F440826

General Info

Members Datasets Scaffolds Average Seq Length
424 155 420 209

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0106521|Ga0495585_0106521_606_1313
Length 235
Sequence MGAAFERDRSTDWPRSWYNDITMTKTAISLILGVTLSAALSACDSKTSANDKNFAITITQYFDKKGDMCLDPVTWPVDVYETDLRQQKLYPDGTAGQMAALEAAGLAKGEDMELPGSFVDGKPSGPKVNVRRYTMTDAAKPYLRADAGRQARMCWGRKSLDKVVRWADPAKVGDHEESSVIYTYKLSNVADWARKPQVKEAFPILGRTVDGEHRQKEKLYVKLTPQGWEALGLKD

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
52 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
53 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
68 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
71 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
90 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 5.19
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10150848 3300003322 Bacteria 2118
2 rootL2_10209023 3300003322 Bacteria 2186
3 Ga0055525_1000105 3300003759 Bacteria 134026
4 Ga0065165_1001997 3300005262 Bacteria 19128
5 Ga0070658_10596217 3300005327 Bacteria 957
6 Ga0070661_100140543 3300005344 Bacteria 1819
7 Ga0070659_100042161 3300005366 Bacteria 3568
8 Ga0070663_100338037 3300005455 Bacteria 1216
9 Ga0068853_100317015 3300005539 Bacteria 1445
10 Ga0068855_100008887 3300005563 Bacteria 12145
11 Ga0068855_100393500 3300005563 Bacteria 1520
12 Ga0070664_100446095 3300005564 Bacteria 1187
13 Ga0068852_100181658 3300005616 Bacteria 1978
14 Ga0105240_10245756 3300009093 Bacteria 2072
15 Ga0105245_10257095 3300009098 Bacteria 1698
16 Ga0105243_10012208 3300009148 Bacteria 6494
17 Ga0105241_10010116 3300009174 Bacteria 6926
18 Ga0105242_10002432 3300009176 Bacteria 14627
19 Ga0105242_10058016 3300009176 Bacteria 3172
20 Ga0105238_10711341 3300009551 Bacteria 1017
21 Ga0105239_10762435 3300010375 Bacteria 1108
22 Ga0157373_10300048 3300013100 Bacteria 1140
23 Ga0157369_10200800 3300013105 Bacteria 2093
24 Ga0157374_10264081 3300013296 Bacteria 1696
25 Ga0157372_10681222 3300013307 Bacteria 1197
26 Ga0157372_10689839 3300013307 Bacteria 1189
27 Ga0157372_10820105 3300013307 Bacteria 1080
28 Ga0209563_100007 3300025230 Bacteria 1579402
29 Ga0209677_104863 3300025253 Bacteria 3697
30 Ga0207645_10408107 3300025907 Bacteria 914
31 Ga0207705_10029414 3300025909 Bacteria 3916
32 Ga0207705_10234618 3300025909 Bacteria 1396
33 Ga0207654_10003662 3300025911 Bacteria 7751
34 Ga0207695_10276116 3300025913 Bacteria 1575
35 Ga0207657_10005977 3300025919 Bacteria 12665
36 Ga0207657_10289516 3300025919 Bacteria 1299
37 Ga0207649_10031189 3300025920 Bacteria 3166
38 Ga0207694_10665296 3300025924 Bacteria 878
39 Ga0207690_10258969 3300025932 Bacteria 1347
40 Ga0207706_10060122 3300025933 Bacteria 3347
41 Ga0207706_10152941 3300025933 Bacteria 2029
42 Ga0207706_10165259 3300025933 Bacteria 1945
43 Ga0207686_10001712 3300025934 Bacteria 12219
44 Ga0207686_10057195 3300025934 Bacteria 2455
45 Ga0207709_10432755 3300025935 Bacteria 1013
46 Ga0207704_10509378 3300025938 Bacteria 971
47 Ga0207679_10079299 3300025945 Bacteria 2503
48 Ga0207667_10005692 3300025949 Bacteria 15198
49 Ga0207667_10516858 3300025949 Bacteria 1210
50 Ga0207639_10197107 3300026041 Bacteria 1724
51 Ga0207648_10102354 3300026089 Bacteria 2510
52 Ga0395899_0003773 3300037312 Bacteria 11959
53 Ga0395899_0007688 3300037312 Bacteria 8309
54 Ga0395899_0028204 3300037312 Bacteria 4227
55 Ga0395899_0102182 3300037312 Bacteria 2068
56 Ga0395900_0000261 3300037418 Bacteria 81971
57 Ga0395900_0006364 3300037418 Bacteria 12310
58 Ga0395900_0012205 3300037418 Bacteria 8782
59 Ga0395900_0013824 3300037418 Bacteria 8237
60 Ga0395900_0026683 3300037418 Bacteria 5913
61 Ga0395900_0031626 3300037418 Bacteria 5439
62 Ga0395900_0171374 3300037418 Bacteria 2209
63 Ga0395900_0364182 3300037418 Bacteria 1416
64 Ga0395900_0487878 3300037418 Bacteria 1184
65 Ga0395898_0013893 3300037466 Bacteria 8275
66 Ga0395898_0080731 3300037466 Bacteria 3136
67 Ga0395898_0120262 3300037466 Bacteria 2516
68 Ga0395898_0588176 3300037466 Bacteria 1055
69 Ga0395905_0025263 3300037471 Bacteria 5602
70 Ga0395905_0071582 3300037471 Bacteria 3250
71 Ga0395905_0414569 3300037471 Bacteria 1242
72 Ga0395905_0811489 3300037471 Bacteria 838
73 Ga0395901_0000229 3300038443 Bacteria 70261
74 Ga0395901_0007685 3300038443 Bacteria 10876
75 Ga0395901_0055266 3300038443 Bacteria 4128
76 Ga0395901_0059504 3300038443 Bacteria 3974
77 Ga0395901_0153212 3300038443 Bacteria 2421
78 Ga0395901_0213741 3300038443 Bacteria 2017
79 Ga0439448_0004871 3300042005 Bacteria 3808
80 Ga0439448_0125231 3300042005 Bacteria 883
81 Ga0439449_0005325 3300042007 Bacteria 4928
82 Ga0439450_003205 3300042008 Bacteria 2677
83 Ga0439450_030489 3300042008 Bacteria 1210
84 Ga0439450_040801 3300042008 Bacteria 1077
85 Ga0439455_0043242 3300042012 Bacteria 1159
86 Ga0439455_0071879 3300042012 Bacteria 931
87 Ga0439458_0031039 3300042157 Bacteria 1273
88 Ga0466969_0011203 3300044656 Bacteria 4746
89 Ga0466969_0101489 3300044656 Bacteria 1354
90 Ga0466969_0135536 3300044656 Bacteria 1140
91 Ga0466972_0004758 3300044658 Bacteria 6797
92 Ga0466972_0224363 3300044658 Bacteria 879
93 Ga0466965_0003484 3300044683 Bacteria 6905
94 Ga0466965_0151237 3300044683 Bacteria 1213
95 Ga0466966_0002462 3300044684 Bacteria 12111
96 Ga0466966_0003021 3300044684 Bacteria 11099
97 Ga0466966_0103912 3300044684 Bacteria 1755
98 Ga0466966_0135916 3300044684 Bacteria 1503
99 Ga0466966_0141874 3300044684 Bacteria 1467
100 Ga0466961_0070282 3300044693 Bacteria 2222
101 Ga0466961_0187902 3300044693 Bacteria 1281
102 Ga0466961_0255453 3300044693 Bacteria 1075
103 Ga0466963_0096311 3300044694 Bacteria 2021
104 Ga0466964_0000369 3300044706 Bacteria 13607
105 Ga0466964_0002589 3300044706 Bacteria 6462
106 Ga0466964_0078046 3300044706 Bacteria 1415
107 Ga0466964_0167741 3300044706 Bacteria 1031
108 Ga0466968_0003632 3300044735 Bacteria 5715
109 Ga0466968_0114189 3300044735 Bacteria 1217
110 Ga0466970_0074068 3300044765 Bacteria 1833
111 Ga0466957_0002383 3300044842 Bacteria 10096
112 Ga0466957_0273242 3300044842 Bacteria 1129
113 Ga0466959_0100371 3300045049 Bacteria 2072
114 Ga0466959_0119915 3300045049 Bacteria 1871
115 Ga0466959_0150182 3300045049 Bacteria 1642
116 Ga0466958_0017131 3300045836 Bacteria 4183
117 Ga0466967_0010566 3300045976 Bacteria 6933
118 Ga0466967_0012206 3300045976 Bacteria 6558
119 Ga0466967_0397432 3300045976 Bacteria 1340
120 Ga0495617_000055 3300046452 Bacteria 102065
121 Ga0495627_000123 3300046453 Bacteria 94862
122 Ga0495627_029812 3300046453 Bacteria 1732
123 Ga0495627_140241 3300046453 Bacteria 677
124 Ga0495603_0330079 3300046455 Bacteria 875
125 Ga0495590_0000013 3300046457 Bacteria 271977
126 Ga0495590_0000610 3300046457 Bacteria 16667
127 Ga0495590_0000991 3300046457 Bacteria 12512
128 Ga0495591_000109 3300046458 Bacteria 94877
129 Ga0495591_007355 3300046458 Bacteria 4694
130 Ga0495638_0104645 3300046460 Bacteria 1688
131 Ga0495653_0009727 3300046463 Bacteria 7862
132 Ga0495650_0053335 3300046471 Bacteria 1656
133 Ga0495650_0128162 3300046471 Bacteria 928
134 Ga0495580_0186969 3300046472 Bacteria 1429
135 Ga0495582_0014327 3300046473 Bacteria 4358
136 Ga0495605_0000035 3300046474 Bacteria 208069
137 Ga0495605_0000039 3300046474 Bacteria 196802
138 Ga0495605_0001118 3300046474 Bacteria 17833
139 Ga0495605_0004941 3300046474 Bacteria 7791
140 Ga0495605_0008956 3300046474 Bacteria 5639
141 Ga0495605_0040874 3300046474 Bacteria 2312
142 Ga0495605_0124726 3300046474 Bacteria 1165
143 Ga0495584_0000029 3300046491 Bacteria 105850
144 Ga0495584_0000791 3300046491 Bacteria 20848
145 Ga0495584_0015346 3300046491 Bacteria 3902
146 Ga0495584_0018228 3300046491 Bacteria 3569
147 Ga0495585_0000048 3300046492 Bacteria 120031
148 Ga0495585_0010743 3300046492 Bacteria 5438
149 Ga0495585_0044798 3300046492 Bacteria 2470
150 Ga0495585_0060308 3300046492 Bacteria 2088
151 Ga0495585_0067864 3300046492 Bacteria 1949
152 Ga0495585_0106521 3300046492 Bacteria 1494
153 Ga0495594_0013754 3300046499 Bacteria 4229
154 Ga0495594_0029564 3300046499 Bacteria 2962
155 Ga0495596_0001509 3300046500 Bacteria 13308
156 Ga0495596_0003025 3300046500 Bacteria 8705
157 Ga0495596_0008861 3300046500 Bacteria 4452
158 Ga0495596_0015375 3300046500 Bacteria 3206
159 Ga0495596_0037681 3300046500 Bacteria 1911
160 Ga0495596_0060591 3300046500 Bacteria 1474
161 Ga0495607_0001269 3300046501 Bacteria 22570
162 Ga0495607_0002120 3300046501 Bacteria 16568
163 Ga0495607_0002439 3300046501 Bacteria 15146
164 Ga0495607_0005695 3300046501 Bacteria 8876
165 Ga0495607_0010411 3300046501 Bacteria 6253
166 Ga0495607_0010974 3300046501 Bacteria 6057
167 Ga0495607_0012232 3300046501 Bacteria 5672
168 Ga0495607_0039932 3300046501 Bacteria 2798
169 Ga0495607_0055982 3300046501 Bacteria 2266
170 Ga0495583_0000704 3300046506 Bacteria 43065
171 Ga0495583_0001128 3300046506 Bacteria 29319
172 Ga0495583_0002696 3300046506 Bacteria 14752
173 Ga0495583_0003300 3300046506 Bacteria 12506
174 Ga0495583_0003820 3300046506 Bacteria 11179
175 Ga0495583_0007253 3300046506 Bacteria 7014
176 Ga0495583_0020518 3300046506 Bacteria 3421
177 Ga0495583_0065892 3300046506 Bacteria 1604
178 Ga0495583_0067244 3300046506 Unclassified 1583
179 Ga0495583_0092373 3300046506 Bacteria 1301
180 Ga0495583_0101228 3300046506 Bacteria 1229
181 Ga0495606_0021396 3300046507 Bacteria 4738
182 Ga0495606_0071420 3300046507 Bacteria 2186
183 Ga0495606_0146761 3300046507 Bacteria 1388
184 Ga0495606_0183029 3300046507 Bacteria 1206
185 Ga0495606_0278496 3300046507 Bacteria 915
186 Ga0495610_0004903 3300046512 Bacteria 9722
187 Ga0495616_0000020 3300046513 Bacteria 162840
188 Ga0495616_0009710 3300046513 Bacteria 5608
189 Ga0495616_0010553 3300046513 Bacteria 5341
190 Ga0495616_0019979 3300046513 Bacteria 3650
191 Ga0495616_0029365 3300046513 Bacteria 2904
192 Ga0495616_0203985 3300046513 Bacteria 868
193 Ga0495630_0021785 3300046517 Bacteria 4732
194 Ga0495631_0000090 3300046518 Bacteria 59264
195 Ga0495631_0000737 3300046518 Bacteria 21033
196 Ga0495631_0002524 3300046518 Bacteria 10282
197 Ga0495631_0003870 3300046518 Bacteria 8106
198 Ga0495631_0006672 3300046518 Bacteria 5935
199 Ga0495631_0010281 3300046518 Bacteria 4635
200 Ga0495631_0012735 3300046518 Bacteria 4099
201 Ga0495631_0121572 3300046518 Bacteria 1123
202 Ga0495632_0000156 3300046519 Bacteria 70702
203 Ga0495632_0000176 3300046519 Bacteria 65711
204 Ga0495632_0003557 3300046519 Bacteria 11010
205 Ga0495632_0003692 3300046519 Bacteria 10734
206 Ga0495632_0040051 3300046519 Bacteria 2362
207 Ga0495637_0000008 3300046520 Bacteria 404658
208 Ga0495637_0019479 3300046520 Bacteria 3137
209 Ga0495637_0030265 3300046520 Bacteria 2402
210 Ga0495643_0002233 3300046522 Bacteria 15734
211 Ga0495643_0006462 3300046522 Bacteria 7724
212 Ga0495643_0026821 3300046522 Bacteria 3245
213 Ga0495643_0030031 3300046522 Bacteria 3038
214 Ga0495643_0115370 3300046522 Bacteria 1361
215 Ga0495643_0140915 3300046522 Bacteria 1202
216 Ga0495644_0007278 3300046523 Bacteria 4277
217 Ga0495644_0010652 3300046523 Bacteria 3541
218 Ga0495644_0034378 3300046523 Bacteria 1913
219 Ga0495644_0054943 3300046523 Bacteria 1495
220 Ga0495648_0000527 3300046524 Bacteria 41184
221 Ga0495648_0001907 3300046524 Bacteria 19909
222 Ga0495648_0003027 3300046524 Bacteria 15061
223 Ga0495648_0020225 3300046524 Bacteria 4652
224 Ga0495648_0032435 3300046524 Bacteria 3427
225 Ga0495648_0076630 3300046524 Bacteria 1919
226 Ga0495648_0077472 3300046524 Bacteria 1905
227 Ga0495642_0000005 3300046528 Bacteria 176726
228 Ga0495642_0000063 3300046528 Bacteria 64137
229 Ga0495642_0003999 3300046528 Bacteria 5762
230 Ga0495642_0005090 3300046528 Bacteria 5063
231 Ga0495642_0040318 3300046528 Bacteria 1896
232 Ga0495642_0050939 3300046528 Bacteria 1703
233 Ga0495652_0013059 3300046529 Bacteria 7484
234 Ga0495654_0006697 3300046530 Bacteria 6520
235 Ga0495654_0017473 3300046530 Bacteria 3773
236 Ga0495654_0029918 3300046530 Bacteria 2775
237 Ga0495654_0126066 3300046530 Bacteria 1154
238 Ga0495665_0018397 3300046531 Bacteria 3754
239 Ga0495640_0260739 3300046533 Bacteria 1083
240 Ga0495587_0018064 3300046536 Bacteria 4373
241 Ga0495609_0000510 3300046538 Bacteria 31267
242 Ga0495609_0010671 3300046538 Bacteria 4397
243 Ga0495609_0024659 3300046538 Bacteria 2758
244 Ga0495609_0037183 3300046538 Bacteria 2196
245 Ga0495609_0112172 3300046538 Unclassified 1176
246 Ga0495597_0000642 3300046542 Bacteria 28429
247 Ga0495597_0001659 3300046542 Bacteria 15522
248 Ga0495597_0001694 3300046542 Bacteria 15260
249 Ga0495597_0121560 3300046542 Bacteria 1088
250 Ga0495597_0200550 3300046542 Bacteria 799
251 Ga0495622_0033464 3300046557 Bacteria 2399
252 Ga0495622_0053251 3300046557 Bacteria 1877
253 Ga0495633_0000874 3300046558 Bacteria 26052
254 Ga0495633_0015774 3300046558 Bacteria 3913
255 Ga0495633_0068462 3300046558 Bacteria 1657
256 Ga0495633_0109825 3300046558 Bacteria 1278
257 Ga0495633_0276636 3300046558 Bacteria 764
258 Ga0495667_0179747 3300046559 Bacteria 1358
259 Ga0495656_0116626 3300046615 Bacteria 1255
260 Ga0495668_0000129 3300046616 Bacteria 113044
261 Ga0495668_0000146 3300046616 Bacteria 106276
262 Ga0495668_0001205 3300046616 Bacteria 26279
263 Ga0495668_0015286 3300046616 Bacteria 4486
264 Ga0495668_0064060 3300046616 Bacteria 2024
265 Ga0495668_0199726 3300046616 Bacteria 1095
266 Ga0495634_0005045 3300046642 Bacteria 10194
267 Ga0495611_0001733 3300046648 Bacteria 10560
268 Ga0495611_0003086 3300046648 Bacteria 7397
269 Ga0495611_0010847 3300046648 Bacteria 3858
270 Ga0495611_0033481 3300046648 Bacteria 2267
271 Ga0495625_0012328 3300046660 Bacteria 6932
272 Ga0495625_0036939 3300046660 Bacteria 3586
273 Ga0495625_0060844 3300046660 Bacteria 2674
274 Ga0495625_0560866 3300046660 Bacteria 690
275 Ga0495661_0000292 3300046665 Bacteria 56829
276 Ga0495661_0001196 3300046665 Bacteria 22530
277 Ga0495661_0001409 3300046665 Bacteria 20155
278 Ga0495661_0006645 3300046665 Bacteria 8120
279 Ga0495661_0021285 3300046665 Bacteria 4229
280 Ga0495661_0021961 3300046665 Bacteria 4153
281 Ga0495661_0030741 3300046665 Bacteria 3417
282 Ga0495661_0049149 3300046665 Bacteria 2559
283 Ga0495661_0056104 3300046665 Bacteria 2358
284 Ga0495661_0057287 3300046665 Bacteria 2327
285 Ga0495661_0065898 3300046665 Bacteria 2133
286 Ga0495661_0073537 3300046665 Bacteria 1991
287 Ga0495661_0098288 3300046665 Bacteria 1652
288 Ga0495661_0250282 3300046665 Bacteria 905
289 Ga0495588_0013390 3300046674 Bacteria 3908
290 Ga0495588_0058025 3300046674 Bacteria 2000
291 Ga0495588_0132430 3300046674 Bacteria 1315
292 Ga0495623_0034923 3300046679 Bacteria 3224
293 Ga0495623_0082073 3300046679 Bacteria 1992
294 Ga0495669_0004589 3300046684 Bacteria 5720
295 Ga0495669_0005447 3300046684 Bacteria 5312
296 Ga0495669_0008660 3300046684 Bacteria 4281
297 Ga0495669_0010906 3300046684 Bacteria 3846
298 Ga0495669_0018371 3300046684 Bacteria 3006
299 Ga0495624_0161673 3300046690 Bacteria 1368
300 Ga0495670_0087645 3300046691 Bacteria 1590
301 Ga0495670_0138731 3300046691 Bacteria 1270
302 Ga0495671_0000294 3300046692 Bacteria 41764
303 Ga0495671_0001608 3300046692 Bacteria 14859
304 Ga0495671_0003966 3300046692 Bacteria 8956
305 Ga0495671_0005658 3300046692 Bacteria 7288
306 Ga0495671_0033454 3300046692 Bacteria 2619
307 Ga0495649_0000071 3300046694 Bacteria 89386
308 Ga0495649_0000880 3300046694 Bacteria 24063
309 Ga0495649_0027277 3300046694 Bacteria 3170
310 Ga0495649_0151765 3300046694 Bacteria 1217
311 Ga0495589_0000033 3300046794 Bacteria 162794
312 Ga0495589_0000047 3300046794 Bacteria 117810
313 Ga0495589_0001233 3300046794 Bacteria 15149
314 Ga0495589_0001477 3300046794 Bacteria 13524
315 Ga0495589_0017199 3300046794 Bacteria 3713
316 Ga0495589_0209873 3300046794 Bacteria 917
317 Ga0495600_0092432 3300046809 Bacteria 1973
318 Ga0495660_0000135 3300046810 Bacteria 80391
319 Ga0495660_0008073 3300046810 Bacteria 6183
320 Ga0495660_0012125 3300046810 Bacteria 5001
321 Ga0495660_0013922 3300046810 Bacteria 4662
322 Ga0495660_0027436 3300046810 Bacteria 3221
323 Ga0495660_0051654 3300046810 Bacteria 2236
324 Ga0495660_0055588 3300046810 Bacteria 2142
325 Ga0495660_0097454 3300046810 Bacteria 1518
326 Ga0495636_0016198 3300047318 Bacteria 2975
327 Ga0495672_0000033 3300047320 Bacteria 291992
328 Ga0495672_0000117 3300047320 Bacteria 126637
329 Ga0495672_0001994 3300047320 Bacteria 19290
330 Ga0495672_0004983 3300047320 Bacteria 10650
331 Ga0495676_0000273 3300047321 Bacteria 41772
332 Ga0495683_0000168 3300047323 Bacteria 63828
333 Ga0495683_0021868 3300047323 Bacteria 3294
334 Ga0495683_0027806 3300047323 Bacteria 2892
335 Ga0495687_000002 3300047443 Bacteria 1085770
336 Ga0495687_000017 3300047443 Bacteria 350429
337 Ga0495687_000987 3300047443 Bacteria 28644
338 Ga0495687_001660 3300047443 Bacteria 19980
339 Ga0495687_067214 3300047443 Bacteria 1452
340 Ga0495687_101766 3300047443 Bacteria 1076
341 Ga0495675_0001471 3300047444 Bacteria 14251
342 Ga0495677_0000108 3300047445 Bacteria 41303
343 Ga0495677_0002475 3300047445 Bacteria 7257
344 Ga0495677_0004949 3300047445 Bacteria 5080
345 Ga0495677_0007369 3300047445 Bacteria 4115
346 Ga0495677_0012734 3300047445 Bacteria 3065
347 Ga0495677_0013593 3300047445 Bacteria 2963
348 Ga0495677_0024814 3300047445 Bacteria 2175
349 Ga0495677_0050646 3300047445 Bacteria 1528
350 Ga0495679_000861 3300047446 Bacteria 19187
351 Ga0495679_012366 3300047446 Bacteria 3252
352 Ga0495679_023543 3300047446 Bacteria 2088
353 Ga0495679_026141 3300047446 Bacteria 1942
354 Ga0495679_033472 3300047446 Bacteria 1641
355 Ga0495685_000932 3300047447 Bacteria 8869
356 Ga0495681_0000021 3300047470 Bacteria 166534
357 Ga0495681_0000428 3300047470 Bacteria 32244
358 Ga0495681_0018443 3300047470 Bacteria 3845
359 Ga0495681_0035819 3300047470 Bacteria 2461
360 Ga0495681_0035892 3300047470 Bacteria 2458
361 Ga0495686_0000431 3300047472 Bacteria 65240
362 Ga0495686_0071005 3300047472 Bacteria 2144
363 Ga0495686_0216750 3300047472 Bacteria 1091
364 Ga0495615_0013843 3300048090 Bacteria 1693
365 Ga0495626_0000047 3300048091 Bacteria 161939
366 Ga0495626_0000054 3300048091 Bacteria 154997
367 Ga0495626_0000804 3300048091 Bacteria 28381
368 Ga0495626_0002400 3300048091 Bacteria 13051
369 Ga0495626_0003408 3300048091 Bacteria 10220
370 Ga0495626_0005360 3300048091 Bacteria 7536
371 Ga0495626_0013609 3300048091 Bacteria 4223
372 Ga0495626_0020007 3300048091 Bacteria 3340
373 Ga0495626_0020750 3300048091 Bacteria 3270
374 Ga0495626_0023682 3300048091 Bacteria 3019
375 Ga0495626_0025855 3300048091 Bacteria 2866
376 Ga0495626_0090183 3300048091 Bacteria 1349
377 Ga0495626_0098205 3300048091 Bacteria 1279
378 Ga0496100_0380510 3300048903 Bacteria 1072
379 Ga0496101_0049764 3300048904 Bacteria 3016
380 Ga0496101_0308864 3300048904 Bacteria 1239
381 Ga0496102_0001274 3300048905 Bacteria 22764
382 Ga0496102_0013559 3300048905 Bacteria 7064
383 Ga0496103_0045643 3300048906 Bacteria 2703
384 Ga0496105_0229799 3300048908 Bacteria 1508
385 Ga0496105_0304703 3300048908 Bacteria 1280
386 Ga0496106_0012765 3300048909 Bacteria 6203
387 Ga0496107_0018529 3300048910 Bacteria 4903
388 Ga0496107_0117048 3300048910 Bacteria 1962
389 Ga0496107_0389602 3300048910 Bacteria 1036
390 Ga0496108_0996904 3300048911 Bacteria 716
391 Ga0496109_0006016 3300048912 Bacteria 10192
392 Ga0496109_0105021 3300048912 Bacteria 2623
393 Ga0496109_0399076 3300048912 Bacteria 1299
394 Ga0496111_0407989 3300048914 Bacteria 1004
395 Ga0496111_0463207 3300048914 Bacteria 935
396 Ga0496112_0253614 3300048915 Bacteria 1710
397 Ga0496113_0005850 3300048916 Bacteria 7718
398 Ga0496115_0262535 3300048918 Bacteria 1420
399 Ga0496115_0606094 3300048918 Bacteria 870
400 Ga0496121_0309027 3300048924 Bacteria 1070
401 Ga0496122_0000310 3300048925 Bacteria 107506
402 Ga0496122_0002956 3300048925 Bacteria 23176
403 Ga0496122_0028804 3300048925 Bacteria 4701
404 Ga0496122_0186524 3300048925 Bacteria 1230
405 Ga0496123_0000312 3300048926 Bacteria 93478
406 Ga0496123_0002318 3300048926 Bacteria 23910
407 Ga0496123_0006252 3300048926 Bacteria 11609
408 Ga0496124_0080893 3300048927 Bacteria 2672
409 Ga0496125_0001510 3300048928 Bacteria 33315
410 Ga0496125_0033820 3300048928 Bacteria 4516
411 Ga0496125_0178150 3300048928 Bacteria 1420
412 Ga0495678_000024 3300049459 Bacteria 229034
413 Ga0495678_000035 3300049459 Bacteria 200957
414 Ga0495678_000094 3300049459 Bacteria 111548
415 Ga0495678_001220 3300049459 Bacteria 21076
416 Ga0495678_004980 3300049459 Bacteria 7485
417 Ga0495682_0000295 3300049460 Bacteria 38015
418 Ga0495682_0003650 3300049460 Bacteria 6783
419 Ga0495682_0015135 3300049460 Bacteria 2922
420 Ga0466962_0022881 3300061719 Bacteria 3003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_140241 Ga0495627_140241_96_659 187
2 3300046692 Ga0495671_0003966 Ga0495671_0003966_5883_6494 187
3 3300047443 Ga0495687_001660 Ga0495687_001660_15669_16346 187
4 3300046457 Ga0495590_0000013 Ga0495590_0000013_178111_178737 188
5 3300046471 Ga0495650_0128162 Ga0495650_0128162_120_746 188
6 3300046491 Ga0495584_0000029 Ga0495584_0000029_25118_25744 188
7 3300046518 Ga0495631_0000737 Ga0495631_0000737_12702_13328 188
8 3300046648 Ga0495611_0001733 Ga0495611_0001733_1588_2214 188
9 3300047445 Ga0495677_0004949 Ga0495677_0004949_1821_2447 188
10 3300046542 Ga0495597_0200550 Ga0495597_0200550_18_593 190
11 3300047445 Ga0495677_0024814 Ga0495677_0024814_1588_2163 190
12 3300048091 Ga0495626_0098205 Ga0495626_0098205_193_807 190
13 3300047470 Ga0495681_0035892 Ga0495681_0035892_526_1203 192
14 3300046460 Ga0495638_0104645 Ga0495638_0104645_697_1317 193
15 3300046492 Ga0495585_0060308 Ga0495585_0060308_753_1367 193
16 3300046506 Ga0495583_0001128 Ga0495583_0001128_18198_18818 193
17 3300046513 Ga0495616_0010553 Ga0495616_0010553_1380_2000 193
18 3300046518 Ga0495631_0000090 Ga0495631_0000090_14050_14670 193
19 3300046522 Ga0495643_0026821 Ga0495643_0026821_895_1515 193
20 3300046528 Ga0495642_0040318 Ga0495642_0040318_1009_1623 193
21 3300046530 Ga0495654_0006697 Ga0495654_0006697_4883_5503 193
22 3300046660 Ga0495625_0012328 Ga0495625_0012328_5381_6001 193
23 3300046665 Ga0495661_0021961 Ga0495661_0021961_2423_3043 193
24 3300046665 Ga0495661_0065898 Ga0495661_0065898_296_910 193
25 3300046810 Ga0495660_0027436 Ga0495660_0027436_752_1372 193
26 3300047446 Ga0495679_000861 Ga0495679_000861_13827_14447 193
27 3300047447 Ga0495685_000932 Ga0495685_000932_6970_7590 193
28 3300046616 Ga0495668_0064060 Ga0495668_0064060_1046_1657 196
29 3300042007 Ga0439449_0005325 Ga0439449_0005325_179_865 198
30 3300042008 Ga0439450_030489 Ga0439450_030489_589_1194 198
31 3300044683 Ga0466965_0151237 Ga0466965_0151237_589_1194 198
32 3300045836 Ga0466958_0017131 Ga0466958_0017131_656_1258 198
33 3300046809 Ga0495600_0092432 Ga0495600_0092432_1340_1942 198
34 3300046665 Ga0495661_0000292 Ga0495661_0000292_13270_13881 200
35 3300048904 Ga0496101_0308864 Ga0496101_0308864_476_1087 200
36 3300048912 Ga0496109_0006016 Ga0496109_0006016_4082_4693 200
37 3300048915 Ga0496112_0253614 Ga0496112_0253614_744_1355 200
38 3300048916 Ga0496113_0005850 Ga0496113_0005850_2670_3281 200
39 3300048925 Ga0496122_0000310 Ga0496122_0000310_65146_65757 200
40 3300048926 Ga0496123_0000312 Ga0496123_0000312_27879_28490 200
41 3300048928 Ga0496125_0001510 Ga0496125_0001510_9127_9738 200
42 3300048911 Ga0496108_0996904 Ga0496108_0996904_28_636 201
43 3300046492 Ga0495585_0067864 Ga0495585_0067864_445_1056 202
44 3300046500 Ga0495596_0008861 Ga0495596_0008861_2002_2679 202
45 3300046506 Ga0495583_0003820 Ga0495583_0003820_2894_3565 202
46 3300046506 Ga0495583_0067244 Ga0495583_0067244_392_1069 202
47 3300046558 Ga0495633_0276636 Ga0495633_0276636_100_711 202
48 3300046660 Ga0495625_0060844 Ga0495625_0060844_583_1194 202
49 3300046665 Ga0495661_0049149 Ga0495661_0049149_1356_1967 202
50 3300046665 Ga0495661_0250282 Ga0495661_0250282_126_806 202
51 3300046692 Ga0495671_0033454 Ga0495671_0033454_1520_2131 202
52 3300046810 Ga0495660_0013922 Ga0495660_0013922_1226_1837 202
53 3300048091 Ga0495626_0000054 Ga0495626_0000054_45896_46516 202
54 iso_pu_bacteria 2808606418 2809146580 202
55 3300005262 Ga0065165_1001997 Ga0065165_100199721 203
56 3300046453 Ga0495627_029812 Ga0495627_029812_481_1092 203
57 3300046457 Ga0495590_0000991 Ga0495590_0000991_4583_5296 203
58 3300046458 Ga0495591_000109 Ga0495591_000109_7565_8179 203
59 3300046458 Ga0495591_007355 Ga0495591_007355_2227_2841 203
60 3300046471 Ga0495650_0053335 Ga0495650_0053335_850_1467 203
61 3300046474 Ga0495605_0004941 Ga0495605_0004941_1922_2536 203
62 3300046474 Ga0495605_0008956 Ga0495605_0008956_922_1542 203
63 3300046491 Ga0495584_0000791 Ga0495584_0000791_12244_12858 203
64 3300046492 Ga0495585_0000048 Ga0495585_0000048_99728_100342 203
65 3300046492 Ga0495585_0010743 Ga0495585_0010743_4808_5422 203
66 3300046492 Ga0495585_0044798 Ga0495585_0044798_1230_1844 203
67 3300046499 Ga0495594_0013754 Ga0495594_0013754_2404_3018 203
68 3300046500 Ga0495596_0001509 Ga0495596_0001509_4804_5415 203
69 3300046500 Ga0495596_0003025 Ga0495596_0003025_7971_8585 203
70 3300046500 Ga0495596_0015375 Ga0495596_0015375_1272_1883 203
71 3300046500 Ga0495596_0037681 Ga0495596_0037681_1165_1776 203
72 3300046500 Ga0495596_0060591 Ga0495596_0060591_572_1186 203
73 3300046501 Ga0495607_0002120 Ga0495607_0002120_4808_5422 203
74 3300046501 Ga0495607_0005695 Ga0495607_0005695_6632_7252 203
75 3300046501 Ga0495607_0010411 Ga0495607_0010411_968_1582 203
76 3300046501 Ga0495607_0012232 Ga0495607_0012232_4395_5009 203
77 3300046501 Ga0495607_0055982 Ga0495607_0055982_450_1061 203
78 3300046506 Ga0495583_0002696 Ga0495583_0002696_12210_12821 203
79 3300046506 Ga0495583_0003300 Ga0495583_0003300_11729_12349 203
80 3300046506 Ga0495583_0007253 Ga0495583_0007253_187_798 203
81 3300046506 Ga0495583_0020518 Ga0495583_0020518_1503_2114 203
82 3300046506 Ga0495583_0065892 Ga0495583_0065892_881_1546 203
83 3300046506 Ga0495583_0101228 Ga0495583_0101228_461_1072 203
84 3300046507 Ga0495606_0021396 Ga0495606_0021396_3342_3956 203
85 3300046507 Ga0495606_0183029 Ga0495606_0183029_427_1041 203
86 3300046507 Ga0495606_0278496 Ga0495606_0278496_178_789 203
87 3300046512 Ga0495610_0004903 Ga0495610_0004903_5632_6246 203
88 3300046513 Ga0495616_0009710 Ga0495616_0009710_516_1130 203
89 3300046513 Ga0495616_0019979 Ga0495616_0019979_1409_2020 203
90 3300046513 Ga0495616_0203985 Ga0495616_0203985_101_745 203
91 3300046518 Ga0495631_0006672 Ga0495631_0006672_1734_2348 203
92 3300046518 Ga0495631_0012735 Ga0495631_0012735_1079_1690 203
93 3300046518 Ga0495631_0121572 Ga0495631_0121572_346_957 203
94 3300046519 Ga0495632_0000156 Ga0495632_0000156_22224_22835 203
95 3300046519 Ga0495632_0003692 Ga0495632_0003692_2595_3209 203
96 3300046520 Ga0495637_0000008 Ga0495637_0000008_92862_93476 203
97 3300046520 Ga0495637_0019479 Ga0495637_0019479_1902_2522 203
98 3300046520 Ga0495637_0030265 Ga0495637_0030265_249_863 203
99 3300046522 Ga0495643_0030031 Ga0495643_0030031_725_1339 203
100 3300046523 Ga0495644_0007278 Ga0495644_0007278_2624_3238 203
101 3300046523 Ga0495644_0010652 Ga0495644_0010652_1012_1626 203
102 3300046524 Ga0495648_0001907 Ga0495648_0001907_19092_19712 203
103 3300046524 Ga0495648_0003027 Ga0495648_0003027_6355_6969 203
104 3300046524 Ga0495648_0032435 Ga0495648_0032435_894_1508 203
105 3300046524 Ga0495648_0076630 Ga0495648_0076630_198_818 203
106 3300046528 Ga0495642_0003999 Ga0495642_0003999_391_1005 203
107 3300046528 Ga0495642_0005090 Ga0495642_0005090_3511_4122 203
108 3300046530 Ga0495654_0126066 Ga0495654_0126066_523_1137 203
109 3300046538 Ga0495609_0024659 Ga0495609_0024659_1423_2037 203
110 3300046542 Ga0495597_0001659 Ga0495597_0001659_1947_2561 203
111 3300046542 Ga0495597_0001694 Ga0495597_0001694_9752_10366 203
112 3300046542 Ga0495597_0121560 Ga0495597_0121560_187_873 203
113 3300046558 Ga0495633_0000874 Ga0495633_0000874_19544_20158 203
114 3300046558 Ga0495633_0109825 Ga0495633_0109825_19_630 203
115 3300046616 Ga0495668_0000129 Ga0495668_0000129_47694_48314 203
116 3300046616 Ga0495668_0015286 Ga0495668_0015286_1804_2415 203
117 3300046648 Ga0495611_0003086 Ga0495611_0003086_4249_4863 203
118 3300046665 Ga0495661_0030741 Ga0495661_0030741_770_1384 203
119 3300046665 Ga0495661_0057287 Ga0495661_0057287_1357_1968 203
120 3300046665 Ga0495661_0098288 Ga0495661_0098288_43_663 203
121 3300046684 Ga0495669_0005447 Ga0495669_0005447_1092_1706 203
122 3300046684 Ga0495669_0008660 Ga0495669_0008660_1353_1967 203
123 3300046684 Ga0495669_0018371 Ga0495669_0018371_1148_1759 203
124 3300046691 Ga0495670_0138731 Ga0495670_0138731_215_829 203
125 3300046692 Ga0495671_0001608 Ga0495671_0001608_6376_6990 203
126 3300046692 Ga0495671_0005658 Ga0495671_0005658_4157_4768 203
127 3300046694 Ga0495649_0000071 Ga0495649_0000071_48795_49415 203
128 3300046694 Ga0495649_0027277 Ga0495649_0027277_718_1329 203
129 3300046694 Ga0495649_0151765 Ga0495649_0151765_548_1162 203
130 3300046794 Ga0495589_0000033 Ga0495589_0000033_63499_64113 203
131 3300046794 Ga0495589_0001477 Ga0495589_0001477_8430_9050 203
132 3300046794 Ga0495589_0017199 Ga0495589_0017199_2774_3388 203
133 3300046794 Ga0495589_0209873 Ga0495589_0209873_221_832 203
134 3300046810 Ga0495660_0051654 Ga0495660_0051654_1128_1739 203
135 3300046810 Ga0495660_0055588 Ga0495660_0055588_260_874 203
136 3300046810 Ga0495660_0097454 Ga0495660_0097454_730_1344 203
137 3300047318 Ga0495636_0016198 Ga0495636_0016198_18_632 203
138 3300047320 Ga0495672_0000033 Ga0495672_0000033_174608_175222 203
139 3300047320 Ga0495672_0004983 Ga0495672_0004983_2348_2962 203
140 3300047323 Ga0495683_0000168 Ga0495683_0000168_40147_40761 203
141 3300047323 Ga0495683_0027806 Ga0495683_0027806_1720_2334 203
142 3300047443 Ga0495687_000017 Ga0495687_000017_295220_295834 203
143 3300047443 Ga0495687_067214 Ga0495687_067214_594_1208 203
144 3300047445 Ga0495677_0012734 Ga0495677_0012734_1266_1880 203
145 3300047445 Ga0495677_0050646 Ga0495677_0050646_398_1009 203
146 3300047446 Ga0495679_023543 Ga0495679_023543_1172_1786 203
147 3300047446 Ga0495679_026141 Ga0495679_026141_542_1156 203
148 3300047446 Ga0495679_033472 Ga0495679_033472_46_666 203
149 3300047470 Ga0495681_0000021 Ga0495681_0000021_112226_112852 203
150 3300047470 Ga0495681_0000428 Ga0495681_0000428_19288_19899 203
151 3300047472 Ga0495686_0000431 Ga0495686_0000431_6622_7236 203
152 3300047472 Ga0495686_0071005 Ga0495686_0071005_705_1325 203
153 3300048091 Ga0495626_0000804 Ga0495626_0000804_839_1453 203
154 3300048091 Ga0495626_0003408 Ga0495626_0003408_7140_7754 203
155 3300048091 Ga0495626_0020750 Ga0495626_0020750_1163_1774 203
156 3300048091 Ga0495626_0023682 Ga0495626_0023682_1390_2001 203
157 3300048091 Ga0495626_0025855 Ga0495626_0025855_682_1296 203
158 3300048906 Ga0496103_0045643 Ga0496103_0045643_1194_1811 203
159 3300048912 Ga0496109_0105021 Ga0496109_0105021_1670_2287 203
160 3300048918 Ga0496115_0262535 Ga0496115_0262535_152_769 203
161 3300048927 Ga0496124_0080893 Ga0496124_0080893_535_1149 203
162 3300049459 Ga0495678_000024 Ga0495678_000024_116593_117213 203
163 3300049459 Ga0495678_000035 Ga0495678_000035_111326_111946 203
164 3300049459 Ga0495678_000094 Ga0495678_000094_17252_17863 203
165 3300049459 Ga0495678_001220 Ga0495678_001220_14998_15609 203
166 3300049460 Ga0495682_0000295 Ga0495682_0000295_23783_24394 203
167 3300049460 Ga0495682_0003650 Ga0495682_0003650_3987_4601 203
168 3300049460 Ga0495682_0015135 Ga0495682_0015135_1564_2178 203
169 3300037418 Ga0395900_0171374 Ga0395900_0171374_242_862 204
170 3300037471 Ga0395905_0071582 Ga0395905_0071582_1151_1771 204
171 3300046665 Ga0495661_0021285 Ga0495661_0021285_2588_3232 204
172 3300048910 Ga0496107_0389602 Ga0496107_0389602_346_999 204
173 3300046452 Ga0495617_000055 Ga0495617_000055_2321_2950 207
174 3300046453 Ga0495627_000123 Ga0495627_000123_91637_92266 207
175 3300046474 Ga0495605_0000035 Ga0495605_0000035_103791_104420 207
176 3300046501 Ga0495607_0010974 Ga0495607_0010974_3158_3787 207
177 3300046513 Ga0495616_0029365 Ga0495616_0029365_307_936 207
178 3300046518 Ga0495631_0010281 Ga0495631_0010281_847_1476 207
179 3300046523 Ga0495644_0054943 Ga0495644_0054943_752_1381 207
180 3300046524 Ga0495648_0000527 Ga0495648_0000527_38235_38864 207
181 3300046528 Ga0495642_0000005 Ga0495642_0000005_65938_66567 207
182 3300046530 Ga0495654_0017473 Ga0495654_0017473_2596_3225 207
183 3300046538 Ga0495609_0112172 Ga0495609_0112172_130_759 207
184 3300046558 Ga0495633_0068462 Ga0495633_0068462_592_1221 207
185 3300046615 Ga0495656_0116626 Ga0495656_0116626_141_770 207
186 3300046616 Ga0495668_0001205 Ga0495668_0001205_2310_2939 207
187 3300046648 Ga0495611_0033481 Ga0495611_0033481_322_951 207
188 3300046665 Ga0495661_0006645 Ga0495661_0006645_4332_4961 207
189 3300046684 Ga0495669_0004589 Ga0495669_0004589_4422_5051 207
190 3300046692 Ga0495671_0000294 Ga0495671_0000294_38353_38982 207
191 3300046794 Ga0495589_0001233 Ga0495589_0001233_1080_1709 207
192 3300047445 Ga0495677_0002475 Ga0495677_0002475_4328_4957 207
193 3300047470 Ga0495681_0035819 Ga0495681_0035819_677_1306 207
194 3300048905 Ga0496102_0001274 Ga0496102_0001274_2709_3338 207
195 3300048918 Ga0496115_0606094 Ga0496115_0606094_34_663 207
196 3300048924 Ga0496121_0309027 Ga0496121_0309027_11_640 207
197 iso_pu_bacteria 2643221556 2643797001 207
198 iso_pu_bacteria 2643221684 2644469895 207
199 iso_pu_bacteria 8047673197 8047676734 207
200 3300046538 Ga0495609_0000510 Ga0495609_0000510_4540_5175 209
201 3300046542 Ga0495597_0000642 Ga0495597_0000642_23320_23955 209
202 3300048914 Ga0496111_0463207 Ga0496111_0463207_136_771 209
203 3300003322 rootL2_10150848 rootL2_101508482 211
204 3300003322 rootL2_10209023 rootL2_102090234 211
205 3300003759 Ga0055525_1000105 Ga0055525_100010588 211
206 3300005327 Ga0070658_10596217 Ga0070658_105962171 211
207 3300005344 Ga0070661_100140543 Ga0070661_1001405432 211
208 3300005366 Ga0070659_100042161 Ga0070659_1000421612 211
209 3300005455 Ga0070663_100338037 Ga0070663_1003380372 211
210 3300005539 Ga0068853_100317015 Ga0068853_1003170152 211
211 3300005563 Ga0068855_100008887 Ga0068855_1000088877 211
212 3300005563 Ga0068855_100393500 Ga0068855_1003935002 211
213 3300005564 Ga0070664_100446095 Ga0070664_1004460951 211
214 3300005616 Ga0068852_100181658 Ga0068852_1001816582 211
215 3300009093 Ga0105240_10245756 Ga0105240_102457562 211
216 3300009098 Ga0105245_10257095 Ga0105245_102570953 211
217 3300009148 Ga0105243_10012208 Ga0105243_100122081 211
218 3300009174 Ga0105241_10010116 Ga0105241_100101162 211
219 3300009176 Ga0105242_10002432 Ga0105242_100024324 211
220 3300009176 Ga0105242_10058016 Ga0105242_100580162 211
221 3300009551 Ga0105238_10711341 Ga0105238_107113412 211
222 3300010375 Ga0105239_10762435 Ga0105239_107624351 211
223 3300013100 Ga0157373_10300048 Ga0157373_103000481 211
224 3300013105 Ga0157369_10200800 Ga0157369_102008003 211
225 3300013296 Ga0157374_10264081 Ga0157374_102640814 211
226 3300013307 Ga0157372_10681222 Ga0157372_106812222 211
227 3300013307 Ga0157372_10689839 Ga0157372_106898392 211
228 3300013307 Ga0157372_10820105 Ga0157372_108201052 211
229 3300025230 Ga0209563_100007 Ga0209563_1000071289 211
230 3300025253 Ga0209677_104863 Ga0209677_1048632 211
231 3300025907 Ga0207645_10408107 Ga0207645_104081072 211
232 3300025909 Ga0207705_10029414 Ga0207705_100294143 211
233 3300025909 Ga0207705_10234618 Ga0207705_102346182 211
234 3300025911 Ga0207654_10003662 Ga0207654_100036627 211
235 3300025913 Ga0207695_10276116 Ga0207695_102761162 211
236 3300025919 Ga0207657_10005977 Ga0207657_100059777 211
237 3300025919 Ga0207657_10289516 Ga0207657_102895163 211
238 3300025920 Ga0207649_10031189 Ga0207649_100311893 211
239 3300025924 Ga0207694_10665296 Ga0207694_106652962 211
240 3300025932 Ga0207690_10258969 Ga0207690_102589692 211
241 3300025933 Ga0207706_10060122 Ga0207706_100601225 211
242 3300025933 Ga0207706_10152941 Ga0207706_101529412 211
243 3300025933 Ga0207706_10165259 Ga0207706_101652592 211
244 3300025934 Ga0207686_10001712 Ga0207686_100017123 211
245 3300025934 Ga0207686_10057195 Ga0207686_100571953 211
246 3300025935 Ga0207709_10432755 Ga0207709_104327551 211
247 3300025938 Ga0207704_10509378 Ga0207704_105093781 211
248 3300025945 Ga0207679_10079299 Ga0207679_100792992 211
249 3300025949 Ga0207667_10005692 Ga0207667_100056923 211
250 3300025949 Ga0207667_10516858 Ga0207667_105168582 211
251 3300026041 Ga0207639_10197107 Ga0207639_101971072 211
252 3300026089 Ga0207648_10102354 Ga0207648_101023543 211
253 3300037312 Ga0395899_0003773 Ga0395899_0003773_7341_7976 211
254 3300037312 Ga0395899_0007688 Ga0395899_0007688_6050_6691 211
255 3300037312 Ga0395899_0028204 Ga0395899_0028204_139_780 211
256 3300037312 Ga0395899_0102182 Ga0395899_0102182_322_963 211
257 3300037418 Ga0395900_0000261 Ga0395900_0000261_10756_11391 211
258 3300037418 Ga0395900_0006364 Ga0395900_0006364_4717_5358 211
259 3300037418 Ga0395900_0012205 Ga0395900_0012205_2797_3438 211
260 3300037418 Ga0395900_0013824 Ga0395900_0013824_7318_7959 211
261 3300037418 Ga0395900_0026683 Ga0395900_0026683_2792_3433 211
262 3300037418 Ga0395900_0031626 Ga0395900_0031626_4659_5300 211
263 3300037418 Ga0395900_0364182 Ga0395900_0364182_476_1117 211
264 3300037418 Ga0395900_0487878 Ga0395900_0487878_381_1022 211
265 3300037466 Ga0395898_0013893 Ga0395898_0013893_3070_3711 211
266 3300037466 Ga0395898_0080731 Ga0395898_0080731_238_879 211
267 3300037466 Ga0395898_0120262 Ga0395898_0120262_1753_2388 211
268 3300037466 Ga0395898_0588176 Ga0395898_0588176_244_885 211
269 3300037471 Ga0395905_0025263 Ga0395905_0025263_2823_3464 211
270 3300037471 Ga0395905_0414569 Ga0395905_0414569_156_797 211
271 3300037471 Ga0395905_0811489 Ga0395905_0811489_15_656 211
272 3300038443 Ga0395901_0000229 Ga0395901_0000229_1400_2041 211
273 3300038443 Ga0395901_0007685 Ga0395901_0007685_6941_7582 211
274 3300038443 Ga0395901_0055266 Ga0395901_0055266_1398_2039 211
275 3300038443 Ga0395901_0059504 Ga0395901_0059504_930_1571 211
276 3300038443 Ga0395901_0153212 Ga0395901_0153212_1293_1934 211
277 3300038443 Ga0395901_0213741 Ga0395901_0213741_576_1217 211
278 3300042005 Ga0439448_0004871 Ga0439448_0004871_2642_3283 211
279 3300042005 Ga0439448_0125231 Ga0439448_0125231_167_802 211
280 3300042008 Ga0439450_003205 Ga0439450_003205_586_1221 211
281 3300042008 Ga0439450_040801 Ga0439450_040801_132_773 211
282 3300042012 Ga0439455_0043242 Ga0439455_0043242_367_1008 211
283 3300042012 Ga0439455_0071879 Ga0439455_0071879_209_844 211
284 3300042157 Ga0439458_0031039 Ga0439458_0031039_204_839 211
285 3300044656 Ga0466969_0011203 Ga0466969_0011203_2541_3182 211
286 3300044656 Ga0466969_0101489 Ga0466969_0101489_457_1101 211
287 3300044656 Ga0466969_0135536 Ga0466969_0135536_409_1122 211
288 3300044658 Ga0466972_0004758 Ga0466972_0004758_2673_3314 211
289 3300044658 Ga0466972_0224363 Ga0466972_0224363_78_719 211
290 3300044683 Ga0466965_0003484 Ga0466965_0003484_4305_4949 211
291 3300044684 Ga0466966_0002462 Ga0466966_0002462_10079_10720 211
292 3300044684 Ga0466966_0003021 Ga0466966_0003021_2476_3120 211
293 3300044684 Ga0466966_0103912 Ga0466966_0103912_193_882 211
294 3300044684 Ga0466966_0135916 Ga0466966_0135916_178_813 211
295 3300044684 Ga0466966_0141874 Ga0466966_0141874_513_1154 211
296 3300044693 Ga0466961_0070282 Ga0466961_0070282_1046_1687 211
297 3300044693 Ga0466961_0187902 Ga0466961_0187902_244_879 211
298 3300044693 Ga0466961_0255453 Ga0466961_0255453_94_807 211
299 3300044694 Ga0466963_0096311 Ga0466963_0096311_1265_1906 211
300 3300044706 Ga0466964_0000369 Ga0466964_0000369_6762_7403 211
301 3300044706 Ga0466964_0002589 Ga0466964_0002589_1657_2298 211
302 3300044706 Ga0466964_0078046 Ga0466964_0078046_461_1174 211
303 3300044706 Ga0466964_0167741 Ga0466964_0167741_302_946 211
304 3300044735 Ga0466968_0003632 Ga0466968_0003632_901_1542 211
305 3300044735 Ga0466968_0114189 Ga0466968_0114189_328_963 211
306 3300044765 Ga0466970_0074068 Ga0466970_0074068_764_1408 211
307 3300044842 Ga0466957_0002383 Ga0466957_0002383_7848_8492 211
308 3300044842 Ga0466957_0273242 Ga0466957_0273242_227_862 211
309 3300045049 Ga0466959_0100371 Ga0466959_0100371_582_1217 211
310 3300045049 Ga0466959_0119915 Ga0466959_0119915_388_1029 211
311 3300045049 Ga0466959_0150182 Ga0466959_0150182_12_653 211
312 3300045976 Ga0466967_0010566 Ga0466967_0010566_4603_5244 211
313 3300045976 Ga0466967_0012206 Ga0466967_0012206_115_756 211
314 3300045976 Ga0466967_0397432 Ga0466967_0397432_188_823 211
315 3300046455 Ga0495603_0330079 Ga0495603_0330079_185_832 211
316 3300046457 Ga0495590_0000610 Ga0495590_0000610_10915_11553 211
317 3300046463 Ga0495653_0009727 Ga0495653_0009727_3434_4075 211
318 3300046472 Ga0495580_0186969 Ga0495580_0186969_777_1418 211
319 3300046473 Ga0495582_0014327 Ga0495582_0014327_955_1596 211
320 3300046474 Ga0495605_0000039 Ga0495605_0000039_88514_89149 211
321 3300046474 Ga0495605_0001118 Ga0495605_0001118_15974_16615 211
322 3300046474 Ga0495605_0040874 Ga0495605_0040874_912_1553 211
323 3300046474 Ga0495605_0124726 Ga0495605_0124726_375_1016 211
324 3300046491 Ga0495584_0015346 Ga0495584_0015346_165_806 211
325 3300046491 Ga0495584_0018228 Ga0495584_0018228_523_1164 211
326 3300046492 Ga0495585_0106521 Ga0495585_0106521_606_1313 211
327 3300046499 Ga0495594_0029564 Ga0495594_0029564_2255_2902 211
328 3300046501 Ga0495607_0001269 Ga0495607_0001269_17188_17823 211
329 3300046501 Ga0495607_0002439 Ga0495607_0002439_9780_10415 211
330 3300046501 Ga0495607_0039932 Ga0495607_0039932_621_1262 211
331 3300046506 Ga0495583_0000704 Ga0495583_0000704_9054_9695 211
332 3300046506 Ga0495583_0092373 Ga0495583_0092373_43_684 211
333 3300046507 Ga0495606_0071420 Ga0495606_0071420_1202_1840 211
334 3300046507 Ga0495606_0146761 Ga0495606_0146761_572_1207 211
335 3300046513 Ga0495616_0000020 Ga0495616_0000020_88224_88871 211
336 3300046517 Ga0495630_0021785 Ga0495630_0021785_4003_4644 211
337 3300046518 Ga0495631_0002524 Ga0495631_0002524_1090_1737 211
338 3300046518 Ga0495631_0003870 Ga0495631_0003870_2123_2764 211
339 3300046519 Ga0495632_0000176 Ga0495632_0000176_54770_55417 211
340 3300046519 Ga0495632_0003557 Ga0495632_0003557_8050_8691 211
341 3300046519 Ga0495632_0040051 Ga0495632_0040051_929_1570 211
342 3300046522 Ga0495643_0002233 Ga0495643_0002233_9787_10422 211
343 3300046522 Ga0495643_0006462 Ga0495643_0006462_1320_1961 211
344 3300046522 Ga0495643_0115370 Ga0495643_0115370_250_885 211
345 3300046522 Ga0495643_0140915 Ga0495643_0140915_81_722 211
346 3300046523 Ga0495644_0034378 Ga0495644_0034378_22_663 211
347 3300046524 Ga0495648_0020225 Ga0495648_0020225_2168_2815 211
348 3300046524 Ga0495648_0077472 Ga0495648_0077472_113_754 211
349 3300046528 Ga0495642_0000063 Ga0495642_0000063_60908_61555 211
350 3300046528 Ga0495642_0050939 Ga0495642_0050939_608_1249 211
351 3300046529 Ga0495652_0013059 Ga0495652_0013059_97_738 211
352 3300046530 Ga0495654_0029918 Ga0495654_0029918_1007_1654 211
353 3300046531 Ga0495665_0018397 Ga0495665_0018397_228_869 211
354 3300046533 Ga0495640_0260739 Ga0495640_0260739_118_756 211
355 3300046536 Ga0495587_0018064 Ga0495587_0018064_2235_2873 211
356 3300046538 Ga0495609_0010671 Ga0495609_0010671_657_1298 211
357 3300046538 Ga0495609_0037183 Ga0495609_0037183_368_1015 211
358 3300046557 Ga0495622_0033464 Ga0495622_0033464_336_977 211
359 3300046557 Ga0495622_0053251 Ga0495622_0053251_1086_1727 211
360 3300046558 Ga0495633_0015774 Ga0495633_0015774_3215_3856 211
361 3300046559 Ga0495667_0179747 Ga0495667_0179747_338_979 211
362 3300046616 Ga0495668_0000146 Ga0495668_0000146_38878_39519 211
363 3300046616 Ga0495668_0199726 Ga0495668_0199726_50_697 211
364 3300046642 Ga0495634_0005045 Ga0495634_0005045_2658_3299 211
365 3300046648 Ga0495611_0010847 Ga0495611_0010847_2284_2925 211
366 3300046660 Ga0495625_0036939 Ga0495625_0036939_562_1203 211
367 3300046660 Ga0495625_0560866 Ga0495625_0560866_29_670 211
368 3300046665 Ga0495661_0001196 Ga0495661_0001196_16250_16885 211
369 3300046665 Ga0495661_0001409 Ga0495661_0001409_14781_15416 211
370 3300046665 Ga0495661_0056104 Ga0495661_0056104_522_1157 211
371 3300046665 Ga0495661_0073537 Ga0495661_0073537_732_1373 211
372 3300046674 Ga0495588_0013390 Ga0495588_0013390_937_1578 211
373 3300046674 Ga0495588_0058025 Ga0495588_0058025_173_820 211
374 3300046674 Ga0495588_0132430 Ga0495588_0132430_325_966 211
375 3300046679 Ga0495623_0034923 Ga0495623_0034923_1763_2422 211
376 3300046679 Ga0495623_0082073 Ga0495623_0082073_162_803 211
377 3300046684 Ga0495669_0010906 Ga0495669_0010906_2890_3537 211
378 3300046690 Ga0495624_0161673 Ga0495624_0161673_350_991 211
379 3300046691 Ga0495670_0087645 Ga0495670_0087645_609_1256 211
380 3300046694 Ga0495649_0000880 Ga0495649_0000880_6749_7390 211
381 3300046794 Ga0495589_0000047 Ga0495589_0000047_15177_15812 211
382 3300046810 Ga0495660_0000135 Ga0495660_0000135_52346_52981 211
383 3300046810 Ga0495660_0008073 Ga0495660_0008073_385_1020 211
384 3300046810 Ga0495660_0012125 Ga0495660_0012125_2101_2742 211
385 3300047320 Ga0495672_0000117 Ga0495672_0000117_60667_61308 211
386 3300047320 Ga0495672_0001994 Ga0495672_0001994_16148_16783 211
387 3300047321 Ga0495676_0000273 Ga0495676_0000273_31783_32424 211
388 3300047323 Ga0495683_0021868 Ga0495683_0021868_1819_2460 211
389 3300047443 Ga0495687_000002 Ga0495687_000002_140510_141151 211
390 3300047443 Ga0495687_000987 Ga0495687_000987_9823_10458 211
391 3300047443 Ga0495687_101766 Ga0495687_101766_285_920 211
392 3300047444 Ga0495675_0001471 Ga0495675_0001471_2814_3455 211
393 3300047445 Ga0495677_0000108 Ga0495677_0000108_18096_18737 211
394 3300047445 Ga0495677_0007369 Ga0495677_0007369_3308_3943 211
395 3300047445 Ga0495677_0013593 Ga0495677_0013593_1670_2311 211
396 3300047446 Ga0495679_012366 Ga0495679_012366_1075_1716 211
397 3300047470 Ga0495681_0018443 Ga0495681_0018443_2397_3038 211
398 3300047472 Ga0495686_0216750 Ga0495686_0216750_312_947 211
399 3300048090 Ga0495615_0013843 Ga0495615_0013843_167_802 211
400 3300048091 Ga0495626_0000047 Ga0495626_0000047_26883_27518 211
401 3300048091 Ga0495626_0002400 Ga0495626_0002400_6384_7025 211
402 3300048091 Ga0495626_0005360 Ga0495626_0005360_3767_4408 211
403 3300048091 Ga0495626_0013609 Ga0495626_0013609_2406_3047 211
404 3300048091 Ga0495626_0020007 Ga0495626_0020007_651_1292 211
405 3300048091 Ga0495626_0090183 Ga0495626_0090183_150_788 211
406 3300048903 Ga0496100_0380510 Ga0496100_0380510_351_992 211
407 3300048904 Ga0496101_0049764 Ga0496101_0049764_1696_2337 211
408 3300048905 Ga0496102_0013559 Ga0496102_0013559_3330_3965 211
409 3300048908 Ga0496105_0229799 Ga0496105_0229799_223_858 211
410 3300048908 Ga0496105_0304703 Ga0496105_0304703_546_1187 211
411 3300048909 Ga0496106_0012765 Ga0496106_0012765_199_873 211
412 3300048910 Ga0496107_0018529 Ga0496107_0018529_2309_2944 211
413 3300048910 Ga0496107_0117048 Ga0496107_0117048_1189_1863 211
414 3300048912 Ga0496109_0399076 Ga0496109_0399076_517_1158 211
415 3300048914 Ga0496111_0407989 Ga0496111_0407989_293_934 211
416 3300048925 Ga0496122_0002956 Ga0496122_0002956_11936_12571 211
417 3300048925 Ga0496122_0028804 Ga0496122_0028804_2577_3212 211
418 3300048925 Ga0496122_0186524 Ga0496122_0186524_415_1050 211
419 3300048926 Ga0496123_0002318 Ga0496123_0002318_20865_21500 211
420 3300048926 Ga0496123_0006252 Ga0496123_0006252_4343_4978 211
421 3300048928 Ga0496125_0033820 Ga0496125_0033820_1255_1890 211
422 3300048928 Ga0496125_0178150 Ga0496125_0178150_464_1099 211
423 3300049459 Ga0495678_004980 Ga0495678_004980_43_684 211
424 3300061719 Ga0466962_0022881 Ga0466962_0022881_258_899 211

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zsg-assembly1.cif.gz_1 structure of orange carotenoid protein with canthaxanthin bound after 1 minute of illumination 0.6287 134 209
1gy5-assembly1.cif.gz_A d92n,d94n double point mutant of human nuclear transport factor 2 (ntf2) 0.5751 133 209
1jb2-assembly1.cif.gz_B crystal structure of ntf2 m84e mutant 0.5575 131 209
1gy6-assembly1.cif.gz_B ntf2 from rat, ammonium sulphate conditions 0.5549 131 208
1ar0-assembly1.cif.gz_B nuclear transport factor 2 (ntf2) e42k mutant 0.5547 131 209
ID Description Score Start End Superfamily
af_A0A1P8AST1_104_184_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7478 77 117 1.10.10.10
af_Q9VGG4_489_641_3.10.450.40 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7064 131 164 3.10.450.40
af_A0A1D6H6A3_1_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6923 131 159 2.40.50.140
af_A0A1D6Q631_9_101_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6893 132 159 2.40.50.140
af_Q9N5H2_1_131_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6447 134 209 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7X3G1G5-F1-model_v4 Lipoprotein 0.8704 10 211
AF-A0A7X3G1G5-F1-model_v4 Lipoprotein 0.8624 10 211
AF-Q7WC34-F1-model_v4 Uncharacterized protein 0.8091 75 207
AF-A0A5C7PCA2-F1-model_v4 Uncharacterized protein 0.8075 46 210
AF-A0A2W5DWW9-F1-model_v4 Cytochrome c domain-containing protein 0.7873 29 207 GO:0004130
GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
82.55 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map