F440751

General Info

Members Datasets Scaffolds Average Seq Length
424 220 834 136

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10068304|Ga0157371_100683043
Length 161
Sequence MVHYIIPRDHSVAVRAEIQEWMDMAMNSGGTAGQPMMDINTTPLIDVLLVLLIMFIITIPMQTHAVKVDTPQGAPPIKLLTKNEVAVTGQNRVLWNGAPVNLITLRQYLDQSQTLDPIPELHIRPAPDAHYELVDKVLAVAKRANVTKMGFVGNEAYARDF

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
156 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
202 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 2.83
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10068304 3300013102 Bacteria 2515
2 JGI24736J21556_1004956 3300001904 Bacteria 2259
3 JGI24736J21556_1009367 3300001904 Bacteria 1616
4 JGI24736J21556_1011161 3300001904 Bacteria 1464
5 JGI24736J21556_1056618 3300001904 Bacteria 605
6 JGI24740J21852_10005435 3300001979 Bacteria 5386
7 JGI24739J22299_10000499 3300001989 Bacteria 13899
8 JGI24739J22299_10002846 3300001989 Bacteria 6640
9 JGI24739J22299_10007494 3300001989 Bacteria 4092
10 JGI24737J22298_10000425 3300001990 Bacteria 14488
11 JGI24737J22298_10004152 3300001990 Bacteria 5062
12 JGI24737J22298_10016120 3300001990 Bacteria 2413
13 JGI24737J22298_10070336 3300001990 Bacteria 1045
14 JGI24737J22298_10084113 3300001990 Bacteria 946
15 JGI24737J22298_10173614 3300001990 Bacteria 636
16 JGI24743J22301_10032774 3300001991 Bacteria 1027
17 JGI24735J21928_10008328 3300002067 Bacteria 3357
18 JGI24735J21928_10008594 3300002067 Bacteria 3296
19 JGI24735J21928_10010197 3300002067 Bacteria 3001
20 JGI24735J21928_10013019 3300002067 Bacteria 2622
21 JGI24735J21928_10014717 3300002067 Bacteria 2448
22 JGI24735J21928_10017244 3300002067 Bacteria 2233
23 JGI24735J21928_10017843 3300002067 Bacteria 2192
24 JGI24735J21928_10034138 3300002067 Bacteria 1501
25 JGI24735J21928_10046550 3300002067 Bacteria 1258
26 JGI24735J21928_10079014 3300002067 Bacteria 942
27 JGI24735J21928_10110931 3300002067 Bacteria 789
28 JGI24735J21928_10118887 3300002067 Bacteria 760
29 JGI24735J21928_10119910 3300002067 Bacteria 757
30 JGI24738J21930_10000040 3300002075 Bacteria 25176
31 JGI24749J21850_1000218 3300002076 Bacteria 8932
32 JGI24744J21845_10000530 3300002077 Bacteria 6827
33 JGI24034J26672_10056361 3300002239 Bacteria 683
34 JGI25157J39369_1026212 3300002741 Bacteria 677
35 JGI25157J39369_1027831 3300002741 Bacteria 653
36 JGI25165J46597_1000082 3300003214 Bacteria 174736
37 rootH1_10023776 3300003316 Bacteria 1412
38 rootL2_10067612 3300003322 Bacteria 1072
39 rootL2_10111258 3300003322 Bacteria 1272
40 Ga0065712_10025333 3300005290 Bacteria 1396
41 Ga0065715_10151206 3300005293 Bacteria 1689
42 Ga0065707_10093614 3300005295 Bacteria 3603
43 Ga0065707_10548540 3300005295 Bacteria 722
44 Ga0070658_10017222 3300005327 Bacteria 5783
45 Ga0070658_10226419 3300005327 Bacteria 1582
46 Ga0070658_10439342 3300005327 Bacteria 1123
47 Ga0070676_10000043 3300005328 Bacteria 38508
48 Ga0070670_100054445 3300005331 Bacteria 3435
49 Ga0070670_100402937 3300005331 Bacteria 1208
50 Ga0068869_100000014 3300005334 Bacteria 73206
51 Ga0070666_10118705 3300005335 Bacteria 1833
52 Ga0070666_10508584 3300005335 Bacteria 874
53 Ga0068868_100000015 3300005338 Bacteria 104058
54 Ga0070660_100000280 3300005339 Bacteria 33943
55 Ga0070660_100049239 3300005339 Bacteria 3239
56 Ga0070660_100066952 3300005339 Bacteria 2798
57 Ga0070687_100133034 3300005343 Bacteria 1438
58 Ga0070661_100716557 3300005344 Bacteria 816
59 Ga0070668_100104725 3300005347 Bacteria 2246
60 Ga0070668_100105017 3300005347 Bacteria 2243
61 Ga0070668_100614786 3300005347 Bacteria 952
62 Ga0070669_100000119 3300005353 Bacteria 73001
63 Ga0070669_100055434 3300005353 Bacteria 2904
64 Ga0070669_100092353 3300005353 Bacteria 2272
65 Ga0070669_101748860 3300005353 Bacteria 542
66 Ga0070675_100002667 3300005354 Bacteria 13418
67 Ga0070675_100099795 3300005354 Bacteria 2444
68 Ga0070675_100836555 3300005354 Bacteria 842
69 Ga0070671_100009712 3300005355 Bacteria 7730
70 Ga0070671_100026971 3300005355 Bacteria 4726
71 Ga0070671_100155494 3300005355 Bacteria 1932
72 Ga0070674_100030763 3300005356 Bacteria 3551
73 Ga0070674_100036788 3300005356 Bacteria 3289
74 Ga0070674_100100296 3300005356 Bacteria 2108
75 Ga0070673_100000098 3300005364 Bacteria 38913
76 Ga0070673_100129468 3300005364 Bacteria 2115
77 Ga0070659_100037250 3300005366 Bacteria 3791
78 Ga0070659_100466548 3300005366 Bacteria 1073
79 Ga0070659_101551939 3300005366 Bacteria 591
80 Ga0070667_100000407 3300005367 Bacteria 46001
81 Ga0070663_100731927 3300005455 Bacteria 843
82 Ga0070663_101522061 3300005455 Bacteria 595
83 Ga0070663_102024314 3300005455 Bacteria 518
84 Ga0070678_100079236 3300005456 Bacteria 2484
85 Ga0070662_100003287 3300005457 Bacteria 10067
86 Ga0070662_100213695 3300005457 Bacteria 1536
87 Ga0070662_100566653 3300005457 Bacteria 953
88 Ga0070681_10276139 3300005458 Bacteria 1592
89 Ga0068867_100000008 3300005459 Bacteria 143488
90 Ga0068867_101316418 3300005459 Bacteria 667
91 Ga0068853_100112950 3300005539 Bacteria 2415
92 Ga0068853_100233976 3300005539 Bacteria 1682
93 Ga0068853_100373534 3300005539 Bacteria 1331
94 Ga0070672_100018323 3300005543 Bacteria 5059
95 Ga0070672_100597351 3300005543 Bacteria 961
96 Ga0070693_100037937 3300005547 Bacteria 2690
97 Ga0070665_100865204 3300005548 Bacteria 917
98 Ga0068855_100036032 3300005563 Bacteria 5890
99 Ga0068855_100509389 3300005563 Bacteria 1307
100 Ga0070664_100098528 3300005564 Bacteria 2540
101 Ga0070664_100159508 3300005564 Bacteria 1995
102 Ga0070664_101476807 3300005564 Bacteria 643
103 Ga0068857_100359816 3300005577 Bacteria 1349
104 Ga0068856_100002832 3300005614 Bacteria 17765
105 Ga0068856_100177323 3300005614 Bacteria 2144
106 Ga0070702_100974338 3300005615 Bacteria 669
107 Ga0068852_100065803 3300005616 Bacteria 3164
108 Ga0068852_100685589 3300005616 Bacteria 1034
109 Ga0068852_101234667 3300005616 Bacteria 769
110 Ga0068852_101571947 3300005616 Bacteria 680
111 Ga0068859_100010149 3300005617 Bacteria 9485
112 Ga0068864_100272404 3300005618 Bacteria 1578
113 Ga0068861_100234548 3300005719 Bacteria 1558
114 Ga0068861_101791336 3300005719 Bacteria 609
115 Ga0068870_10060481 3300005840 Bacteria 2033
116 Ga0068863_100003363 3300005841 Bacteria 15795
117 Ga0068863_100110100 3300005841 Bacteria 2622
118 Ga0068862_100000011 3300005844 Bacteria 270105
119 Ga0068862_100469141 3300005844 Bacteria 1189
120 Ga0075368_10286108 3300006042 Bacteria 709
121 Ga0075366_10039836 3300006195 Bacteria 2778
122 Ga0075366_10107099 3300006195 Bacteria 1681
123 Ga0068865_100000036 3300006881 Bacteria 82943
124 Ga0068865_100358037 3300006881 Bacteria 1184
125 Ga0097620_100010149 3300006931 Bacteria 9485
126 Ga0105240_10131648 3300009093 Bacteria 2999
127 Ga0105240_11586149 3300009093 Bacteria 685
128 Ga0105245_10003374 3300009098 Bacteria 14312
129 Ga0105243_10000625 3300009148 Bacteria 35272
130 Ga0105242_10010105 3300009176 Bacteria 7227
131 Ga0105248_10900509 3300009177 Bacteria 999
132 Ga0105237_10032435 3300009545 Bacteria 5289
133 Ga0105237_10692829 3300009545 Bacteria 1025
134 Ga0105238_11017600 3300009551 Bacteria 850
135 Ga0105249_10014632 3300009553 Bacteria 6938
136 Ga0105239_10349003 3300010375 Bacteria 1670
137 Ga0105246_10045191 3300011119 Bacteria 2997
138 Ga0105246_10169600 3300011119 Bacteria 1670
139 Ga0105246_11564434 3300011119 Bacteria 622
140 Ga0157326_1000156 3300012513 Bacteria 7474
141 Ga0157373_10069981 3300013100 Bacteria 2480
142 Ga0157373_10128281 3300013100 Bacteria 1784
143 Ga0157373_10249373 3300013100 Bacteria 1256
144 Ga0157373_10420567 3300013100 Bacteria 959
145 Ga0157373_10439398 3300013100 Bacteria 938
146 Ga0157373_10881285 3300013100 Bacteria 663
147 Ga0157371_10146437 3300013102 Bacteria 1683
148 Ga0157371_10192669 3300013102 Bacteria 1460
149 Ga0157371_10499091 3300013102 Bacteria 899
150 Ga0157371_11317769 3300013102 Bacteria 559
151 Ga0157370_10000112 3300013104 Bacteria 94316
152 Ga0157370_11388877 3300013104 Bacteria 632
153 Ga0157369_10042823 3300013105 Bacteria 4939
154 Ga0157369_10112726 3300013105 Bacteria 2889
155 Ga0157369_10183560 3300013105 Bacteria 2200
156 Ga0157369_10615207 3300013105 Bacteria 1121
157 Ga0157369_10878774 3300013105 Bacteria 920
158 Ga0157374_10001100 3300013296 Bacteria 23248
159 Ga0157374_11600617 3300013296 Bacteria 675
160 Ga0157374_12174880 3300013296 Bacteria 582
161 Ga0157378_10001248 3300013297 Bacteria 22962
162 Ga0163162_10323260 3300013306 Bacteria 1675
163 Ga0163162_10809640 3300013306 Bacteria 1054
164 Ga0157372_10060831 3300013307 Bacteria 4226
165 Ga0157372_10135043 3300013307 Bacteria 2840
166 Ga0157372_10421967 3300013307 Bacteria 1555
167 Ga0157372_10442129 3300013307 Bacteria 1515
168 Ga0157372_10659122 3300013307 Bacteria 1219
169 Ga0157372_10869228 3300013307 Bacteria 1047
170 Ga0157372_11108161 3300013307 Bacteria 916
171 Ga0157372_11187732 3300013307 Bacteria 882
172 Ga0157375_10009204 3300013308 Bacteria 8660
173 Ga0157380_10001430 3300014326 Bacteria 15629
174 Ga0157380_10150058 3300014326 Bacteria 2014
175 Ga0157380_10728580 3300014326 Bacteria 1000
176 Ga0157377_10055679 3300014745 Bacteria 2243
177 Ga0157376_10000033 3300014969 Bacteria 163952
178 Ga0163161_10384187 3300017792 Bacteria 1123
179 Ga0163161_11055953 3300017792 Bacteria 696
180 Ga0207427_100526 3300025231 Bacteria 19933
181 Ga0209026_1005392 3300025250 Bacteria 3456
182 Ga0209148_1000127 3300025254 Bacteria 181586
183 Ga0209148_1004200 3300025254 Bacteria 3614
184 Ga0209233_1000041 3300025261 Bacteria 515463
185 Ga0209455_1034575 3300025272 Bacteria 821
186 Ga0207682_10035217 3300025893 Bacteria 2021
187 Ga0207642_10348765 3300025899 Bacteria 873
188 Ga0207688_10054407 3300025901 Bacteria 2245
189 Ga0207680_10012735 3300025903 Bacteria 4295
190 Ga0207680_10061914 3300025903 Bacteria 2284
191 Ga0207680_10240402 3300025903 Bacteria 1248
192 Ga0207647_10002638 3300025904 Bacteria 13550
193 Ga0207647_10012142 3300025904 Bacteria 6011
194 Ga0207647_10026436 3300025904 Bacteria 3798
195 Ga0207647_10027184 3300025904 Bacteria 3733
196 Ga0207647_10052284 3300025904 Bacteria 2522
197 Ga0207647_10114276 3300025904 Bacteria 1595
198 Ga0207647_10243382 3300025904 Bacteria 1033
199 Ga0207645_10000117 3300025907 Bacteria 60207
200 Ga0207645_10171794 3300025907 Bacteria 1421
201 Ga0207705_10002415 3300025909 Bacteria 14419
202 Ga0207705_10358257 3300025909 Bacteria 1125
203 Ga0207705_10848091 3300025909 Bacteria 708
204 Ga0207707_10471975 3300025912 Bacteria 1072
205 Ga0207695_10053176 3300025913 Bacteria 4237
206 Ga0207671_10133601 3300025914 Bacteria 1906
207 Ga0207671_10460294 3300025914 Bacteria 1013
208 Ga0207657_10000983 3300025919 Bacteria 30231
209 Ga0207657_10014533 3300025919 Bacteria 7676
210 Ga0207657_10015601 3300025919 Bacteria 7350
211 Ga0207681_10000001 3300025923 Bacteria 1105841
212 Ga0207681_10909913 3300025923 Bacteria 737
213 Ga0207694_10278257 3300025924 Bacteria 1374
214 Ga0207650_10000018 3300025925 Bacteria 352120
215 Ga0207650_10058848 3300025925 Bacteria 2862
216 Ga0207650_10487178 3300025925 Bacteria 1029
217 Ga0207659_10005343 3300025926 Bacteria 7782
218 Ga0207659_11033178 3300025926 Bacteria 707
219 Ga0207687_10000372 3300025927 Bacteria 29996
220 Ga0207644_10083792 3300025931 Bacteria 2362
221 Ga0207644_10169876 3300025931 Bacteria 1701
222 Ga0207644_10786152 3300025931 Bacteria 796
223 Ga0207690_10020269 3300025932 Bacteria 4106
224 Ga0207690_10043589 3300025932 Bacteria 2953
225 Ga0207690_10293626 3300025932 Bacteria 1270
226 Ga0207690_10612900 3300025932 Bacteria 889
227 Ga0207690_11430362 3300025932 Bacteria 578
228 Ga0207706_10003421 3300025933 Bacteria 15153
229 Ga0207706_10045597 3300025933 Bacteria 3884
230 Ga0207706_10103166 3300025933 Bacteria 2509
231 Ga0207706_10220286 3300025933 Bacteria 1661
232 Ga0207706_10309401 3300025933 Bacteria 1376
233 Ga0207706_10912649 3300025933 Bacteria 741
234 Ga0207709_10000102 3300025935 Bacteria 132562
235 Ga0207669_10148371 3300025937 Bacteria 1639
236 Ga0207704_10000014 3300025938 Bacteria 164052
237 Ga0207704_10310008 3300025938 Bacteria 1213
238 Ga0207691_10059814 3300025940 Bacteria 3463
239 Ga0207691_10672399 3300025940 Bacteria 874
240 Ga0207689_10000364 3300025942 Bacteria 42763
241 Ga0207679_11855002 3300025945 Bacteria 550
242 Ga0207667_10490765 3300025949 Bacteria 1246
243 Ga0207667_10594441 3300025949 Bacteria 1116
244 Ga0207651_10000015 3300025960 Bacteria 164178
245 Ga0207651_10306421 3300025960 Bacteria 1323
246 Ga0207712_10007151 3300025961 Bacteria 7039
247 Ga0207668_10308355 3300025972 Bacteria 1309
248 Ga0207668_10548057 3300025972 Bacteria 1001
249 Ga0207658_10001469 3300025986 Bacteria 18347
250 Ga0207658_11297866 3300025986 Bacteria 666
251 Ga0207677_10000097 3300026023 Bacteria 71753
252 Ga0207639_10260661 3300026041 Bacteria 1516
253 Ga0207678_10127930 3300026067 Bacteria 2167
254 Ga0207678_10674959 3300026067 Bacteria 908
255 Ga0207678_11900625 3300026067 Bacteria 519
256 Ga0207702_10003314 3300026078 Bacteria 14805
257 Ga0207641_10103806 3300026088 Bacteria 2508
258 Ga0207641_10262573 3300026088 Bacteria 1617
259 Ga0207648_10000014 3300026089 Bacteria 163862
260 Ga0207648_10368805 3300026089 Bacteria 1296
261 Ga0207676_10000004 3300026095 Bacteria 725417
262 Ga0207676_11060667 3300026095 Bacteria 800
263 Ga0207674_10019434 3300026116 Bacteria 7356
264 Ga0207674_10253942 3300026116 Bacteria 1705
265 Ga0207675_100001128 3300026118 Bacteria 26498
266 Ga0207675_102257398 3300026118 Bacteria 559
267 Ga0207683_10007411 3300026121 Bacteria 9408
268 Ga0207698_10096358 3300026142 Bacteria 2438
269 Ga0207698_10427291 3300026142 Bacteria 1273
270 Ga0207698_11444009 3300026142 Bacteria 703
271 Ga0209967_1058565 3300027364 Bacteria 596
272 Ga0209974_10012483 3300027876 Bacteria 2840
273 Ga0268266_11607873 3300028379 Bacteria 625
274 Ga0268265_10000002 3300028380 Bacteria 1035381
275 Ga0268265_11634818 3300028380 Bacteria 649
276 Ga0307408_100053439 3300031548 Bacteria 2917
277 Ga0307408_100089281 3300031548 Bacteria 2323
278 Ga0307405_10032752 3300031731 Bacteria 3075
279 Ga0307405_10054703 3300031731 Bacteria 2493
280 Ga0307405_10215897 3300031731 Bacteria 1404
281 Ga0307405_10412961 3300031731 Bacteria 1060
282 Ga0307413_10011941 3300031824 Bacteria 4298
283 Ga0307413_10220232 3300031824 Bacteria 1386
284 Ga0307410_10082320 3300031852 Bacteria 2264
285 Ga0307410_10120430 3300031852 Bacteria 1913
286 Ga0307410_10422557 3300031852 Bacteria 1081
287 Ga0307406_10119809 3300031901 Bacteria 1827
288 Ga0307406_10330853 3300031901 Bacteria 1182
289 Ga0307407_10009986 3300031903 Bacteria 4452
290 Ga0307407_10690161 3300031903 Bacteria 768
291 Ga0307412_10357262 3300031911 Bacteria 1175
292 Ga0307412_10397357 3300031911 Bacteria 1121
293 Ga0307409_100009926 3300031995 Bacteria 5880
294 Ga0307409_100526073 3300031995 Bacteria 1156
295 Ga0307409_100632998 3300031995 Bacteria 1061
296 Ga0307409_101609992 3300031995 Bacteria 678
297 Ga0307409_101741278 3300031995 Bacteria 652
298 Ga0307416_100111611 3300032002 Bacteria 2411
299 Ga0307416_100307378 3300032002 Bacteria 1580
300 Ga0307416_100396394 3300032002 Bacteria 1416
301 Ga0307416_100960569 3300032002 Bacteria 957
302 Ga0307414_10043188 3300032004 Bacteria 3069
303 Ga0307414_10046104 3300032004 Bacteria 2989
304 Ga0307414_10512816 3300032004 Bacteria 1063
305 Ga0307414_11054679 3300032004 Bacteria 749
306 Ga0307411_10001850 3300032005 Bacteria 8989
307 Ga0307411_10014110 3300032005 Bacteria 4435
308 Ga0307411_10200650 3300032005 Unclassified 1531
309 Ga0307415_100006164 3300032126 Bacteria 6437
310 Ga0307415_100028330 3300032126 Bacteria 3562
311 Ga0307415_100387004 3300032126 Bacteria 1189
312 Ga0307415_100967333 3300032126 Bacteria 789
313 Ga0373931_0201526 3300035691 Bacteria 1189
314 Ga0395899_0003962 3300037312 Bacteria 11669
315 Ga0395900_0017530 3300037418 Bacteria 7307
316 Ga0395900_0829123 3300037418 Bacteria 851
317 Ga0395898_1576289 3300037466 Bacteria 581
318 Ga0395905_1460781 3300037471 Bacteria 588
319 Ga0451801_08754 3300041455 Bacteria 815
320 Ga0451798_0509006 3300041458 Bacteria 940
321 Ga0451800_0865922 3300041459 Bacteria 2350
322 Ga0451802_1436532 3300041460 Bacteria 1273
323 Ga0451805_038156 3300041461 Bacteria 1603
324 Ga0451806_833252 3300041462 Bacteria 1095
325 Ga0451804_0204772 3300041463 Bacteria 510
326 Ga0451841_0836323 3300041498 Bacteria 870
327 Ga0439445_0002495 3300042004 Bacteria 4094
328 Ga0439448_0011460 3300042005 Bacteria 2643
329 Ga0439448_0031254 3300042005 Bacteria 1690
330 Ga0439448_0186494 3300042005 Bacteria 725
331 Ga0439449_0016276 3300042007 Bacteria 2795
332 Ga0439455_0006341 3300042012 Bacteria 2451
333 Ga0439455_0016446 3300042012 Bacteria 1711
334 Ga0439455_0025859 3300042012 Bacteria 1429
335 Ga0439455_0052748 3300042012 Bacteria 1065
336 Ga0450920_021578 3300042122 Bacteria 1246
337 Ga0439458_0001585 3300042157 Bacteria 5680
338 Ga0451577_0454094 3300042876 Bacteria 1164
339 Ga0466965_0009881 3300044683 Bacteria 4439
340 Ga0466966_0128710 3300044684 Bacteria 1551
341 Ga0466961_0021721 3300044693 Bacteria 4129
342 Ga0466961_0498378 3300044693 Bacteria 735
343 Ga0466968_0052416 3300044735 Bacteria 1745
344 Ga0466970_0018629 3300044765 Bacteria 3597
345 Ga0466957_0544323 3300044842 Bacteria 808
346 Ga0466959_0002221 3300045049 Bacteria 12362
347 Ga0466967_0917539 3300045976 Bacteria 871
348 Ga0495583_0000038 3300046506 Bacteria 243395
349 Ga0495606_0015264 3300046507 Bacteria 5928
350 Ga0495606_0027801 3300046507 Bacteria 4003
351 Ga0495606_0342005 3300046507 Bacteria 797
352 Ga0495648_0306787 3300046524 Bacteria 741
353 Ga0495621_0048483 3300046539 Bacteria 1513
354 Ga0495661_0193296 3300046665 Bacteria 1070
355 Ga0495669_0002940 3300046684 Bacteria 7002
356 Ga0495669_0294119 3300046684 Bacteria 782
357 Ga0495670_0026006 3300046691 Bacteria 2897
358 Ga0495683_0137165 3300047323 Bacteria 1149
359 Ga0495687_108284 3300047443 Bacteria 1027
360 Ga0495686_0001180 3300047472 Bacteria 30452
361 Ga0495686_0013900 3300047472 Bacteria 5570
362 Ga0495686_0026515 3300047472 Bacteria 3790
363 Ga0495626_0260771 3300048091 Bacteria 693
364 Ga0496102_0221274 3300048905 Bacteria 1785
365 Ga0496108_0532274 3300048911 Bacteria 1026
366 Ga0496109_0168390 3300048912 Bacteria 2055
367 Ga0496110_0148557 3300048913 Bacteria 2121
368 Ga0496111_0146911 3300048914 Bacteria 1748
369 Ga0496117_0170373 3300048920 Bacteria 1264
370 Ga0496118_0014286 3300048921 Bacteria 7447
371 Ga0496118_0108997 3300048921 Bacteria 1844
372 Ga0496118_0293506 3300048921 Bacteria 897
373 Ga0496118_0324667 3300048921 Bacteria 833
374 Ga0496119_0021258 3300048922 Bacteria 4697
375 Ga0496120_0188712 3300048923 Bacteria 1006
376 Ga0496121_0013505 3300048924 Bacteria 8766
377 Ga0496121_0034647 3300048924 Bacteria 4542
378 Ga0496121_0835333 3300048924 Bacteria 537
379 Ga0496122_0002498 3300048925 Bacteria 25978
380 Ga0496122_0020308 3300048925 Bacteria 6011
381 Ga0496123_0005014 3300048926 Bacteria 13555
382 Ga0496123_0011998 3300048926 Bacteria 7432
383 Ga0496123_0090761 3300048926 Bacteria 1815
384 Ga0496124_0012349 3300048927 Bacteria 8435
385 Ga0496124_0317582 3300048927 Bacteria 1117
386 Ga0496124_0384695 3300048927 Bacteria 980
387 Ga0496124_0743469 3300048927 Bacteria 615
388 Ga0496124_0815600 3300048927 Bacteria 576
389 Ga0496125_0048028 3300048928 Bacteria 3563
390 Ga0496125_0074479 3300048928 Bacteria 2632
391 Ga0496125_0117667 3300048928 Bacteria 1905
392 Ga0496125_0629238 3300048928 Bacteria 581
393 Ga0496126_0948736 3300048929 Bacteria 649
394 Ga0495682_0173415 3300049460 Bacteria 767
395 Ga0501290_005933 3300049513 Bacteria 1523
396 Ga0501300_002856 3300049523 Bacteria 2581
397 Ga0501067_0010483 3300049583 Bacteria 5131
398 Ga0501249_002715 3300049679 Bacteria 3565
399 Ga0501257_000127 3300049686 Bacteria 17543
400 Ga0501280_006279 3300049776 Bacteria 1678
401 nmdc:mga00v17_162212_c1 3300050491 Bacteria 1439
402 nmdc:mga0k408_47641_c1 3300050493 Bacteria 2477
403 nmdc:mga0k408_52517_c1 3300050493 Bacteria 2362
404 nmdc:mga0qj67_40214_c1 3300050509 Bacteria 3675
405 Ga0500643_206581 3300053087 Bacteria 527
406 Ga0500555_008517 3300053103 Bacteria 2925
407 Ga0500555_014599 3300053103 Bacteria 2264
408 Ga0500556_0163608 3300053104 Bacteria 878
409 Ga0500564_145270 3300053138 Bacteria 1015
410 Ga0500577_0056447 3300053142 Bacteria 1495
411 Ga0500616_0099575 3300053153 Bacteria 1423
412 Ga0500616_0110614 3300053153 Bacteria 1327
413 Ga0590071_166141 3300059421 Bacteria 575
414 Ga0587101_005154 3300059623 Bacteria 1436
415 Ga0587128_000880 3300059630 Bacteria 2589
416 Ga0587124_000300 3300059660 Bacteria 2526
417 Ga0466962_0039928 3300061719 Bacteria 2247
418 Ga0157371_10068304
419 JGI24736J21556_1004956
420 JGI24736J21556_1009367
421 JGI24736J21556_1011161
422 JGI24736J21556_1056618
423 JGI24740J21852_10005435
424 JGI24739J22299_10000499
425 JGI24739J22299_10002846
426 JGI24739J22299_10007494
427 JGI24737J22298_10000425
428 JGI24737J22298_10004152
429 JGI24737J22298_10016120
430 JGI24737J22298_10070336
431 JGI24737J22298_10084113
432 JGI24737J22298_10173614
433 JGI24743J22301_10032774
434 JGI24735J21928_10008328
435 JGI24735J21928_10008594
436 JGI24735J21928_10010197
437 JGI24735J21928_10013019
438 JGI24735J21928_10014717
439 JGI24735J21928_10017244
440 JGI24735J21928_10017843
441 JGI24735J21928_10034138
442 JGI24735J21928_10046550
443 JGI24735J21928_10079014
444 JGI24735J21928_10110931
445 JGI24735J21928_10118887
446 JGI24735J21928_10119910
447 JGI24738J21930_10000040
448 JGI24749J21850_1000218
449 JGI24744J21845_10000530
450 JGI24034J26672_10056361
451 JGI25157J39369_1026212
452 JGI25157J39369_1027831
453 JGI25165J46597_1000082
454 rootH1_10023776
455 rootL2_10067612
456 rootL2_10111258
457 Ga0065712_10025333
458 Ga0065715_10151206
459 Ga0065707_10093614
460 Ga0065707_10548540
461 Ga0070658_10017222
462 Ga0070658_10226419
463 Ga0070658_10439342
464 Ga0070676_10000043
465 Ga0070670_100054445
466 Ga0070670_100402937
467 Ga0068869_100000014
468 Ga0070666_10118705
469 Ga0070666_10508584
470 Ga0068868_100000015
471 Ga0070660_100000280
472 Ga0070660_100049239
473 Ga0070660_100066952
474 Ga0070687_100133034
475 Ga0070661_100716557
476 Ga0070668_100104725
477 Ga0070668_100105017
478 Ga0070668_100614786
479 Ga0070669_100000119
480 Ga0070669_100055434
481 Ga0070669_100092353
482 Ga0070669_101748860
483 Ga0070675_100002667
484 Ga0070675_100099795
485 Ga0070675_100836555
486 Ga0070671_100009712
487 Ga0070671_100026971
488 Ga0070671_100155494
489 Ga0070674_100030763
490 Ga0070674_100036788
491 Ga0070674_100100296
492 Ga0070673_100000098
493 Ga0070673_100129468
494 Ga0070659_100037250
495 Ga0070659_100466548
496 Ga0070659_101551939
497 Ga0070667_100000407
498 Ga0070663_100731927
499 Ga0070663_101522061
500 Ga0070663_102024314
501 Ga0070678_100079236
502 Ga0070662_100003287
503 Ga0070662_100213695
504 Ga0070662_100566653
505 Ga0070681_10276139
506 Ga0068867_100000008
507 Ga0068867_101316418
508 Ga0068853_100112950
509 Ga0068853_100233976
510 Ga0068853_100373534
511 Ga0070672_100018323
512 Ga0070672_100597351
513 Ga0070693_100037937
514 Ga0070665_100865204
515 Ga0068855_100036032
516 Ga0068855_100509389
517 Ga0070664_100098528
518 Ga0070664_100159508
519 Ga0070664_101476807
520 Ga0068857_100359816
521 Ga0068856_100002832
522 Ga0068856_100177323
523 Ga0070702_100974338
524 Ga0068852_100065803
525 Ga0068852_100685589
526 Ga0068852_101234667
527 Ga0068852_101571947
528 Ga0068859_100010149
529 Ga0068864_100272404
530 Ga0068861_100234548
531 Ga0068861_101791336
532 Ga0068870_10060481
533 Ga0068863_100003363
534 Ga0068863_100110100
535 Ga0068862_100000011
536 Ga0068862_100469141
537 Ga0075368_10286108
538 Ga0075366_10039836
539 Ga0075366_10107099
540 Ga0068865_100000036
541 Ga0068865_100358037
542 Ga0097620_100010149
543 Ga0105240_10131648
544 Ga0105240_11586149
545 Ga0105245_10003374
546 Ga0105243_10000625
547 Ga0105242_10010105
548 Ga0105248_10900509
549 Ga0105237_10032435
550 Ga0105237_10692829
551 Ga0105238_11017600
552 Ga0105249_10014632
553 Ga0105239_10349003
554 Ga0105246_10045191
555 Ga0105246_10169600
556 Ga0105246_11564434
557 Ga0157326_1000156
558 Ga0157373_10069981
559 Ga0157373_10128281
560 Ga0157373_10249373
561 Ga0157373_10420567
562 Ga0157373_10439398
563 Ga0157373_10881285
564 Ga0157371_10146437
565 Ga0157371_10192669
566 Ga0157371_10499091
567 Ga0157371_11317769
568 Ga0157370_10000112
569 Ga0157370_11388877
570 Ga0157369_10042823
571 Ga0157369_10112726
572 Ga0157369_10183560
573 Ga0157369_10615207
574 Ga0157369_10878774
575 Ga0157374_10001100
576 Ga0157374_11600617
577 Ga0157374_12174880
578 Ga0157378_10001248
579 Ga0163162_10323260
580 Ga0163162_10809640
581 Ga0157372_10060831
582 Ga0157372_10135043
583 Ga0157372_10421967
584 Ga0157372_10442129
585 Ga0157372_10659122
586 Ga0157372_10869228
587 Ga0157372_11108161
588 Ga0157372_11187732
589 Ga0157375_10009204
590 Ga0157380_10001430
591 Ga0157380_10150058
592 Ga0157380_10728580
593 Ga0157377_10055679
594 Ga0157376_10000033
595 Ga0163161_10384187
596 Ga0163161_11055953
597 Ga0207427_100526
598 Ga0209026_1005392
599 Ga0209148_1000127
600 Ga0209148_1004200
601 Ga0209233_1000041
602 Ga0209455_1034575
603 Ga0207682_10035217
604 Ga0207642_10348765
605 Ga0207688_10054407
606 Ga0207680_10012735
607 Ga0207680_10061914
608 Ga0207680_10240402
609 Ga0207647_10002638
610 Ga0207647_10012142
611 Ga0207647_10026436
612 Ga0207647_10027184
613 Ga0207647_10052284
614 Ga0207647_10114276
615 Ga0207647_10243382
616 Ga0207645_10000117
617 Ga0207645_10171794
618 Ga0207705_10002415
619 Ga0207705_10358257
620 Ga0207705_10848091
621 Ga0207707_10471975
622 Ga0207695_10053176
623 Ga0207671_10133601
624 Ga0207671_10460294
625 Ga0207657_10000983
626 Ga0207657_10014533
627 Ga0207657_10015601
628 Ga0207681_10000001
629 Ga0207681_10909913
630 Ga0207694_10278257
631 Ga0207650_10000018
632 Ga0207650_10058848
633 Ga0207650_10487178
634 Ga0207659_10005343
635 Ga0207659_11033178
636 Ga0207687_10000372
637 Ga0207644_10083792
638 Ga0207644_10169876
639 Ga0207644_10786152
640 Ga0207690_10020269
641 Ga0207690_10043589
642 Ga0207690_10293626
643 Ga0207690_10612900
644 Ga0207690_11430362
645 Ga0207706_10003421
646 Ga0207706_10045597
647 Ga0207706_10103166
648 Ga0207706_10220286
649 Ga0207706_10309401
650 Ga0207706_10912649
651 Ga0207709_10000102
652 Ga0207669_10148371
653 Ga0207704_10000014
654 Ga0207704_10310008
655 Ga0207691_10059814
656 Ga0207691_10672399
657 Ga0207689_10000364
658 Ga0207679_11855002
659 Ga0207667_10490765
660 Ga0207667_10594441
661 Ga0207651_10000015
662 Ga0207651_10306421
663 Ga0207712_10007151
664 Ga0207668_10308355
665 Ga0207668_10548057
666 Ga0207658_10001469
667 Ga0207658_11297866
668 Ga0207677_10000097
669 Ga0207639_10260661
670 Ga0207678_10127930
671 Ga0207678_10674959
672 Ga0207678_11900625
673 Ga0207702_10003314
674 Ga0207641_10103806
675 Ga0207641_10262573
676 Ga0207648_10000014
677 Ga0207648_10368805
678 Ga0207676_10000004
679 Ga0207676_11060667
680 Ga0207674_10019434
681 Ga0207674_10253942
682 Ga0207675_100001128
683 Ga0207675_102257398
684 Ga0207683_10007411
685 Ga0207698_10096358
686 Ga0207698_10427291
687 Ga0207698_11444009
688 Ga0209967_1058565
689 Ga0209974_10012483
690 Ga0268266_11607873
691 Ga0268265_10000002
692 Ga0268265_11634818
693 Ga0307408_100053439
694 Ga0307408_100089281
695 Ga0307405_10032752
696 Ga0307405_10054703
697 Ga0307405_10215897
698 Ga0307405_10412961
699 Ga0307413_10011941
700 Ga0307413_10220232
701 Ga0307410_10082320
702 Ga0307410_10120430
703 Ga0307410_10422557
704 Ga0307406_10119809
705 Ga0307406_10330853
706 Ga0307407_10009986
707 Ga0307407_10690161
708 Ga0307412_10357262
709 Ga0307412_10397357
710 Ga0307409_100009926
711 Ga0307409_100526073
712 Ga0307409_100632998
713 Ga0307409_101609992
714 Ga0307409_101741278
715 Ga0307416_100111611
716 Ga0307416_100307378
717 Ga0307416_100396394
718 Ga0307416_100960569
719 Ga0307414_10043188
720 Ga0307414_10046104
721 Ga0307414_10512816
722 Ga0307414_11054679
723 Ga0307411_10001850
724 Ga0307411_10014110
725 Ga0307411_10200650
726 Ga0307415_100006164
727 Ga0307415_100028330
728 Ga0307415_100387004
729 Ga0307415_100967333
730 Ga0373931_0201526
731 Ga0395899_0003962
732 Ga0395900_0017530
733 Ga0395900_0829123
734 Ga0395898_1576289
735 Ga0395905_1460781
736 Ga0451801_08754
737 Ga0451798_0509006
738 Ga0451800_0865922
739 Ga0451802_1436532
740 Ga0451805_038156
741 Ga0451806_833252
742 Ga0451804_0204772
743 Ga0451841_0836323
744 Ga0439445_0002495
745 Ga0439448_0011460
746 Ga0439448_0031254
747 Ga0439448_0186494
748 Ga0439449_0016276
749 Ga0439455_0006341
750 Ga0439455_0016446
751 Ga0439455_0025859
752 Ga0439455_0052748
753 Ga0450920_021578
754 Ga0439458_0001585
755 Ga0451577_0454094
756 Ga0466965_0009881
757 Ga0466966_0128710
758 Ga0466961_0021721
759 Ga0466961_0498378
760 Ga0466968_0052416
761 Ga0466970_0018629
762 Ga0466957_0544323
763 Ga0466959_0002221
764 Ga0466967_0917539
765 Ga0495583_0000038
766 Ga0495606_0015264
767 Ga0495606_0027801
768 Ga0495606_0342005
769 Ga0495648_0306787
770 Ga0495621_0048483
771 Ga0495661_0193296
772 Ga0495669_0002940
773 Ga0495669_0294119
774 Ga0495670_0026006
775 Ga0495683_0137165
776 Ga0495687_108284
777 Ga0495686_0001180
778 Ga0495686_0013900
779 Ga0495686_0026515
780 Ga0495626_0260771
781 Ga0496102_0221274
782 Ga0496108_0532274
783 Ga0496109_0168390
784 Ga0496110_0148557
785 Ga0496111_0146911
786 Ga0496117_0170373
787 Ga0496118_0014286
788 Ga0496118_0108997
789 Ga0496118_0293506
790 Ga0496118_0324667
791 Ga0496119_0021258
792 Ga0496120_0188712
793 Ga0496121_0013505
794 Ga0496121_0034647
795 Ga0496121_0835333
796 Ga0496122_0002498
797 Ga0496122_0020308
798 Ga0496123_0005014
799 Ga0496123_0011998
800 Ga0496123_0090761
801 Ga0496124_0012349
802 Ga0496124_0317582
803 Ga0496124_0384695
804 Ga0496124_0743469
805 Ga0496124_0815600
806 Ga0496125_0048028
807 Ga0496125_0074479
808 Ga0496125_0117667
809 Ga0496125_0629238
810 Ga0496126_0948736
811 Ga0495682_0173415
812 Ga0501290_005933
813 Ga0501300_002856
814 Ga0501067_0010483
815 Ga0501249_002715
816 Ga0501257_000127
817 Ga0501280_006279
818 nmdc:mga00v17_162212_c1
819 nmdc:mga0k408_47641_c1
820 nmdc:mga0k408_52517_c1
821 nmdc:mga0qj67_40214_c1
822 Ga0500643_206581
823 Ga0500555_008517
824 Ga0500555_014599
825 Ga0500556_0163608
826 Ga0500564_145270
827 Ga0500577_0056447
828 Ga0500616_0099575
829 Ga0500616_0110614
830 Ga0590071_166141
831 Ga0587101_005154
832 Ga0587128_000880
833 Ga0587124_000300
834 Ga0466962_0039928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

33

156

0.94

Map