F440754

General Info

Members Datasets Scaffolds Average Seq Length
424 188 772 296

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10571060|Ga0163162_105710602
Length 274
Sequence MPAFSQPAGKVVEQETVSSTILGRSVHYTVYLPADYDISQRSYPVVYLLHGFTDDNTGWLQFGEINRYADKAIADGTIPPMIIIMPNADSSWYINSYDGKENYEDFFIKELMPFVEKKYRIKAGVAGLSMGGYGTLIYALKYPQLFAAAAPLSAGIFTSDELKAMPDNNYANVLARVFGSNLKGDARLTDQWYANSVLDIVAKESTDSLKRVRYWIDCGDDDFLTNANCLLHIALVTKHVPHEFRMRDGAHNWTYWRTGITDALQFIGDSFHQK

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
134 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
174 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
175 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
185 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
186 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
187 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
188 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0
Rhizoplane 0.47
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10571060 3300013306 Bacteria 1258
2 JGI24736J21556_1003395 3300001904 Bacteria 2767
3 JGI24739J22299_10033345 3300001989 Bacteria 1762
4 JGI24739J22299_10050340 3300001989 Bacteria 1348
5 JGI24737J22298_10000796 3300001990 Bacteria 11186
6 JGI24735J21928_10000008 3300002067 Bacteria 319819
7 JGI25162J39368_1000183 3300002737 Bacteria 67086
8 rootH1_10027967 3300003316 Unclassified 1684
9 rootH1_10032600 3300003316 Bacteria 7369
10 rootL2_10088930 3300003322 Bacteria 1385
11 rootL2_10104135 3300003322 Bacteria 9618
12 rootL2_10192222 3300003322 Bacteria 1676
13 JGI25160J50197_1002234 3300003354 Bacteria 9095
14 Ga0065714_10067958 3300005288 Bacteria 5068
15 Ga0065707_10010946 3300005295 Bacteria 3158
16 Ga0070676_10001416 3300005328 Bacteria 12103
17 Ga0070676_10073821 3300005328 Unclassified 2053
18 Ga0070676_10150702 3300005328 Bacteria 1488
19 Ga0070676_10363012 3300005328 Bacteria 998
20 Ga0070683_100017296 3300005329 Bacteria 6371
21 Ga0070690_100012007 3300005330 Bacteria 5083
22 Ga0070690_100040567 3300005330 Unclassified 2944
23 Ga0070690_100073318 3300005330 Bacteria 2227
24 Ga0070670_100085975 3300005331 Bacteria 2702
25 Ga0070670_100356791 3300005331 Unclassified 1285
26 Ga0070677_10043497 3300005333 Bacteria 1784
27 Ga0068869_100139178 3300005334 Bacteria 1873
28 Ga0068869_100158106 3300005334 Bacteria 1763
29 Ga0068869_100426704 3300005334 Unclassified 1095
30 Ga0070666_10013801 3300005335 Bacteria 5133
31 Ga0070666_10058911 3300005335 Unclassified 2597
32 Ga0070682_100006801 3300005337 Bacteria 6419
33 Ga0068868_100023984 3300005338 Unclassified 4624
34 Ga0068868_100070021 3300005338 Bacteria 2796
35 Ga0068868_100115824 3300005338 Bacteria 2182
36 Ga0070689_100088208 3300005340 Unclassified 2441
37 Ga0070689_100111768 3300005340 Unclassified 2174
38 Ga0070661_100011266 3300005344 Bacteria 6229
39 Ga0070668_100078612 3300005347 Bacteria 2580
40 Ga0070669_100031635 3300005353 Bacteria 3822
41 Ga0070669_100033239 3300005353 Bacteria 3730
42 Ga0070675_100157454 3300005354 Bacteria 1951
43 Ga0070671_100066144 3300005355 Bacteria 3012
44 Ga0070671_100503443 3300005355 Bacteria 1042
45 Ga0070674_100002319 3300005356 Bacteria 10514
46 Ga0070673_100109244 3300005364 Bacteria 2291
47 Ga0070673_100127155 3300005364 Unclassified 2134
48 Ga0070688_100030061 3300005365 Bacteria 3257
49 Ga0070688_100041268 3300005365 Bacteria 2832
50 Ga0070688_100046543 3300005365 Bacteria 2687
51 Ga0070659_100062710 3300005366 Bacteria 2939
52 Ga0070667_100520964 3300005367 Unclassified 1091
53 Ga0070700_100014173 3300005441 Bacteria 4499
54 Ga0070678_100041496 3300005456 Bacteria 3262
55 Ga0070662_100018711 3300005457 Bacteria 4691
56 Ga0070662_100037247 3300005457 Bacteria 3448
57 Ga0070662_100055114 3300005457 Bacteria 2884
58 Ga0070662_100334978 3300005457 Unclassified 1237
59 Ga0070685_10177177 3300005466 Bacteria 1370
60 Ga0070698_100003211 3300005471 Bacteria 18007
61 Ga0070698_100011101 3300005471 Bacteria 9571
62 Ga0070684_100020837 3300005535 Bacteria 5441
63 Ga0070684_100093556 3300005535 Bacteria 2676
64 Ga0070684_100212668 3300005535 Bacteria 1762
65 Ga0070684_100233086 3300005535 Bacteria 1681
66 Ga0068853_100001327 3300005539 Bacteria 17802
67 Ga0068853_100245727 3300005539 Bacteria 1641
68 Ga0068853_100548214 3300005539 Bacteria 1095
69 Ga0070672_100159452 3300005543 Bacteria 1871
70 Ga0070672_100181346 3300005543 Bacteria 1755
71 Ga0070695_100369799 3300005545 Bacteria 1079
72 Ga0070665_100000008 3300005548 Bacteria 606341
73 Ga0068855_100016939 3300005563 Bacteria 8764
74 Ga0068855_100122909 3300005563 Bacteria 2970
75 Ga0070664_100000360 3300005564 Bacteria 33570
76 Ga0070664_100028393 3300005564 Bacteria 4653
77 Ga0070664_100059063 3300005564 Unclassified 3263
78 Ga0070664_100324465 3300005564 Unclassified 1396
79 Ga0068857_100000323 3300005577 Bacteria 32881
80 Ga0068857_100024671 3300005577 Bacteria 5295
81 Ga0068857_100092625 3300005577 Bacteria 2706
82 Ga0068854_100110978 3300005578 Bacteria 2069
83 Ga0068852_100000631 3300005616 Bacteria 23016
84 Ga0068852_100129854 3300005616 Bacteria 2319
85 Ga0068859_100143503 3300005617 Bacteria 2461
86 Ga0068859_100498056 3300005617 Bacteria 1313
87 Ga0068864_100014750 3300005618 Bacteria 6492
88 Ga0068864_100083653 3300005618 Bacteria 2803
89 Ga0068861_100057617 3300005719 Bacteria 2968
90 Ga0068861_100064190 3300005719 Bacteria 2824
91 Ga0068861_100638380 3300005719 Bacteria 982
92 Ga0068870_10002834 3300005840 Bacteria 7302
93 Ga0068863_100147360 3300005841 Unclassified 2252
94 Ga0068863_100215328 3300005841 Unclassified 1850
95 Ga0068863_100434481 3300005841 Unclassified 1287
96 Ga0068863_100549116 3300005841 Bacteria 1141
97 Ga0068858_100199840 3300005842 Bacteria 1890
98 Ga0068858_100287849 3300005842 Unclassified 1566
99 Ga0068860_100000029 3300005843 Bacteria 259192
100 Ga0068860_100008584 3300005843 Bacteria 10185
101 Ga0068860_100011846 3300005843 Bacteria 8596
102 Ga0068860_100016954 3300005843 Bacteria 7100
103 Ga0068862_100008081 3300005844 Bacteria 8709
104 Ga0068862_100029200 3300005844 Bacteria 4646
105 Ga0068862_100048714 3300005844 Bacteria 3618
106 Ga0068862_100364979 3300005844 Unclassified 1343
107 Ga0075366_10158555 3300006195 Bacteria 1371
108 Ga0097621_100198411 3300006237 Unclassified 1741
109 Ga0068871_100424087 3300006358 Bacteria 1188
110 Ga0075429_100389043 3300006880 Bacteria 1221
111 Ga0068865_100047269 3300006881 Bacteria 2956
112 Ga0068865_100284085 3300006881 Unclassified 1318
113 Ga0097620_100143491 3300006931 Bacteria 2461
114 Ga0097620_100498070 3300006931 Bacteria 1313
115 Ga0105240_10003982 3300009093 Bacteria 22790
116 Ga0105240_10014188 3300009093 Bacteria 10882
117 Ga0105240_10127989 3300009093 Bacteria 3049
118 Ga0111539_10017182 3300009094 Bacteria 8955
119 Ga0111539_10031303 3300009094 Bacteria 6463
120 Ga0105241_10030156 3300009174 Bacteria 4052
121 Ga0105241_10040780 3300009174 Bacteria 3505
122 Ga0105241_10100151 3300009174 Bacteria 2302
123 Ga0105241_10251868 3300009174 Bacteria 1497
124 Ga0105242_10040941 3300009176 Bacteria 3735
125 Ga0105242_10071692 3300009176 Bacteria 2876
126 Ga0105242_10389047 3300009176 Bacteria 1298
127 Ga0105248_10160734 3300009177 Bacteria 2534
128 Ga0105248_10859063 3300009177 Unclassified 1024
129 Ga0105237_10003152 3300009545 Bacteria 19845
130 Ga0105237_10008782 3300009545 Bacteria 10901
131 Ga0105237_10033278 3300009545 Bacteria 5222
132 Ga0105237_10052309 3300009545 Bacteria 4100
133 Ga0105237_10116431 3300009545 Bacteria 2666
134 Ga0105237_10691335 3300009545 Unclassified 1027
135 Ga0105249_10057006 3300009553 Bacteria 3578
136 Ga0105249_10336761 3300009553 Bacteria 1524
137 Ga0105249_10357638 3300009553 Unclassified 1481
138 Ga0105249_10359273 3300009553 Bacteria 1477
139 Ga0105249_10592307 3300009553 Unclassified 1163
140 Ga0105239_10000816 3300010375 Bacteria 44236
141 Ga0105239_10003173 3300010375 Bacteria 20361
142 Ga0105239_10011821 3300010375 Bacteria 9742
143 Ga0105239_10034359 3300010375 Bacteria 5567
144 Ga0105239_10286484 3300010375 Bacteria 1855
145 Ga0105239_10451588 3300010375 Bacteria 1458
146 Ga0105239_10602136 3300010375 Bacteria 1253
147 Ga0105246_10001324 3300011119 Bacteria 14568
148 Ga0157373_10042010 3300013100 Bacteria 3269
149 Ga0157371_10007149 3300013102 Bacteria 9066
150 Ga0157371_10054902 3300013102 Bacteria 2828
151 Ga0157370_10347720 3300013104 Bacteria 1367
152 Ga0157369_10126154 3300013105 Bacteria 2713
153 Ga0157369_10214533 3300013105 Bacteria 2016
154 Ga0157369_10380474 3300013105 Bacteria 1465
155 Ga0157369_10464859 3300013105 Unclassified 1310
156 Ga0157374_10024086 3300013296 Bacteria 5452
157 Ga0157374_10034904 3300013296 Unclassified 4599
158 Ga0157374_10264270 3300013296 Bacteria 1696
159 Ga0157378_10007614 3300013297 Bacteria 9453
160 Ga0157378_10078099 3300013297 Bacteria 2985
161 Ga0157378_10086711 3300013297 Bacteria 2838
162 Ga0157378_10239671 3300013297 Bacteria 1732
163 Ga0157378_10287284 3300013297 Bacteria 1587
164 Ga0157378_10353933 3300013297 Bacteria 1435
165 Ga0163162_10002323 3300013306 Bacteria 17844
166 Ga0163162_10002751 3300013306 Bacteria 16697
167 Ga0163162_10004892 3300013306 Bacteria 12916
168 Ga0163162_10005776 3300013306 Bacteria 11971
169 Ga0163162_10013352 3300013306 Bacteria 8020
170 Ga0163162_10112506 3300013306 Bacteria 2821
171 Ga0163162_10145257 3300013306 Bacteria 2488
172 Ga0157372_10002043 3300013307 Bacteria 21955
173 Ga0157372_10008025 3300013307 Bacteria 11228
174 Ga0157372_10170040 3300013307 Bacteria 2521
175 Ga0157372_10397192 3300013307 Bacteria 1607
176 Ga0157375_10005531 3300013308 Bacteria 10994
177 Ga0157375_10024349 3300013308 Bacteria 5601
178 Ga0157375_10031558 3300013308 Bacteria 5011
179 Ga0163163_10002119 3300014325 Bacteria 16744
180 Ga0163163_10163957 3300014325 Unclassified 2268
181 Ga0163163_10203108 3300014325 Bacteria 2030
182 Ga0157380_10010608 3300014326 Bacteria 6629
183 Ga0157377_10005271 3300014745 Bacteria 6057
184 Ga0157379_10189931 3300014968 Bacteria 1856
185 Ga0157379_10328909 3300014968 Bacteria 1396
186 Ga0157376_10067408 3300014969 Bacteria 3027
187 Ga0157376_10332815 3300014969 Unclassified 1447
188 Ga0157376_10524468 3300014969 Bacteria 1168
189 Ga0163161_10008140 3300017792 Bacteria 7249
190 Ga0163161_10084965 3300017792 Bacteria 2334
191 Ga0213876_10000984 3300021384 Bacteria 18715
192 Ga0209437_100089 3300025233 Bacteria 250476
193 Ga0207426_1000023 3300025302 Bacteria 545465
194 Ga0207642_10026833 3300025899 Bacteria 2350
195 Ga0207688_10001993 3300025901 Bacteria 10954
196 Ga0207688_10119481 3300025901 Unclassified 1537
197 Ga0207680_10031000 3300025903 Bacteria 3024
198 Ga0207680_10035993 3300025903 Bacteria 2848
199 Ga0207680_10244969 3300025903 Unclassified 1236
200 Ga0207647_10000054 3300025904 Bacteria 86704
201 Ga0207647_10065100 3300025904 Bacteria 2213
202 Ga0207645_10000198 3300025907 Bacteria 49061
203 Ga0207645_10005936 3300025907 Bacteria 8797
204 Ga0207645_10089309 3300025907 Bacteria 1981
205 Ga0207643_10020638 3300025908 Bacteria 3616
206 Ga0207643_10052566 3300025908 Bacteria 2314
207 Ga0207695_10007439 3300025913 Bacteria 13937
208 Ga0207695_10033063 3300025913 Bacteria 5649
209 Ga0207695_10086416 3300025913 Bacteria 3163
210 Ga0207671_10001778 3300025914 Bacteria 24205
211 Ga0207671_10003802 3300025914 Bacteria 14807
212 Ga0207671_10006180 3300025914 Bacteria 10754
213 Ga0207671_10026334 3300025914 Bacteria 4360
214 Ga0207671_10061140 3300025914 Bacteria 2795
215 Ga0207671_10061682 3300025914 Bacteria 2783
216 Ga0207671_10328320 3300025914 Unclassified 1211
217 Ga0207649_10238214 3300025920 Unclassified 1305
218 Ga0207649_10242085 3300025920 Unclassified 1295
219 Ga0207681_10091929 3300025923 Bacteria 2168
220 Ga0207681_10472859 3300025923 Bacteria 1023
221 Ga0207650_10093731 3300025925 Bacteria 2299
222 Ga0207650_10336110 3300025925 Unclassified 1240
223 Ga0207659_10377369 3300025926 Unclassified 1182
224 Ga0207659_10382624 3300025926 Bacteria 1174
225 Ga0207644_10092073 3300025931 Bacteria 2261
226 Ga0207644_10202161 3300025931 Unclassified 1568
227 Ga0207644_10251619 3300025931 Bacteria 1410
228 Ga0207690_10050172 3300025932 Bacteria 2785
229 Ga0207690_10210019 3300025932 Bacteria 1483
230 Ga0207706_10011289 3300025933 Bacteria 8141
231 Ga0207706_10014965 3300025933 Bacteria 7024
232 Ga0207706_10077591 3300025933 Bacteria 2921
233 Ga0207706_10087955 3300025933 Unclassified 2732
234 Ga0207670_10031962 3300025936 Bacteria 3379
235 Ga0207691_10020435 3300025940 Bacteria 6259
236 Ga0207691_10036561 3300025940 Bacteria 4551
237 Ga0207691_10062901 3300025940 Bacteria 3366
238 Ga0207689_10001133 3300025942 Bacteria 25688
239 Ga0207689_10003219 3300025942 Bacteria 14956
240 Ga0207689_10004134 3300025942 Bacteria 13188
241 Ga0207689_10018743 3300025942 Bacteria 5837
242 Ga0207689_10021858 3300025942 Bacteria 5380
243 Ga0207689_10253116 3300025942 Bacteria 1456
244 Ga0207689_10413390 3300025942 Unclassified 1125
245 Ga0207661_10010446 3300025944 Bacteria 6683
246 Ga0207661_10092556 3300025944 Bacteria 2520
247 Ga0207679_10000575 3300025945 Bacteria 24610
248 Ga0207679_10029528 3300025945 Bacteria 3818
249 Ga0207679_10154006 3300025945 Unclassified 1875
250 Ga0207667_10017043 3300025949 Bacteria 8195
251 Ga0207667_10063957 3300025949 Bacteria 3843
252 Ga0207651_10008349 3300025960 Bacteria 5589
253 Ga0207651_10124121 3300025960 Bacteria 1964
254 Ga0207712_10206835 3300025961 Unclassified 1560
255 Ga0207668_10246811 3300025972 Bacteria 1448
256 Ga0207640_10157288 3300025981 Bacteria 1677
257 Ga0207658_10490238 3300025986 Unclassified 1093
258 Ga0207677_10078290 3300026023 Unclassified 2360
259 Ga0207677_10085463 3300026023 Bacteria 2277
260 Ga0207639_10005654 3300026041 Bacteria 8459
261 Ga0207639_10138760 3300026041 Unclassified 2023
262 Ga0207639_10504522 3300026041 Bacteria 1106
263 Ga0207678_10103735 3300026067 Unclassified 2427
264 Ga0207641_10290196 3300026088 Bacteria 1542
265 Ga0207648_10004601 3300026089 Bacteria 14145
266 Ga0207648_10012208 3300026089 Bacteria 8045
267 Ga0207648_10043409 3300026089 Bacteria 3947
268 Ga0207648_10047763 3300026089 Bacteria 3750
269 Ga0207676_10007795 3300026095 Bacteria 7615
270 Ga0207676_10351616 3300026095 Bacteria 1363
271 Ga0207674_10001817 3300026116 Bacteria 27232
272 Ga0207674_10015441 3300026116 Bacteria 8391
273 Ga0207674_10040221 3300026116 Bacteria 4845
274 Ga0207674_10043093 3300026116 Unclassified 4655
275 Ga0207674_10378151 3300026116 Bacteria 1369
276 Ga0207675_100018687 3300026118 Bacteria 6469
277 Ga0207675_100048495 3300026118 Unclassified 3964
278 Ga0207683_10008601 3300026121 Bacteria 8732
279 Ga0207683_10028608 3300026121 Unclassified 4820
280 Ga0207698_10015583 3300026142 Bacteria 5095
281 Ga0207698_10058347 3300026142 Bacteria 2991
282 Ga0207698_10108469 3300026142 Bacteria 2321
283 Ga0268266_10000016 3300028379 Bacteria 629101
284 Ga0268265_10281662 3300028380 Unclassified 1488
285 Ga0268264_10000072 3300028381 Bacteria 260791
286 Ga0268264_10003369 3300028381 Bacteria 13813
287 Ga0268264_10007535 3300028381 Bacteria 9080
288 Ga0268264_10029822 3300028381 Bacteria 4471
289 Ga0268264_10047596 3300028381 Bacteria 3565
290 Ga0268264_10110068 3300028381 Bacteria 2411
291 Ga0268264_10353214 3300028381 Unclassified 1400
292 Ga0268264_10392207 3300028381 Bacteria 1332
293 Ga0307515_10000039 3300028794 Bacteria 323229
294 Ga0307515_10001879 3300028794 Bacteria 46722
295 Ga0307515_10007245 3300028794 Bacteria 21963
296 Ga0265327_10010552 3300031251 Bacteria 6474
297 Ga0307507_10000032 3300033179 Bacteria 194155
298 Ga0307510_10181849 3300033180 Bacteria 1664
299 Ga0373955_0051056 3300035172 Bacteria 2252
300 Ga0373937_0025425 3300036401 Bacteria 5344
301 Ga0451853_3379980 3300041512 Bacteria 1564
302 Ga0439442_002905 3300042002 Bacteria 3376
303 Ga0439445_0055334 3300042004 Unclassified 1077
304 Ga0453684_0228405 3300044712 Bacteria 2150
305 Ga0466968_0030879 3300044735 Bacteria 2221
306 Ga0495592_0071715 3300046454 Bacteria 2521
307 Ga0495629_0215769 3300046459 Bacteria 1324
308 Ga0495638_0076515 3300046460 Bacteria 2039
309 Ga0495651_0090469 3300046462 Bacteria 2296
310 Ga0495650_0000119 3300046471 Bacteria 185719
311 Ga0495650_0033089 3300046471 Bacteria 2305
312 Ga0495585_0000173 3300046492 Bacteria 69500
313 Ga0495585_0001496 3300046492 Bacteria 18225
314 Ga0495585_0003557 3300046492 Bacteria 10458
315 Ga0495583_0010045 3300046506 Bacteria 5576
316 Ga0495606_0000008 3300046507 Bacteria 321373
317 Ga0495606_0059804 3300046507 Bacteria 2443
318 Ga0495606_0098214 3300046507 Bacteria 1787
319 Ga0495606_0127834 3300046507 Bacteria 1514
320 Ga0495608_0077612 3300046511 Bacteria 2162
321 Ga0495610_0002038 3300046512 Bacteria 17252
322 Ga0495616_0036331 3300046513 Bacteria 2542
323 Ga0495616_0045978 3300046513 Bacteria 2206
324 Ga0495618_0107221 3300046514 Bacteria 1789
325 Ga0495628_0226731 3300046516 Bacteria 1402
326 Ga0495637_0013908 3300046520 Bacteria 3810
327 Ga0495648_0007737 3300046524 Bacteria 8555
328 Ga0495648_0036946 3300046524 Bacteria 3144
329 Ga0495648_0045783 3300046524 Bacteria 2718
330 Ga0495652_0137921 3300046529 Bacteria 1922
331 Ga0495609_0009807 3300046538 Bacteria 4619
332 Ga0495609_0019718 3300046538 Bacteria 3118
333 Ga0495645_0130217 3300046543 Unclassified 1764
334 Ga0495633_0000032 3300046558 Bacteria 193765
335 Ga0495633_0022405 3300046558 Bacteria 3144
336 Ga0495668_0000667 3300046616 Bacteria 41283
337 Ga0495611_0121189 3300046648 Bacteria 1219
338 Ga0495625_0000017 3300046660 Bacteria 299728
339 Ga0495625_0000535 3300046660 Bacteria 55840
340 Ga0495625_0000742 3300046660 Bacteria 45511
341 Ga0495625_0016995 3300046660 Bacteria 5705
342 Ga0495625_0051952 3300046660 Bacteria 2936
343 Ga0495625_0105526 3300046660 Bacteria 1930
344 Ga0495661_0008137 3300046665 Bacteria 7266
345 Ga0495599_0130649 3300046678 Bacteria 1560
346 Ga0495658_0005519 3300046683 Bacteria 6218
347 Ga0495613_0245780 3300046689 Bacteria 1250
348 Ga0495649_0000121 3300046694 Bacteria 68443
349 Ga0495600_0148937 3300046809 Bacteria 1516
350 Ga0495660_0011892 3300046810 Bacteria 5049
351 Ga0495687_000004 3300047443 Bacteria 779298
352 Ga0495687_022492 3300047443 Bacteria 3025
353 Ga0495687_035225 3300047443 Bacteria 2254
354 Ga0495679_059385 3300047446 Bacteria 1125
355 Ga0495684_0262574 3300047471 Bacteria 1252
356 Ga0495686_0001124 3300047472 Bacteria 31635
357 Ga0495686_0018957 3300047472 Bacteria 4605
358 Ga0495686_0056501 3300047472 Bacteria 2452
359 Ga0495614_0004858 3300048089 Bacteria 6068
360 Ga0495678_025156 3300049459 Bacteria 2561
361 Ga0501043_0085360 3300049579 Bacteria 2481
362 Ga0501257_006977 3300049686 Bacteria 2516
363 Ga0501259_001418 3300049688 Bacteria 3985
364 Ga0501266_001347 3300049763 Bacteria 3133
365 nmdc:mga0k408_150266_c1 3300050493 Bacteria 1387
366 nmdc:mga08y16_245341_c1 3300050511 Bacteria 1851
367 nmdc:mga08y16_40624_c1 3300050511 Unclassified 4874
368 Ga0495619_0050991 3300053085 Bacteria 2734
369 Ga0500614_021324 3300053123 Bacteria 1502
370 Ga0500614_036053 3300053123 Bacteria 1235
371 Ga0500618_000040 3300053125 Bacteria 112548
372 Ga0500618_017425 3300053125 Bacteria 1787
373 Ga0500618_037639 3300053125 Bacteria 1118
374 Ga0500642_0052782 3300053130 Bacteria 1801
375 Ga0500616_0046204 3300053153 Bacteria 2316
376 Ga0500622_0002434 3300053156 Bacteria 13443
377 2599476623 2599185184 Bacteria 6430550
378 2599476624 2599185184 Bacteria 6430550
379 2919442724 2919437846 Bacteria 6199444
380 2919442725 2919437846 Bacteria 6199444
381 2928078572 2928078545 Bacteria 6534839
382 2928078573 2928078545 Bacteria 6534839
383 2928151750 2928147474 Bacteria 6512076
384 2928151751 2928147474 Bacteria 6512076
385 2932084364 2932082852 Bacteria 6563563
386 2932084365 2932082852 Bacteria 6563563
387 Ga0163162_10571060
388 JGI24736J21556_1003395
389 JGI24739J22299_10033345
390 JGI24739J22299_10050340
391 JGI24737J22298_10000796
392 JGI24735J21928_10000008
393 JGI25162J39368_1000183
394 rootH1_10027967
395 rootH1_10032600
396 rootL2_10088930
397 rootL2_10104135
398 rootL2_10192222
399 JGI25160J50197_1002234
400 Ga0065714_10067958
401 Ga0065707_10010946
402 Ga0070676_10001416
403 Ga0070676_10073821
404 Ga0070676_10150702
405 Ga0070676_10363012
406 Ga0070683_100017296
407 Ga0070690_100012007
408 Ga0070690_100040567
409 Ga0070690_100073318
410 Ga0070670_100085975
411 Ga0070670_100356791
412 Ga0070677_10043497
413 Ga0068869_100139178
414 Ga0068869_100158106
415 Ga0068869_100426704
416 Ga0070666_10013801
417 Ga0070666_10058911
418 Ga0070682_100006801
419 Ga0068868_100023984
420 Ga0068868_100070021
421 Ga0068868_100115824
422 Ga0070689_100088208
423 Ga0070689_100111768
424 Ga0070661_100011266
425 Ga0070668_100078612
426 Ga0070669_100031635
427 Ga0070669_100033239
428 Ga0070675_100157454
429 Ga0070671_100066144
430 Ga0070671_100503443
431 Ga0070674_100002319
432 Ga0070673_100109244
433 Ga0070673_100127155
434 Ga0070688_100030061
435 Ga0070688_100041268
436 Ga0070688_100046543
437 Ga0070659_100062710
438 Ga0070667_100520964
439 Ga0070700_100014173
440 Ga0070678_100041496
441 Ga0070662_100018711
442 Ga0070662_100037247
443 Ga0070662_100055114
444 Ga0070662_100334978
445 Ga0070685_10177177
446 Ga0070698_100003211
447 Ga0070698_100011101
448 Ga0070684_100020837
449 Ga0070684_100093556
450 Ga0070684_100212668
451 Ga0070684_100233086
452 Ga0068853_100001327
453 Ga0068853_100245727
454 Ga0068853_100548214
455 Ga0070672_100159452
456 Ga0070672_100181346
457 Ga0070695_100369799
458 Ga0070665_100000008
459 Ga0068855_100016939
460 Ga0068855_100122909
461 Ga0070664_100000360
462 Ga0070664_100028393
463 Ga0070664_100059063
464 Ga0070664_100324465
465 Ga0068857_100000323
466 Ga0068857_100024671
467 Ga0068857_100092625
468 Ga0068854_100110978
469 Ga0068852_100000631
470 Ga0068852_100129854
471 Ga0068859_100143503
472 Ga0068859_100498056
473 Ga0068864_100014750
474 Ga0068864_100083653
475 Ga0068861_100057617
476 Ga0068861_100064190
477 Ga0068861_100638380
478 Ga0068870_10002834
479 Ga0068863_100147360
480 Ga0068863_100215328
481 Ga0068863_100434481
482 Ga0068863_100549116
483 Ga0068858_100199840
484 Ga0068858_100287849
485 Ga0068860_100000029
486 Ga0068860_100008584
487 Ga0068860_100011846
488 Ga0068860_100016954
489 Ga0068862_100008081
490 Ga0068862_100029200
491 Ga0068862_100048714
492 Ga0068862_100364979
493 Ga0075366_10158555
494 Ga0097621_100198411
495 Ga0068871_100424087
496 Ga0075429_100389043
497 Ga0068865_100047269
498 Ga0068865_100284085
499 Ga0097620_100143491
500 Ga0097620_100498070
501 Ga0105240_10003982
502 Ga0105240_10014188
503 Ga0105240_10127989
504 Ga0111539_10017182
505 Ga0111539_10031303
506 Ga0105241_10030156
507 Ga0105241_10040780
508 Ga0105241_10100151
509 Ga0105241_10251868
510 Ga0105242_10040941
511 Ga0105242_10071692
512 Ga0105242_10389047
513 Ga0105248_10160734
514 Ga0105248_10859063
515 Ga0105237_10003152
516 Ga0105237_10008782
517 Ga0105237_10033278
518 Ga0105237_10052309
519 Ga0105237_10116431
520 Ga0105237_10691335
521 Ga0105249_10057006
522 Ga0105249_10336761
523 Ga0105249_10357638
524 Ga0105249_10359273
525 Ga0105249_10592307
526 Ga0105239_10000816
527 Ga0105239_10003173
528 Ga0105239_10011821
529 Ga0105239_10034359
530 Ga0105239_10286484
531 Ga0105239_10451588
532 Ga0105239_10602136
533 Ga0105246_10001324
534 Ga0157373_10042010
535 Ga0157371_10007149
536 Ga0157371_10054902
537 Ga0157370_10347720
538 Ga0157369_10126154
539 Ga0157369_10214533
540 Ga0157369_10380474
541 Ga0157369_10464859
542 Ga0157374_10024086
543 Ga0157374_10034904
544 Ga0157374_10264270
545 Ga0157378_10007614
546 Ga0157378_10078099
547 Ga0157378_10086711
548 Ga0157378_10239671
549 Ga0157378_10287284
550 Ga0157378_10353933
551 Ga0163162_10002323
552 Ga0163162_10002751
553 Ga0163162_10004892
554 Ga0163162_10005776
555 Ga0163162_10013352
556 Ga0163162_10112506
557 Ga0163162_10145257
558 Ga0157372_10002043
559 Ga0157372_10008025
560 Ga0157372_10170040
561 Ga0157372_10397192
562 Ga0157375_10005531
563 Ga0157375_10024349
564 Ga0157375_10031558
565 Ga0163163_10002119
566 Ga0163163_10163957
567 Ga0163163_10203108
568 Ga0157380_10010608
569 Ga0157377_10005271
570 Ga0157379_10189931
571 Ga0157379_10328909
572 Ga0157376_10067408
573 Ga0157376_10332815
574 Ga0157376_10524468
575 Ga0163161_10008140
576 Ga0163161_10084965
577 Ga0213876_10000984
578 Ga0209437_100089
579 Ga0207426_1000023
580 Ga0207642_10026833
581 Ga0207688_10001993
582 Ga0207688_10119481
583 Ga0207680_10031000
584 Ga0207680_10035993
585 Ga0207680_10244969
586 Ga0207647_10000054
587 Ga0207647_10065100
588 Ga0207645_10000198
589 Ga0207645_10005936
590 Ga0207645_10089309
591 Ga0207643_10020638
592 Ga0207643_10052566
593 Ga0207695_10007439
594 Ga0207695_10033063
595 Ga0207695_10086416
596 Ga0207671_10001778
597 Ga0207671_10003802
598 Ga0207671_10006180
599 Ga0207671_10026334
600 Ga0207671_10061140
601 Ga0207671_10061682
602 Ga0207671_10328320
603 Ga0207649_10238214
604 Ga0207649_10242085
605 Ga0207681_10091929
606 Ga0207681_10472859
607 Ga0207650_10093731
608 Ga0207650_10336110
609 Ga0207659_10377369
610 Ga0207659_10382624
611 Ga0207644_10092073
612 Ga0207644_10202161
613 Ga0207644_10251619
614 Ga0207690_10050172
615 Ga0207690_10210019
616 Ga0207706_10011289
617 Ga0207706_10014965
618 Ga0207706_10077591
619 Ga0207706_10087955
620 Ga0207670_10031962
621 Ga0207691_10020435
622 Ga0207691_10036561
623 Ga0207691_10062901
624 Ga0207689_10001133
625 Ga0207689_10003219
626 Ga0207689_10004134
627 Ga0207689_10018743
628 Ga0207689_10021858
629 Ga0207689_10253116
630 Ga0207689_10413390
631 Ga0207661_10010446
632 Ga0207661_10092556
633 Ga0207679_10000575
634 Ga0207679_10029528
635 Ga0207679_10154006
636 Ga0207667_10017043
637 Ga0207667_10063957
638 Ga0207651_10008349
639 Ga0207651_10124121
640 Ga0207712_10206835
641 Ga0207668_10246811
642 Ga0207640_10157288
643 Ga0207658_10490238
644 Ga0207677_10078290
645 Ga0207677_10085463
646 Ga0207639_10005654
647 Ga0207639_10138760
648 Ga0207639_10504522
649 Ga0207678_10103735
650 Ga0207641_10290196
651 Ga0207648_10004601
652 Ga0207648_10012208
653 Ga0207648_10043409
654 Ga0207648_10047763
655 Ga0207676_10007795
656 Ga0207676_10351616
657 Ga0207674_10001817
658 Ga0207674_10015441
659 Ga0207674_10040221
660 Ga0207674_10043093
661 Ga0207674_10378151
662 Ga0207675_100018687
663 Ga0207675_100048495
664 Ga0207683_10008601
665 Ga0207683_10028608
666 Ga0207698_10015583
667 Ga0207698_10058347
668 Ga0207698_10108469
669 Ga0268266_10000016
670 Ga0268265_10281662
671 Ga0268264_10000072
672 Ga0268264_10003369
673 Ga0268264_10007535
674 Ga0268264_10029822
675 Ga0268264_10047596
676 Ga0268264_10110068
677 Ga0268264_10353214
678 Ga0268264_10392207
679 Ga0307515_10000039
680 Ga0307515_10001879
681 Ga0307515_10007245
682 Ga0265327_10010552
683 Ga0307507_10000032
684 Ga0307510_10181849
685 Ga0373955_0051056
686 Ga0373937_0025425
687 Ga0451853_3379980
688 Ga0439442_002905
689 Ga0439445_0055334
690 Ga0453684_0228405
691 Ga0466968_0030879
692 Ga0495592_0071715
693 Ga0495629_0215769
694 Ga0495638_0076515
695 Ga0495651_0090469
696 Ga0495650_0000119
697 Ga0495650_0033089
698 Ga0495585_0000173
699 Ga0495585_0001496
700 Ga0495585_0003557
701 Ga0495583_0010045
702 Ga0495606_0000008
703 Ga0495606_0059804
704 Ga0495606_0098214
705 Ga0495606_0127834
706 Ga0495608_0077612
707 Ga0495610_0002038
708 Ga0495616_0036331
709 Ga0495616_0045978
710 Ga0495618_0107221
711 Ga0495628_0226731
712 Ga0495637_0013908
713 Ga0495648_0007737
714 Ga0495648_0036946
715 Ga0495648_0045783
716 Ga0495652_0137921
717 Ga0495609_0009807
718 Ga0495609_0019718
719 Ga0495645_0130217
720 Ga0495633_0000032
721 Ga0495633_0022405
722 Ga0495668_0000667
723 Ga0495611_0121189
724 Ga0495625_0000017
725 Ga0495625_0000535
726 Ga0495625_0000742
727 Ga0495625_0016995
728 Ga0495625_0051952
729 Ga0495625_0105526
730 Ga0495661_0008137
731 Ga0495599_0130649
732 Ga0495658_0005519
733 Ga0495613_0245780
734 Ga0495649_0000121
735 Ga0495600_0148937
736 Ga0495660_0011892
737 Ga0495687_000004
738 Ga0495687_022492
739 Ga0495687_035225
740 Ga0495679_059385
741 Ga0495684_0262574
742 Ga0495686_0001124
743 Ga0495686_0018957
744 Ga0495686_0056501
745 Ga0495614_0004858
746 Ga0495678_025156
747 Ga0501043_0085360
748 Ga0501257_006977
749 Ga0501259_001418
750 Ga0501266_001347
751 nmdc:mga0k408_150266_c1
752 nmdc:mga08y16_245341_c1
753 nmdc:mga08y16_40624_c1
754 Ga0495619_0050991
755 Ga0500614_021324
756 Ga0500614_036053
757 Ga0500618_000040
758 Ga0500618_017425
759 Ga0500618_037639
760 Ga0500642_0052782
761 Ga0500616_0046204
762 Ga0500622_0002434
763 2599476623
764 2599476624
765 2919442724
766 2919442725
767 2928078572
768 2928078573
769 2928151750
770 2928151751
771 2932084364
772 2932084365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

19

267

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rgy-assembly1.cif.gz_B-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.8901 23 287
5vol-assembly2.cif.gz_H bacint_04212 ferulic acid esterase 0.883 22 289
7xrv-assembly1.cif.gz_H bacteroides thetaiotaomicron ferulic acid esterase - s150a (bt_4077-s150a) complex with trans-methylferulate 0.8815 21 293
5vol-assembly2.cif.gz_G bacint_04212 ferulic acid esterase 0.8811 22 289
2uz0-assembly1.cif.gz_D the crystal crystal structure of the esta protein, a virulence factor esta protein from streptococcus pneumonia 0.8809 20 286
ID Description Score Start End Superfamily
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8901 23 287 3.40.50.1820
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8794 23 287 3.40.50.1820
af_O33364_74_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8699 30 287 3.40.50.1820
2uz0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8693 21 286 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8625 24 286 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3M1UVF3-F1-model_v4 Esterase family protein 0.9943 33 292 GO:0016747
AF-I0K3K7-F1-model_v4 Putative esterase 0.9891 33 292 GO:0016747
AF-A0A2N7Q9H4-F1-model_v4 Esterase 0.9879 18 292 GO:0016747
AF-A0A350D5B6-F1-model_v4 Esterase 0.9851 66 292 GO:0016747
AF-A0A251WLH7-F1-model_v4 Esterase 0.9844 32 293 GO:0016747

Map