207705_10116433 Ga0207705_101164332 124
188 3300025909 Ga0207705_10168677 Ga0207705_101686772 124
189 3300025912 Ga0207707_10013900 Ga0207707_100139003 124
190 3300025913 Ga0207695_10053103 Ga0207695_100531033 124
191 3300025913 Ga0207695_10768595 Ga0207695_107685952 124
192 3300025913 Ga0207695_11134501 Ga0207695_111345012 124
193 3300025917 Ga0207660_10000991 Ga0207660_100009914 124
194 3300025917 Ga0207660_10067517 Ga0207660_100675174 124
195 3300025917 Ga0207660_11253134 Ga0207660_112531341 124
196 3300025919 Ga0207657_10022898 Ga0207657_100228985 124
197 3300025919 Ga0207657_10025186 Ga0207657_100251866 124
198 3300025919 Ga0207657_10035152 Ga0207657_100351521 124
199 3300025921 Ga0207652_10003485 Ga0207652_100034853 124
200 3300025924 Ga0207694_10015710 Ga0207694_100157103 124
201 3300025924 Ga0207694_10472772 Ga0207694_104727722 124
202 3300025925 Ga0207650_10071049 Ga0207650_100710493 124
203 3300025927 Ga0207687_11154543 Ga0207687_111545431 124
204 3300025931 Ga0207644_11324580 Ga0207644_113245801 124
205 3300025932 Ga0207690_10000110 Ga0207690_1000011055 124
206 3300025933 Ga0207706_10143324 Ga0207706_101433243 124
207 3300025938 Ga0207704_10053659 Ga0207704_100536592 124
208 3300025941 Ga0207711_10083758 Ga0207711_100837583 124
209 3300025945 Ga0207679_10603880 Ga0207679_106038802 124
210 3300025949 Ga0207667_10030621 Ga0207667_100306214 124
211 3300025949 Ga0207667_10080956 Ga0207667_100809563 124
212 3300025949 Ga0207667_10118117 Ga0207667_101181173 124
213 3300025960 Ga0207651_10105381 Ga0207651_101053813 124
214 3300025961 Ga0207712_10589677 Ga0207712_105896772 124
215 3300026035 Ga0207703_10000105 Ga0207703_1000010513 124
216 3300026035 Ga0207703_10805048 Ga0207703_108050482 124
217 3300026041 Ga0207639_10020203 Ga0207639_100202035 124
218 3300026067 Ga0207678_10667327 Ga0207678_106673272 124
219 3300026088 Ga0207641_10000109 Ga0207641_10000109120 124
220 3300026088 Ga0207641_12153552 Ga0207641_121535521 124
221 3300026095 Ga0207676_10000380 Ga0207676_1000038036 124
222 3300026095 Ga0207676_10642068 Ga0207676_106420681 124
223 3300026095 Ga0207676_10671857 Ga0207676_106718572 124
224 3300026095 Ga0207676_11302553 Ga0207676_113025532 124
225 3300026095 Ga0207676_11747748 Ga0207676_117477481 124
226 3300026116 Ga0207674_10629654 Ga0207674_106296541 124
227 3300026142 Ga0207698_10049003 Ga0207698_100490031 124
228 3300026142 Ga0207698_10681816 Ga0207698_106818162 124
229 3300027378 Ga0209981_1024681 Ga0209981_10246811 124
230 3300027462 Ga0210000_1014333 Ga0210000_10143332 124
231 3300027543 Ga0209999_1050393 Ga0209999_10503931 124
232 3300027665 Ga0209983_1014102 Ga0209983_10141022 124
233 3300028379 Ga0268266_10000005 Ga0268266_100000051323 124
234 3300028379 Ga0268266_10016087 Ga0268266_100160873 124
235 3300028379 Ga0268266_10313179 Ga0268266_103131793 124
236 3300028786 Ga0307517_10002579 Ga0307517_1000257928 124
237 3300031251 Ga0265327_10041467 Ga0265327_100414673 124
238 3300031456 Ga0307513_10001556 Ga0307513_1000155624 124
239 3300035083 Ga0373926_0034141 Ga0373926_0034141_606_986 124
240 3300035113 Ga0373936_0117928 Ga0373936_0117928_269_649 124
241 3300035115 Ga0373941_0112017 Ga0373941_0112017_325_702 124
242 3300035171 Ga0373946_0030169 Ga0373946_0030169_890_1270 124
243 3300035692 Ga0373935_0256700 Ga0373935_0256700_378_776 124
244 3300035695 Ga0373927_0000296 Ga0373927_0000296_15791_16171 124
245 3300037068 Ga0373925_0000022 Ga0373925_0000022_81587_81967 124
246 3300037068 Ga0373925_0016787 Ga0373925_0016787_4362_4760 124
247 3300037418 Ga0395900_0189122 Ga0395900_0189122_632_1009 124
248 3300037466 Ga0395898_0035191 Ga0395898_0035191_4246_4623 124
249 3300037471 Ga0395905_0027996 Ga0395905_0027996_352_729 124
250 3300037471 Ga0395905_0216090 Ga0395905_0216090_679_1056 124
251 3300038443 Ga0395901_0069664 Ga0395901_0069664_1374_1751 124
252 3300046471 Ga0495650_0132728 Ga0495650_0132728_19_393 124
253 3300046528 Ga0495642_0201814 Ga0495642_0201814_309_689 124
254 3300046528 Ga0495642_0266762 Ga0495642_0266762_34_414 124
255 3300046535 Ga0495586_0859640 Ga0495586_0859640_36_434 124
256 3300046616 Ga0495668_0127482 Ga0495668_0127482_803_1183 124
257 3300046616 Ga0495668_0509955 Ga0495668_0509955_198_578 124
258 3300046616 Ga0495668_0712595 Ga0495668_0712595_125_526 124
259 3300046648 Ga0495611_0015583 Ga0495611_0015583_1041_1421 124
260 3300046665 Ga0495661_0626559 Ga0495661_0626559_36_416 124
261 3300046684 Ga0495669_0041634 Ga0495669_0041634_851_1252 124
262 3300046684 Ga0495669_0064675 Ga0495669_0064675_889_1272 124
263 3300046691 Ga0495670_0808650 Ga0495670_0808650_47_445 124
264 3300047445 Ga0495677_0030583 Ga0495677_0030583_229_612 124
265 3300048903 Ga0496100_0542686 Ga0496100_0542686_60_443 124
266 3300048904 Ga0496101_0028839 Ga0496101_0028839_3074_3457 124
267 3300048905 Ga0496102_0057530 Ga0496102_0057530_961_1344 124
268 3300048912 Ga0496109_0958044 Ga0496109_0958044_343_726 124
269 3300048914 Ga0496111_0120161 Ga0496111_0120161_1370_1753 124
270 3300048915 Ga0496112_0059653 Ga0496112_0059653_1233_1616 124
271 3300048915 Ga0496112_0680038 Ga0496112_0680038_198_596 124
272 3300048915 Ga0496112_1641089 Ga0496112_1641089_116_499 124
273 3300048916 Ga0496113_1097959 Ga0496113_1097959_217_600 124
274 3300048918 Ga0496115_0002044 Ga0496115_0002044_13916_14299 124
275 3300048918 Ga0496115_0002144 Ga0496115_0002144_2065_2457 124
276 3300049574 Ga0501038_1028277 Ga0501038_1028277_45_428 124
277 3300049581 Ga0501047_0010553 Ga0501047_0010553_212_589 124
278 3300049582 Ga0501048_0202928 Ga0501048_0202928_779_1156 124
279 3300049589 Ga0501073_0544981 Ga0501073_0544981_232_615 124
280 3300049742 Ga0501080_0479431 Ga0501080_0479431_410_787 124
281 3300053080 Ga0500635_0000052 Ga0500635_0000052_7733_8119 124
282 3300053096 Ga0500641_0012838 Ga0500641_0012838_326_703 124
283 3300053102 Ga0500554_314258 Ga0500554_314258_99_485 124
284 3300053103 Ga0500555_047388 Ga0500555_047388_421_816 124
285 3300053108 Ga0500562_084929 Ga0500562_084929_412_789 124
286 3300053121 Ga0500607_032303 Ga0500607_032303_556_942 124
287 3300053157 Ga0500624_005299 Ga0500624_005299_1057_1443 124
288 3300053162 Ga0500638_087466 Ga0500638_087466_924_1310 124
289 3300053177 Ga0500636_0057624 Ga0500636_0057624_329_715 124
290 3300053178 Ga0500637_0003599 Ga0500637_0003599_3922_4308 124
291 3300053737 Ga0500601_030106 Ga0500601_030106_204_590 124
292 3300005548 Ga0070665_100034481 Ga0070665_1000344812 125
293 3300005563 Ga0068855_100111548 Ga0068855_1001115483 125
294 3300005563 Ga0068855_100790996 Ga0068855_1007909962 125
295 3300005563 Ga0068855_101236793 Ga0068855_1012367932 125
296 3300005614 Ga0068856_100051983 Ga0068856_1000519832 125
297 3300005614 Ga0068856_100523361 Ga0068856_1005233612 125
298 3300006177 Ga0075362_10007026 Ga0075362_100070263 125
299 3300006353 Ga0075370_10439346 Ga0075370_104393462 125
300 3300009093 Ga0105240_10940865 Ga0105240_109408652 125
301 3300009174 Ga0105241_10092021 Ga0105241_100920212 125
302 3300009177 Ga0105248_10001964 Ga0105248_100019642 125
303 3300009177 Ga0105248_10002901 Ga0105248_100029012 125
304 3300009545 Ga0105237_11032870 Ga0105237_110328701 125
305 3300009545 Ga0105237_12036728 Ga0105237_120367281 125
306 3300009551 Ga0105238_10008802 Ga0105238_100088024 125
307 3300009551 Ga0105238_10120825 Ga0105238_101208253 125
308 3300010375 Ga0105239_10919170 Ga0105239_109191702 125
309 3300013105 Ga0157369_10885416 Ga0157369_108854161 125
310 3300013105 Ga0157369_11859755 Ga0157369_118597551 125
311 3300013307 Ga0157372_11090951 Ga0157372_110909511 125
312 3300013308 Ga0157375_10230725 Ga0157375_102307254 125
313 3300014968 Ga0157379_10628459 Ga0157379_106284592 125
314 3300021384 Ga0213876_10010735 Ga0213876_100107354 125
315 3300025904 Ga0207647_10427003 Ga0207647_104270032 125
316 3300025911 Ga0207654_10045443 Ga0207654_100454434 125
317 3300025913 Ga0207695_10568772 Ga0207695_105687721 125
318 3300025914 Ga0207671_11267322 Ga0207671_112673221 125
319 3300025924 Ga0207694_10006764 Ga0207694_100067649 125
320 3300025924 Ga0207694_10038044 Ga0207694_100380443 125
321 3300025940 Ga0207691_10764346 Ga0207691_107643461 125
322 3300025941 Ga0207711_10001488 Ga0207711_100014883 125
323 3300025941 Ga0207711_10030505 Ga0207711_100305057 125
324 3300026041 Ga0207639_10733818 Ga0207639_107338182 125
325 3300026078 Ga0207702_10044955 Ga0207702_100449551 125
326 3300026078 Ga0207702_10521776 Ga0207702_105217762 125
327 3300026078 Ga0207702_11347822 Ga0207702_113478221 125
328 3300028379 Ga0268266_10747761 Ga0268266_107477612 125
329 3300028786 Ga0307517_10304502 Ga0307517_103045022 125
330 3300031456 Ga0307513_10063077 Ga0307513_100630773 125
331 3300033180 Ga0307510_10002252 Ga0307510_100022525 125
332 3300037418 Ga0395900_0000010 Ga0395900_0000010_158193_158594 125
333 3300037466 Ga0395898_0011688 Ga0395898_0011688_4313_4714 125
334 3300037471 Ga0395905_0006685 Ga0395905_0006685_10398_10799 125
335 3300037471 Ga0395905_0563739 Ga0395905_0563739_43_423 125
336 3300038443 Ga0395901_0000007 Ga0395901_0000007_242555_242956 125
337 3300039437 Ga0436365_0434950 Ga0436365_0434950_2191_2580 125
338 3300042004 Ga0439445_0114771 Ga0439445_0114771_260_637 125
339 3300044693 Ga0466961_0644410 Ga0466961_0644410_237_617 125
340 3300044706 Ga0466964_0236439 Ga0466964_0236439_464_844 125
341 3300046459 Ga0495629_0013275 Ga0495629_0013275_1809_2201 125
342 3300046462 Ga0495651_0571732 Ga0495651_0571732_220_606 125
343 3300046506 Ga0495583_0333355 Ga0495583_0333355_115_507 125
344 3300046516 Ga0495628_0487141 Ga0495628_0487141_220_606 125
345 3300046517 Ga0495630_0560066 Ga0495630_0560066_103_489 125
346 3300046522 Ga0495643_0030203 Ga0495643_0030203_106_498 125
347 3300046528 Ga0495642_0045730 Ga0495642_0045730_866_1252 125
348 3300046542 Ga0495597_0006638 Ga0495597_0006638_4276_4668 125
349 3300046543 Ga0495645_0556780 Ga0495645_0556780_268_654 125
350 3300046557 Ga0495622_0019238 Ga0495622_0019238_850_1242 125
351 3300046615 Ga0495656_0549586 Ga0495656_0549586_190_576 125
352 3300046616 Ga0495668_0067408 Ga0495668_0067408_1052_1444 125
353 3300048910 Ga0496107_0694339 Ga0496107_0694339_338_730 125
354 3300048915 Ga0496112_0014104 Ga0496112_0014104_1685_2074 125
355 3300050489 nmdc:mga03683_62060_c1 nmdc:mga03683_62060_c1_1018_1395 125
356 3300053092 Ga0500583_0045239 Ga0500583_0045239_331_723 125
357 3300053093 Ga0500651_0010541 Ga0500651_0010541_3496_3888 125
358 3300053094 Ga0500566_0099819 Ga0500566_0099819_823_1215 125
359 3300053109 Ga0500569_015733 Ga0500569_015733_1192_1584 125
360 3300053111 Ga0500572_045849 Ga0500572_045849_661_1053 125
361 3300053119 Ga0500595_032751 Ga0500595_032751_1207_1599 125
362 3300053122 Ga0500608_004959 Ga0500608_004959_1865_2257 125
363 3300053123 Ga0500614_080258 Ga0500614_080258_89_481 125
364 3300053130 Ga0500642_0252762 Ga0500642_0252762_257_649 125
365 3300053133 Ga0500655_028759 Ga0500655_028759_300_692 125
366 3300053134 Ga0500658_0011742 Ga0500658_0011742_156_548 125
367 3300053136 Ga0500559_0118042 Ga0500559_0118042_346_738 125
368 3300053148 Ga0500590_087200 Ga0500590_087200_777_1169 125
369 3300053155 Ga0500620_136214 Ga0500620_136214_254_646 125
370 3300053163 Ga0500639_211742 Ga0500639_211742_304_696 125
371 3300053177 Ga0500636_0149862 Ga0500636_0149862_330_722 125
372 3300053178 Ga0500637_0033584 Ga0500637_0033584_2096_2488 125
373 3300053729 Ga0500625_166460 Ga0500625_166460_93_485 125
374 3300053730 Ga0500645_006132 Ga0500645_006132_441_818 125
375 3300053735 Ga0500596_001514 Ga0500596_001514_331_723 125
376 3300055283 Ga0500661_084005 Ga0500661_084005_138_530 125
377 3300003794 Ga0055531_10035051 Ga0055531_100350513 126
378 3300005262 Ga0065165_1000238 Ga0065165_10002383 126
379 3300005341 Ga0070691_10003012 Ga0070691_100030124 126
380 3300005344 Ga0070661_100362775 Ga0070661_1003627751 126
381 3300005367 Ga0070667_100002073 Ga0070667_1000020736 126
382 3300005458 Ga0070681_10006518 Ga0070681_1000651810 126
383 3300005530 Ga0070679_100037636 Ga0070679_1000376365 126
384 3300005539 Ga0068853_100099031 Ga0068853_1000990313 126
385 3300005548 Ga0070665_100001054 Ga0070665_1000010542 126
386 3300005563 Ga0068855_100091379 Ga0068855_1000913794 126
387 3300005578 Ga0068854_100190939 Ga0068854_1001909391 126
388 3300005614 Ga0068856_100415151 Ga0068856_1004151512 126
389 3300005844 Ga0068862_100004607 Ga0068862_10000460710 126
390 3300009093 Ga0105240_10014610 Ga0105240_100146104 126
391 3300009093 Ga0105240_10188267 Ga0105240_101882672 126
392 3300009176 Ga0105242_10292775 Ga0105242_102927752 126
393 3300009551 Ga0105238_10062342 Ga0105238_100623423 126
394 3300025250 Ga0209026_1000438 Ga0209026_100043827 126
395 3300025304 Ga0209257_1003363 Ga0209257_10033636 126
396 3300025912 Ga0207707_10050870 Ga0207707_100508703 126
397 3300025913 Ga0207695_10008571 Ga0207695_1000857112 126
398 3300025913 Ga0207695_10010341 Ga0207695_100103419 126
399 3300025913 Ga0207695_10038076 Ga0207695_100380766 126
400 3300025917 Ga0207660_10072765 Ga0207660_100727654 126
401 3300025921 Ga0207652_10098460 Ga0207652_100984603 126
402 3300025934 Ga0207686_10181759 Ga0207686_101817592 126
403 3300025949 Ga0207667_10054954 Ga0207667_100549545 126
404 3300025961 Ga0207712_10200669 Ga0207712_102006693 126
405 3300025972 Ga0207668_10000007 Ga0207668_10000007170 126
406 3300025981 Ga0207640_12115474 Ga0207640_121154741 126
407 3300025986 Ga0207658_10002402 Ga0207658_100024029 126
408 3300026041 Ga0207639_10032985 Ga0207639_100329853 126
409 3300026078 Ga0207702_10234947 Ga0207702_102349472 126
410 3300028379 Ga0268266_10002189 Ga0268266_1000218920 126
411 3300028380 Ga0268265_10043150 Ga0268265_100431503 126
412 3300032004 Ga0307414_10109182 Ga0307414_101091823 126
413 3300037471 Ga0395905_0726188 Ga0395905_0726188_178_561 126
414 3300037471 Ga0395905_0797833 Ga0395905_0797833_77_463 126
415 3300044901 Ga0466960_0067936 Ga0466960_0067936_206_586 126
416 3300046616 Ga0495668_0081273 Ga0495668_0081273_307_687 126
417 3300047472 Ga0495686_0003065 Ga0495686_0003065_9247_9627 126
418 3300053087 Ga0500643_012677 Ga0500643_012677_2524_2928 126
419 3300053139 Ga0500568_0153365 Ga0500568_0153365_360_740 126
420 3300053730 Ga0500645_041221 Ga0500645_041221_440_820 126
421 3300003794 Ga0055531_10001202 Ga0055531_1000120214 131
422 3300025297 Ga0209758_1002163 Ga0209758_100216323 131
423 3300025298 Ga0209050_1000031 Ga0209050_1000031100 131
424 3300025304 Ga0209257_1000073 Ga0209257_1000073280 131

Structural Annotation

Top 5 Hits

ID Description Score Start End
5td6-assembly1.cif.gz_B c. elegans fog-3 btg/tob domain - h47n, c117a 0.6312 86 111
4lo8-assembly4.cif.gz_G ha70(d3)-ha17 0.5982 36 59
3b02-assembly1.cif.gz_A crystal structure of tthb099, a transcriptional regulator crp family from thermus thermophilus hb8 0.534 27 50
4ckg-assembly1.cif.gz_A helical reconstruction of acap1(bar-ph domain) decorated membrane tubules by cryo-electron microscopy 0.5239 35 112
3hif-assembly3.cif.gz_E the crystal structure of apo wild type cap at 3.6 a resolution. 0.5152 34 89
ID Description Score Start End Superfamily
af_Q9W6I6_17_257_2.60.120.970 Mainly Beta;Sandwich;Jelly Rolls; 0.9402 36 54 2.60.120.970
af_O01404_204_355_2.60.120.230 Mainly Beta;Sandwich;Jelly Rolls; 0.7206 29 54 2.60.120.230
af_Q9U2B7_29_187_3.50.30.30 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.6614 36 53 3.50.30.30
af_G5EDX7_1_116_3.90.640.90 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;Anti-proliferative protein, N-terminal domain 0.6472 88 111 3.90.640.90
af_Q559C4_4_114_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6451 77 114 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A4Q3S5D9-F1-model_v4 Lipoprotein 0.9162 18 128
AF-A0A328B4K8-F1-model_v4 DUF4156 domain-containing protein 0.91 21 129
AF-A0A2D2AZM0-F1-model_v4 Lipoprotein 0.9003 21 126
AF-B4R9P0-F1-model_v4 Lipoprotein 0.8825 18 129
AF-A0A069IN41-F1-model_v4 Lipoprotein 0.8704 21 126

Feature Viewer

pLDDT pTM Quality
76.23 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map