F440901

General Info

Members Datasets Scaffolds Average Seq Length
425 249 850 238

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10108315|Ga0065707_101083151
Length 260
Sequence MLTFAGFRSAKRFIHIWEKSMTRVAIVTGGTRGIGEAISLALRKMDMTVVANYAGNADKANAFTERTGIKSVKWDVSDPEACQAGVEQVEAEFGPVDVLINNAGITRDGTLMRMTYQDWKEVIDTNLGGCFNMAKATFPGMRARGWGRIVNIGSVNGQAGQYGQVNYAAAKSGIHGFTKALAQEGAKAGVTVNAIAPGYIDTEMVAGVPADVLTKIVAKVPIGRLGEVGEIARAVVFLCAEDAGFVTGSTMSLNGGQHMY

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
206 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
219 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
223 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
239 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
240 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
241 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
242 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
243 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
244 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
245 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
246 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
247 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
248 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
249 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.35
Metatranscriptomes 2.59
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.47
Rhizoplane 1.88
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10108315 3300005295 Bacteria 2515
2 JGI24736J21556_1013414 3300001904 Bacteria 1323
3 JGI24752J21851_1001110 3300001976 Bacteria 3688
4 JGI24739J22299_10000394 3300001989 Bacteria 15147
5 JGI24737J22298_10018343 3300001990 Bacteria 2246
6 JGI24735J21928_10012035 3300002067 Bacteria 2737
7 JGI24735J21928_10039199 3300002067 Bacteria 1385
8 JGI24738J21930_10000528 3300002075 Bacteria 10921
9 JGI24751J29686_10000135 3300002459 Bacteria 37169
10 JGI25151J46595_10000624 3300003187 Bacteria 30772
11 JGI25160J50197_1015010 3300003354 Bacteria 2562
12 Ga0065704_10075983 3300005289 Bacteria 5318
13 Ga0065704_10083410 3300005289 Bacteria 3470
14 Ga0065707_10081960 3300005295 Bacteria 27438
15 Ga0065707_10085937 3300005295 Bacteria 5780
16 Ga0070658_10000040 3300005327 Bacteria 136073
17 Ga0070658_10005671 3300005327 Bacteria 10120
18 Ga0070658_10205693 3300005327 Bacteria 1662
19 Ga0070670_100000090 3300005331 Bacteria 86222
20 Ga0070670_100000965 3300005331 Bacteria 22582
21 Ga0070670_100049568 3300005331 Bacteria 3610
22 Ga0068869_100000568 3300005334 Bacteria 20681
23 Ga0070680_100543403 3300005336 Bacteria 996
24 Ga0068868_100000133 3300005338 Bacteria 47802
25 Ga0068868_100043658 3300005338 Bacteria 3502
26 Ga0068868_100124338 3300005338 Bacteria 2106
27 Ga0070660_100003719 3300005339 Bacteria 10539
28 Ga0070660_100514408 3300005339 Bacteria 996
29 Ga0070689_100568115 3300005340 Bacteria 979
30 Ga0070661_100084031 3300005344 Bacteria 2352
31 Ga0070661_100599177 3300005344 Bacteria 891
32 Ga0070692_10016423 3300005345 Bacteria 3520
33 Ga0070668_100000132 3300005347 Bacteria 46719
34 Ga0070668_100001305 3300005347 Bacteria 17832
35 Ga0070668_100002711 3300005347 Bacteria 13030
36 Ga0070668_100016881 3300005347 Bacteria 5460
37 Ga0070669_100000093 3300005353 Bacteria 87563
38 Ga0070669_100001282 3300005353 Bacteria 18155
39 Ga0070671_100001115 3300005355 Bacteria 19917
40 Ga0070671_100004606 3300005355 Bacteria 10934
41 Ga0070671_100191523 3300005355 Bacteria 1733
42 Ga0070673_100000015 3300005364 Bacteria 118064
43 Ga0070673_100042584 3300005364 Bacteria 3502
44 Ga0070659_100003241 3300005366 Bacteria 11581
45 Ga0070667_100000003 3300005367 Bacteria 447715
46 Ga0070667_100002068 3300005367 Bacteria 17765
47 Ga0070667_100004333 3300005367 Bacteria 11971
48 Ga0070662_100006260 3300005457 Bacteria 7666
49 Ga0070681_10377301 3300005458 Bacteria 1329
50 Ga0068867_100000030 3300005459 Bacteria 86560
51 Ga0068867_100044583 3300005459 Bacteria 3250
52 Ga0070685_10542377 3300005466 Bacteria 829
53 Ga0070698_100285428 3300005471 Bacteria 1582
54 Ga0070679_100066157 3300005530 Bacteria 3602
55 Ga0070679_100132326 3300005530 Bacteria 2475
56 Ga0070679_100171015 3300005530 Bacteria 2146
57 Ga0068853_100034401 3300005539 Bacteria 4301
58 Ga0070665_100000079 3300005548 Bacteria 186925
59 Ga0070665_100000685 3300005548 Bacteria 45385
60 Ga0070665_100442522 3300005548 Bacteria 1309
61 Ga0070704_100720814 3300005549 Bacteria 886
62 Ga0068855_100002861 3300005563 Bacteria 21208
63 Ga0068855_100090318 3300005563 Bacteria 3535
64 Ga0068855_100230369 3300005563 Bacteria 2075
65 Ga0068857_100038041 3300005577 Bacteria 4262
66 Ga0068854_100024392 3300005578 Bacteria 4141
67 Ga0068856_100091488 3300005614 Bacteria 3026
68 Ga0068856_100385085 3300005614 Bacteria 1422
69 Ga0068852_100004127 3300005616 Bacteria 10227
70 Ga0068859_100003838 3300005617 Bacteria 15350
71 Ga0068859_100004144 3300005617 Bacteria 14804
72 Ga0068864_100000332 3300005618 Bacteria 41671
73 Ga0068864_100004959 3300005618 Bacteria 10910
74 Ga0068864_100061570 3300005618 Bacteria 3251
75 Ga0068861_100005566 3300005719 Bacteria 8535
76 Ga0068863_100000456 3300005841 Bacteria 41671
77 Ga0068863_100028002 3300005841 Bacteria 5379
78 Ga0068863_100068311 3300005841 Bacteria 3362
79 Ga0068858_100000278 3300005842 Bacteria 55142
80 Ga0068860_100000045 3300005843 Bacteria 223252
81 Ga0068860_100108028 3300005843 Bacteria 2659
82 Ga0068860_100483817 3300005843 Bacteria 1234
83 Ga0068862_100000126 3300005844 Bacteria 89210
84 Ga0068862_100000506 3300005844 Bacteria 41538
85 Ga0068862_100001480 3300005844 Bacteria 21523
86 Ga0068862_100021672 3300005844 Bacteria 5373
87 Ga0068862_100041197 3300005844 Bacteria 3929
88 Ga0068862_100041464 3300005844 Bacteria 3916
89 Ga0081455_10002924 3300005937 Bacteria 20032
90 Ga0081455_10077601 3300005937 Bacteria 2732
91 Ga0081540_1026022 3300005983 Bacteria 3351
92 Ga0070717_10192640 3300006028 Bacteria 1782
93 Ga0068871_100114839 3300006358 Bacteria 2269
94 Ga0068865_100000021 3300006881 Bacteria 103137
95 Ga0097620_100003839 3300006931 Bacteria 15350
96 Ga0097620_100004144 3300006931 Bacteria 14804
97 Ga0105251_10001625 3300009011 Bacteria 19048
98 Ga0105251_10036569 3300009011 Bacteria 2415
99 Ga0105240_10029009 3300009093 Bacteria 7217
100 Ga0105240_10052010 3300009093 Bacteria 5151
101 Ga0105240_10249545 3300009093 Bacteria 2053
102 Ga0105240_10746396 3300009093 Bacteria 1064
103 Ga0105245_10325097 3300009098 Bacteria 1516
104 Ga0105247_10008192 3300009101 Bacteria 6381
105 Ga0105247_10037904 3300009101 Bacteria 2941
106 Ga0105243_10001435 3300009148 Bacteria 20998
107 Ga0105243_10001795 3300009148 Bacteria 18418
108 Ga0105241_10104914 3300009174 Bacteria 2253
109 Ga0105242_10000198 3300009176 Bacteria 46869
110 Ga0105242_10034070 3300009176 Bacteria 4081
111 Ga0105248_10000029 3300009177 Bacteria 223366
112 Ga0105248_10000155 3300009177 Bacteria 79121
113 Ga0105248_10293103 3300009177 Bacteria 1832
114 Ga0105248_10303974 3300009177 Bacteria 1796
115 Ga0105237_10002575 3300009545 Bacteria 22351
116 Ga0105237_10348474 3300009545 Bacteria 1485
117 Ga0105237_10678921 3300009545 Bacteria 1037
118 Ga0105237_10737180 3300009545 Bacteria 992
119 Ga0105238_10009116 3300009551 Bacteria 9931
120 Ga0105238_10251887 3300009551 Bacteria 1744
121 Ga0105238_10446424 3300009551 Bacteria 1290
122 Ga0105249_10000024 3300009553 Bacteria 232947
123 Ga0105239_10000131 3300010375 Bacteria 105796
124 Ga0105239_10196436 3300010375 Bacteria 2259
125 Ga0157373_10093177 3300013100 Bacteria 2122
126 Ga0157370_10000203 3300013104 Bacteria 75249
127 Ga0157370_10046403 3300013104 Bacteria 4166
128 Ga0157369_10029339 3300013105 Bacteria 6079
129 Ga0157374_10002712 3300013296 Bacteria 14884
130 Ga0157378_10002734 3300013297 Bacteria 15710
131 Ga0163162_10086804 3300013306 Bacteria 3207
132 Ga0163162_10096946 3300013306 Bacteria 3037
133 Ga0163162_10345313 3300013306 Bacteria 1621
134 Ga0157375_10001617 3300013308 Bacteria 19361
135 Ga0157380_10000137 3300014326 Bacteria 40923
136 Ga0157380_10007500 3300014326 Bacteria 7747
137 Ga0182008_10023235 3300014497 Bacteria 3169
138 Ga0182008_10066578 3300014497 Bacteria 1773
139 Ga0157377_10004241 3300014745 Bacteria 6564
140 Ga0157379_10089237 3300014968 Bacteria 2765
141 Ga0157376_10000140 3300014969 Bacteria 49314
142 Ga0163161_10277101 3300017792 Bacteria 1314
143 Ga0206355_1150189 3300020076 Bacteria 939
144 Ga0209233_1000065 3300025261 Bacteria 387195
145 Ga0209130_1000706 3300025284 Bacteria 29893
146 Ga0209025_1000750 3300025294 Bacteria 54523
147 Ga0209758_1006313 3300025297 Bacteria 8605
148 Ga0207426_1000336 3300025302 Bacteria 88370
149 Ga0207697_10028962 3300025315 Bacteria 2266
150 Ga0207713_1000673 3300025735 Bacteria 32203
151 Ga0207713_1007728 3300025735 Bacteria 6281
152 Ga0207642_10044275 3300025899 Bacteria 1969
153 Ga0207710_10005907 3300025900 Bacteria 5251
154 Ga0207710_10135353 3300025900 Bacteria 1186
155 Ga0207647_10001987 3300025904 Bacteria 15638
156 Ga0207647_10015909 3300025904 Bacteria 5147
157 Ga0207645_10000523 3300025907 Bacteria 31917
158 Ga0207705_10000002 3300025909 Bacteria 2046852
159 Ga0207705_10000025 3300025909 Bacteria 259826
160 Ga0207705_10001656 3300025909 Bacteria 17693
161 Ga0207654_10450920 3300025911 Bacteria 902
162 Ga0207707_10380545 3300025912 Bacteria 1213
163 Ga0207707_10432006 3300025912 Bacteria 1128
164 Ga0207695_10024374 3300025913 Bacteria 6810
165 Ga0207695_10027218 3300025913 Bacteria 6370
166 Ga0207695_10051576 3300025913 Bacteria 4317
167 Ga0207695_10143665 3300025913 Bacteria 2332
168 Ga0207695_10335348 3300025913 Bacteria 1400
169 Ga0207671_10001065 3300025914 Bacteria 33324
170 Ga0207671_10051462 3300025914 Bacteria 3052
171 Ga0207671_10501666 3300025914 Bacteria 967
172 Ga0207693_10403580 3300025915 Bacteria 1068
173 Ga0207657_10007632 3300025919 Bacteria 11071
174 Ga0207657_10039632 3300025919 Bacteria 4184
175 Ga0207649_10051937 3300025920 Bacteria 2541
176 Ga0207681_10000005 3300025923 Bacteria 555724
177 Ga0207681_10000261 3300025923 Bacteria 40384
178 Ga0207694_10008785 3300025924 Bacteria 7623
179 Ga0207694_10249229 3300025924 Bacteria 1453
180 Ga0207694_10282110 3300025924 Bacteria 1365
181 Ga0207650_10000004 3300025925 Bacteria 743372
182 Ga0207650_10000545 3300025925 Bacteria 30685
183 Ga0207659_10200214 3300025926 Bacteria 1594
184 Ga0207687_10005128 3300025927 Bacteria 8686
185 Ga0207687_10285170 3300025927 Bacteria 1325
186 Ga0207700_10165386 3300025928 Bacteria 1841
187 Ga0207700_10261626 3300025928 Bacteria 1482
188 Ga0207644_10000294 3300025931 Bacteria 32960
189 Ga0207644_10005069 3300025931 Bacteria 8599
190 Ga0207644_10159545 3300025931 Bacteria 1752
191 Ga0207690_10002318 3300025932 Bacteria 11610
192 Ga0207690_10055331 3300025932 Bacteria 2672
193 Ga0207690_10215242 3300025932 Bacteria 1467
194 Ga0207706_10007622 3300025933 Bacteria 10008
195 Ga0207686_10006212 3300025934 Bacteria 6424
196 Ga0207686_10043721 3300025934 Bacteria 2746
197 Ga0207709_10000118 3300025935 Bacteria 122125
198 Ga0207704_10000027 3300025938 Bacteria 122372
199 Ga0207711_10000004 3300025941 Bacteria 870636
200 Ga0207711_10005137 3300025941 Bacteria 11096
201 Ga0207711_10006059 3300025941 Bacteria 10217
202 Ga0207689_10000584 3300025942 Bacteria 34795
203 Ga0207661_10005016 3300025944 Bacteria 9281
204 Ga0207667_10002922 3300025949 Bacteria 21209
205 Ga0207667_10117957 3300025949 Bacteria 2735
206 Ga0207667_10240974 3300025949 Bacteria 1851
207 Ga0207651_10000016 3300025960 Bacteria 122094
208 Ga0207651_10010648 3300025960 Bacteria 5107
209 Ga0207712_10000034 3300025961 Bacteria 202320
210 Ga0207668_10000030 3300025972 Bacteria 122797
211 Ga0207668_10004978 3300025972 Bacteria 7818
212 Ga0207668_10007717 3300025972 Bacteria 6400
213 Ga0207668_10026592 3300025972 Bacteria 3758
214 Ga0207668_10069184 3300025972 Bacteria 2512
215 Ga0207640_10036089 3300025981 Bacteria 3100
216 Ga0207640_10346896 3300025981 Bacteria 1191
217 Ga0207658_10000002 3300025986 Bacteria 1364188
218 Ga0207658_10000434 3300025986 Bacteria 39528
219 Ga0207658_10005601 3300025986 Bacteria 8591
220 Ga0207658_10010032 3300025986 Bacteria 6433
221 Ga0207677_10000192 3300026023 Bacteria 49458
222 Ga0207677_10086826 3300026023 Bacteria 2263
223 Ga0207703_10000587 3300026035 Bacteria 37079
224 Ga0207639_10034891 3300026041 Bacteria 3721
225 Ga0207639_10125204 3300026041 Bacteria 2118
226 Ga0207641_10000010 3300026088 Bacteria 402193
227 Ga0207641_10000199 3300026088 Bacteria 81050
228 Ga0207641_10003708 3300026088 Bacteria 13453
229 Ga0207641_10006245 3300026088 Bacteria 10080
230 Ga0207641_10075882 3300026088 Bacteria 2904
231 Ga0207648_10000116 3300026089 Bacteria 77755
232 Ga0207676_10000006 3300026095 Bacteria 681936
233 Ga0207676_10000036 3300026095 Bacteria 198447
234 Ga0207676_10037144 3300026095 Bacteria 3710
235 Ga0207674_10066042 3300026116 Bacteria 3645
236 Ga0207674_10083581 3300026116 Bacteria 3192
237 Ga0207675_100000385 3300026118 Bacteria 42428
238 Ga0207698_10001220 3300026142 Bacteria 15021
239 Ga0268266_10000175 3300028379 Bacteria 115897
240 Ga0268266_10000329 3300028379 Bacteria 74608
241 Ga0268265_10000001 3300028380 Bacteria 1230727
242 Ga0268265_10000059 3300028380 Bacteria 152531
243 Ga0268265_10004576 3300028380 Bacteria 9564
244 Ga0268265_10020157 3300028380 Bacteria 4650
245 Ga0268265_10034737 3300028380 Bacteria 3677
246 Ga0268265_10272096 3300028380 Bacteria 1511
247 Ga0268265_10613696 3300028380 Bacteria 1041
248 Ga0268264_10000101 3300028381 Bacteria 225109
249 Ga0268264_10024380 3300028381 Bacteria 4939
250 Ga0265334_10013837 3300028573 Bacteria 3372
251 Ga0307517_10074320 3300028786 Bacteria 2999
252 Ga0265338_10029568 3300028800 Bacteria 5426
253 Ga0307513_10313091 3300031456 Bacteria 1331
254 Ga0307408_100029973 3300031548 Bacteria 3775
255 Ga0265314_10053773 3300031711 Bacteria 2791
256 Ga0265314_10075556 3300031711 Bacteria 2241
257 Ga0307405_10095803 3300031731 Bacteria 1977
258 Ga0307413_10213403 3300031824 Bacteria 1404
259 Ga0307410_10284212 3300031852 Bacteria 1299
260 Ga0307407_10106730 3300031903 Bacteria 1750
261 Ga0307412_10057250 3300031911 Bacteria 2601
262 Ga0307412_10130690 3300031911 Bacteria 1823
263 Ga0307412_10167191 3300031911 Bacteria 1641
264 Ga0307409_100079518 3300031995 Bacteria 2643
265 Ga0307416_100032632 3300032002 Bacteria 3938
266 Ga0307416_100072295 3300032002 Bacteria 2870
267 Ga0307414_10000842 3300032004 Bacteria 15692
268 Ga0307414_10002252 3300032004 Bacteria 10077
269 Ga0307414_10074995 3300032004 Bacteria 2453
270 Ga0307411_10227859 3300032005 Bacteria 1450
271 Ga0373936_0011119 3300035113 Bacteria 3402
272 Ga0373941_0174140 3300035115 Bacteria 804
273 Ga0373956_0173862 3300035119 Bacteria 1017
274 Ga0316574_0495030 3300035398 Bacteria 763
275 Ga0373933_0318855 3300035724 Bacteria 1008
276 Ga0373933_0348612 3300035724 Bacteria 962
277 Ga0373937_0783953 3300036401 Bacteria 901
278 Ga0395900_0669718 3300037418 Bacteria 973
279 Ga0395905_0132640 3300037471 Bacteria 2343
280 Ga0436364_0602458 3300037853 Bacteria 947
281 Ga0395901_0008801 3300038443 Bacteria 10216
282 Ga0395901_0053106 3300038443 Bacteria 4211
283 Ga0395901_0168957 3300038443 Bacteria 2295
284 Ga0436361_0977713 3300039447 Bacteria 1809
285 Ga0436363_0120568 3300039450 Bacteria 1318
286 Ga0439448_0032258 3300042005 Bacteria 1666
287 Ga0439455_0034490 3300042012 Bacteria 1273
288 Ga0439458_0000048 3300042157 Bacteria 19869
289 Ga0466961_0031975 3300044693 Bacteria 3381
290 Ga0466961_0052446 3300044693 Bacteria 2603
291 Ga0466963_0012325 3300044694 Bacteria 5229
292 Ga0466971_0001004 3300044719 Bacteria 11648
293 Ga0466957_0010106 3300044842 Bacteria 5402
294 Ga0466957_0117011 3300044842 Bacteria 1696
295 Ga0466957_0335348 3300044842 Bacteria 1023
296 Ga0466959_0187074 3300045049 Bacteria 1446
297 Ga0451576_1184382 3300045051 Bacteria 798
298 Ga0466958_0000542 3300045836 Bacteria 16044
299 Ga0466967_0035436 3300045976 Bacteria 4248
300 Ga0466967_0098563 3300045976 Bacteria 2669
301 Ga0466967_0402281 3300045976 Bacteria 1332
302 Ga0466967_1040647 3300045976 Bacteria 815
303 Ga0495664_0186402 3300046477 Bacteria 1258
304 Ga0495630_0117679 3300046517 Unclassified 2015
305 Ga0495643_0021446 3300046522 Bacteria 3706
306 Ga0495652_0052575 3300046529 Bacteria 3474
307 Ga0495668_0041791 3300046616 Bacteria 2553
308 Ga0495669_0137161 3300046684 Bacteria 1154
309 Ga0495613_0003587 3300046689 Bacteria 11631
310 Ga0495686_0000262 3300047472 Bacteria 94462
311 Ga0496102_0000100 3300048905 Bacteria 123531
312 Ga0496102_0139022 3300048905 Bacteria 2277
313 Ga0496103_0000070 3300048906 Bacteria 121077
314 Ga0496103_0013787 3300048906 Bacteria 4799
315 Ga0496103_0199037 3300048906 Bacteria 1288
316 Ga0496108_0867467 3300048911 Bacteria 776
317 Ga0496115_0224187 3300048918 Bacteria 1551
318 Ga0496116_0000045 3300048919 Bacteria 324307
319 Ga0496116_0001752 3300048919 Bacteria 23645
320 Ga0496117_0000194 3300048920 Bacteria 123531
321 Ga0496117_0005305 3300048920 Bacteria 13633
322 Ga0496117_0010705 3300048920 Bacteria 8297
323 Ga0496117_0023598 3300048920 Bacteria 4895
324 Ga0496118_0000146 3300048921 Bacteria 123531
325 Ga0496118_0001200 3300048921 Bacteria 39881
326 Ga0496118_0004591 3300048921 Bacteria 16240
327 Ga0496118_0027705 3300048921 Bacteria 4788
328 Ga0496118_0082996 3300048921 Bacteria 2242
329 Ga0496119_0033374 3300048922 Bacteria 3412
330 Ga0496119_0036195 3300048922 Bacteria 3225
331 Ga0496119_0068394 3300048922 Bacteria 2091
332 Ga0496120_0148537 3300048923 Bacteria 1180
333 Ga0496120_0171386 3300048923 Bacteria 1073
334 Ga0496121_0000024 3300048924 Bacteria 462959
335 Ga0496121_0011369 3300048924 Bacteria 9895
336 Ga0496121_0028649 3300048924 Bacteria 5179
337 Ga0496122_0004681 3300048925 Bacteria 16797
338 Ga0496122_0118356 3300048925 Bacteria 1717
339 Ga0496123_0002896 3300048926 Bacteria 20095
340 Ga0496123_0054707 3300048926 Bacteria 2625
341 Ga0496124_0000185 3300048927 Bacteria 123531
342 Ga0496124_0006995 3300048927 Bacteria 12093
343 Ga0496124_0007034 3300048927 Bacteria 12052
344 Ga0496124_0062904 3300048927 Bacteria 3103
345 Ga0496124_0081232 3300048927 Bacteria 2665
346 Ga0496125_0006050 3300048928 Bacteria 13227
347 Ga0496125_0069852 3300048928 Bacteria 2752
348 Ga0496126_0000641 3300048929 Bacteria 65115
349 Ga0496126_0013949 3300048929 Bacteria 8151
350 Ga0496126_0558937 3300048929 Bacteria 907
351 Ga0501314_001657 3300049530 Bacteria 1640
352 Ga0501031_0213358 3300049568 Bacteria 1258
353 Ga0501033_0130415 3300049570 Bacteria 1821
354 Ga0501033_0163326 3300049570 Bacteria 1602
355 Ga0501034_0145297 3300049571 Bacteria 2349
356 Ga0501034_0193996 3300049571 Bacteria 1992
357 Ga0501034_0514441 3300049571 Bacteria 1109
358 Ga0501036_0226032 3300049572 Bacteria 1571
359 Ga0501036_0669003 3300049572 Bacteria 859
360 Ga0501043_0011178 3300049579 Bacteria 7030
361 Ga0501043_0030046 3300049579 Bacteria 4269
362 Ga0501046_0158362 3300049580 Bacteria 1704
363 Ga0501047_0002100 3300049581 Bacteria 19058
364 Ga0501047_0002711 3300049581 Bacteria 16852
365 Ga0501069_0036930 3300049585 Bacteria 2695
366 Ga0501070_0141748 3300049586 Bacteria 1984
367 Ga0501073_0029192 3300049589 Bacteria 3941
368 Ga0501073_0098262 3300049589 Bacteria 2033
369 Ga0501223_000055 3300049663 Bacteria 38140
370 Ga0501223_004618 3300049663 Bacteria 2933
371 Ga0501224_000002 3300049664 Bacteria 229331
372 Ga0501233_000660 3300049668 Bacteria 5653
373 Ga0501235_004155 3300049669 Bacteria 3136
374 Ga0501257_000064 3300049686 Bacteria 29858
375 Ga0501225_0000039 3300049705 Bacteria 44735
376 Ga0501234_000132 3300049707 Bacteria 9862
377 Ga0501080_0224295 3300049742 Bacteria 1719
378 Ga0501280_000700 3300049776 Bacteria 7417
379 Ga0501035_0379871 3300049822 Bacteria 1178
380 Ga0501035_0459771 3300049822 Bacteria 1052
381 Ga0501044_0000338 3300049823 Bacteria 59252
382 Ga0501044_0005365 3300049823 Bacteria 14244
383 Ga0501044_0137914 3300049823 Bacteria 2429
384 Ga0501044_0214755 3300049823 Bacteria 1876
385 Ga0501226_000046 3300049853 Bacteria 54629
386 nmdc:mga0sz30_3345_c1 3300050516 Bacteria 4558
387 Ga0500643_000033 3300053087 Bacteria 189987
388 Ga0500643_000933 3300053087 Bacteria 18300
389 Ga0500592_000134 3300053116 Bacteria 15761
390 Ga0500592_000653 3300053116 Bacteria 5698
391 Ga0500592_000869 3300053116 Bacteria 4931
392 Ga0500608_003694 3300053122 Bacteria 5793
393 Ga0500655_006723 3300053133 Bacteria 2069
394 Ga0500559_0001479 3300053136 Bacteria 13261
395 Ga0500559_0033290 3300053136 Bacteria 2218
396 Ga0500590_020369 3300053148 Bacteria 3442
397 Ga0500604_0076415 3300053151 Bacteria 1076
398 Ga0500627_0000230 3300053158 Bacteria 15971
399 Ga0500637_0167800 3300053178 Bacteria 1263
400 Ga0500625_000004 3300053729 Bacteria 245905
401 Ga0500645_003846 3300053730 Bacteria 5949
402 Ga0587066_010533 3300059490 Bacteria 1335
403 Ga0587077_013038 3300059493 Bacteria 1341
404 Ga0587080_025466 3300059503 Bacteria 999
405 Ga0587082_005893 3300059504 Bacteria 1612
406 Ga0587106_014356 3300059605 Bacteria 1090
407 Ga0587072_015040 3300059643 Bacteria 1310
408 Ga0587075_012495 3300059644 Bacteria 1155
409 Ga0587079_034795 3300059647 Bacteria 988
410 Ga0587100_005045 3300059648 Bacteria 969
411 Ga0466962_0025480 3300061719 Bacteria 2839
412 Ga0466962_0187539 3300061719 Bacteria 1009
413 2600228766 2599185359 Bacteria 4772316
414 2643731326 2643221541 Bacteria 5498788
415 2644038090 2643221605 Bacteria 4772303
416 2644042346 2643221606 Bacteria 5588032
417 2644394012 2643221671 Bacteria 5496681
418 2819715938 2818991466 Bacteria 4748179
419 2842339372 2842333319 Bacteria 8899485
420 2842340837 2842333319 Bacteria 8899485
421 2879163298 2879163058 Bacteria 4223965
422 2882809126 2882806704 Bacteria 3007728
423 2883359331 2883354860 Bacteria 5865246
424 2928529980 2928526807 Bacteria 4760224
425 2928970598 2928968154 Bacteria 4633371
426 Ga0065707_10108315
427 JGI24736J21556_1013414
428 JGI24752J21851_1001110
429 JGI24739J22299_10000394
430 JGI24737J22298_10018343
431 JGI24735J21928_10012035
432 JGI24735J21928_10039199
433 JGI24738J21930_10000528
434 JGI24751J29686_10000135
435 JGI25151J46595_10000624
436 JGI25160J50197_1015010
437 Ga0065704_10075983
438 Ga0065704_10083410
439 Ga0065707_10081960
440 Ga0065707_10085937
441 Ga0070658_10000040
442 Ga0070658_10005671
443 Ga0070658_10205693
444 Ga0070670_100000090
445 Ga0070670_100000965
446 Ga0070670_100049568
447 Ga0068869_100000568
448 Ga0070680_100543403
449 Ga0068868_100000133
450 Ga0068868_100043658
451 Ga0068868_100124338
452 Ga0070660_100003719
453 Ga0070660_100514408
454 Ga0070689_100568115
455 Ga0070661_100084031
456 Ga0070661_100599177
457 Ga0070692_10016423
458 Ga0070668_100000132
459 Ga0070668_100001305
460 Ga0070668_100002711
461 Ga0070668_100016881
462 Ga0070669_100000093
463 Ga0070669_100001282
464 Ga0070671_100001115
465 Ga0070671_100004606
466 Ga0070671_100191523
467 Ga0070673_100000015
468 Ga0070673_100042584
469 Ga0070659_100003241
470 Ga0070667_100000003
471 Ga0070667_100002068
472 Ga0070667_100004333
473 Ga0070662_100006260
474 Ga0070681_10377301
475 Ga0068867_100000030
476 Ga0068867_100044583
477 Ga0070685_10542377
478 Ga0070698_100285428
479 Ga0070679_100066157
480 Ga0070679_100132326
481 Ga0070679_100171015
482 Ga0068853_100034401
483 Ga0070665_100000079
484 Ga0070665_100000685
485 Ga0070665_100442522
486 Ga0070704_100720814
487 Ga0068855_100002861
488 Ga0068855_100090318
489 Ga0068855_100230369
490 Ga0068857_100038041
491 Ga0068854_100024392
492 Ga0068856_100091488
493 Ga0068856_100385085
494 Ga0068852_100004127
495 Ga0068859_100003838
496 Ga0068859_100004144
497 Ga0068864_100000332
498 Ga0068864_100004959
499 Ga0068864_100061570
500 Ga0068861_100005566
501 Ga0068863_100000456
502 Ga0068863_100028002
503 Ga0068863_100068311
504 Ga0068858_100000278
505 Ga0068860_100000045
506 Ga0068860_100108028
507 Ga0068860_100483817
508 Ga0068862_100000126
509 Ga0068862_100000506
510 Ga0068862_100001480
511 Ga0068862_100021672
512 Ga0068862_100041197
513 Ga0068862_100041464
514 Ga0081455_10002924
515 Ga0081455_10077601
516 Ga0081540_1026022
517 Ga0070717_10192640
518 Ga0068871_100114839
519 Ga0068865_100000021
520 Ga0097620_100003839
521 Ga0097620_100004144
522 Ga0105251_10001625
523 Ga0105251_10036569
524 Ga0105240_10029009
525 Ga0105240_10052010
526 Ga0105240_10249545
527 Ga0105240_10746396
528 Ga0105245_10325097
529 Ga0105247_10008192
530 Ga0105247_10037904
531 Ga0105243_10001435
532 Ga0105243_10001795
533 Ga0105241_10104914
534 Ga0105242_10000198
535 Ga0105242_10034070
536 Ga0105248_10000029
537 Ga0105248_10000155
538 Ga0105248_10293103
539 Ga0105248_10303974
540 Ga0105237_10002575
541 Ga0105237_10348474
542 Ga0105237_10678921
543 Ga0105237_10737180
544 Ga0105238_10009116
545 Ga0105238_10251887
546 Ga0105238_10446424
547 Ga0105249_10000024
548 Ga0105239_10000131
549 Ga0105239_10196436
550 Ga0157373_10093177
551 Ga0157370_10000203
552 Ga0157370_10046403
553 Ga0157369_10029339
554 Ga0157374_10002712
555 Ga0157378_10002734
556 Ga0163162_10086804
557 Ga0163162_10096946
558 Ga0163162_10345313
559 Ga0157375_10001617
560 Ga0157380_10000137
561 Ga0157380_10007500
562 Ga0182008_10023235
563 Ga0182008_10066578
564 Ga0157377_10004241
565 Ga0157379_10089237
566 Ga0157376_10000140
567 Ga0163161_10277101
568 Ga0206355_1150189
569 Ga0209233_1000065
570 Ga0209130_1000706
571 Ga0209025_1000750
572 Ga0209758_1006313
573 Ga0207426_1000336
574 Ga0207697_10028962
575 Ga0207713_1000673
576 Ga0207713_1007728
577 Ga0207642_10044275
578 Ga0207710_10005907
579 Ga0207710_10135353
580 Ga0207647_10001987
581 Ga0207647_10015909
582 Ga0207645_10000523
583 Ga0207705_10000002
584 Ga0207705_10000025
585 Ga0207705_10001656
586 Ga0207654_10450920
587 Ga0207707_10380545
588 Ga0207707_10432006
589 Ga0207695_10024374
590 Ga0207695_10027218
591 Ga0207695_10051576
592 Ga0207695_10143665
593 Ga0207695_10335348
594 Ga0207671_10001065
595 Ga0207671_10051462
596 Ga0207671_10501666
597 Ga0207693_10403580
598 Ga0207657_10007632
599 Ga0207657_10039632
600 Ga0207649_10051937
601 Ga0207681_10000005
602 Ga0207681_10000261
603 Ga0207694_10008785
604 Ga0207694_10249229
605 Ga0207694_10282110
606 Ga0207650_10000004
607 Ga0207650_10000545
608 Ga0207659_10200214
609 Ga0207687_10005128
610 Ga0207687_10285170
611 Ga0207700_10165386
612 Ga0207700_10261626
613 Ga0207644_10000294
614 Ga0207644_10005069
615 Ga0207644_10159545
616 Ga0207690_10002318
617 Ga0207690_10055331
618 Ga0207690_10215242
619 Ga0207706_10007622
620 Ga0207686_10006212
621 Ga0207686_10043721
622 Ga0207709_10000118
623 Ga0207704_10000027
624 Ga0207711_10000004
625 Ga0207711_10005137
626 Ga0207711_10006059
627 Ga0207689_10000584
628 Ga0207661_10005016
629 Ga0207667_10002922
630 Ga0207667_10117957
631 Ga0207667_10240974
632 Ga0207651_10000016
633 Ga0207651_10010648
634 Ga0207712_10000034
635 Ga0207668_10000030
636 Ga0207668_10004978
637 Ga0207668_10007717
638 Ga0207668_10026592
639 Ga0207668_10069184
640 Ga0207640_10036089
641 Ga0207640_10346896
642 Ga0207658_10000002
643 Ga0207658_10000434
644 Ga0207658_10005601
645 Ga0207658_10010032
646 Ga0207677_10000192
647 Ga0207677_10086826
648 Ga0207703_10000587
649 Ga0207639_10034891
650 Ga0207639_10125204
651 Ga0207641_10000010
652 Ga0207641_10000199
653 Ga0207641_10003708
654 Ga0207641_10006245
655 Ga0207641_10075882
656 Ga0207648_10000116
657 Ga0207676_10000006
658 Ga0207676_10000036
659 Ga0207676_10037144
660 Ga0207674_10066042
661 Ga0207674_10083581
662 Ga0207675_100000385
663 Ga0207698_10001220
664 Ga0268266_10000175
665 Ga0268266_10000329
666 Ga0268265_10000001
667 Ga0268265_10000059
668 Ga0268265_10004576
669 Ga0268265_10020157
670 Ga0268265_10034737
671 Ga0268265_10272096
672 Ga0268265_10613696
673 Ga0268264_10000101
674 Ga0268264_10024380
675 Ga0265334_10013837
676 Ga0307517_10074320
677 Ga0265338_10029568
678 Ga0307513_10313091
679 Ga0307408_100029973
680 Ga0265314_10053773
681 Ga0265314_10075556
682 Ga0307405_10095803
683 Ga0307413_10213403
684 Ga0307410_10284212
685 Ga0307407_10106730
686 Ga0307412_10057250
687 Ga0307412_10130690
688 Ga0307412_10167191
689 Ga0307409_100079518
690 Ga0307416_100032632
691 Ga0307416_100072295
692 Ga0307414_10000842
693 Ga0307414_10002252
694 Ga0307414_10074995
695 Ga0307411_10227859
696 Ga0373936_0011119
697 Ga0373941_0174140
698 Ga0373956_0173862
699 Ga0316574_0495030
700 Ga0373933_0318855
701 Ga0373933_0348612
702 Ga0373937_0783953
703 Ga0395900_0669718
704 Ga0395905_0132640
705 Ga0436364_0602458
706 Ga0395901_0008801
707 Ga0395901_0053106
708 Ga0395901_0168957
709 Ga0436361_0977713
710 Ga0436363_0120568
711 Ga0439448_0032258
712 Ga0439455_0034490
713 Ga0439458_0000048
714 Ga0466961_0031975
715 Ga0466961_0052446
716 Ga0466963_0012325
717 Ga0466971_0001004
718 Ga0466957_0010106
719 Ga0466957_0117011
720 Ga0466957_0335348
721 Ga0466959_0187074
722 Ga0451576_1184382
723 Ga0466958_0000542
724 Ga0466967_0035436
725 Ga0466967_0098563
726 Ga0466967_0402281
727 Ga0466967_1040647
728 Ga0495664_0186402
729 Ga0495630_0117679
730 Ga0495643_0021446
731 Ga0495652_0052575
732 Ga0495668_0041791
733 Ga0495669_0137161
734 Ga0495613_0003587
735 Ga0495686_0000262
736 Ga0496102_0000100
737 Ga0496102_0139022
738 Ga0496103_0000070
739 Ga0496103_0013787
740 Ga0496103_0199037
741 Ga0496108_0867467
742 Ga0496115_0224187
743 Ga0496116_0000045
744 Ga0496116_0001752
745 Ga0496117_0000194
746 Ga0496117_0005305
747 Ga0496117_0010705
748 Ga0496117_0023598
749 Ga0496118_0000146
750 Ga0496118_0001200
751 Ga0496118_0004591
752 Ga0496118_0027705
753 Ga0496118_0082996
754 Ga0496119_0033374
755 Ga0496119_0036195
756 Ga0496119_0068394
757 Ga0496120_0148537
758 Ga0496120_0171386
759 Ga0496121_0000024
760 Ga0496121_0011369
761 Ga0496121_0028649
762 Ga0496122_0004681
763 Ga0496122_0118356
764 Ga0496123_0002896
765 Ga0496123_0054707
766 Ga0496124_0000185
767 Ga0496124_0006995
768 Ga0496124_0007034
769 Ga0496124_0062904
770 Ga0496124_0081232
771 Ga0496125_0006050
772 Ga0496125_0069852
773 Ga0496126_0000641
774 Ga0496126_0013949
775 Ga0496126_0558937
776 Ga0501314_001657
777 Ga0501031_0213358
778 Ga0501033_0130415
779 Ga0501033_0163326
780 Ga0501034_0145297
781 Ga0501034_0193996
782 Ga0501034_0514441
783 Ga0501036_0226032
784 Ga0501036_0669003
785 Ga0501043_0011178
786 Ga0501043_0030046
787 Ga0501046_0158362
788 Ga0501047_0002100
789 Ga0501047_0002711
790 Ga0501069_0036930
791 Ga0501070_0141748
792 Ga0501073_0029192
793 Ga0501073_0098262
794 Ga0501223_000055
795 Ga0501223_004618
796 Ga0501224_000002
797 Ga0501233_000660
798 Ga0501235_004155
799 Ga0501257_000064
800 Ga0501225_0000039
801 Ga0501234_000132
802 Ga0501080_0224295
803 Ga0501280_000700
804 Ga0501035_0379871
805 Ga0501035_0459771
806 Ga0501044_0000338
807 Ga0501044_0005365
808 Ga0501044_0137914
809 Ga0501044_0214755
810 Ga0501226_000046
811 nmdc:mga0sz30_3345_c1
812 Ga0500643_000033
813 Ga0500643_000933
814 Ga0500592_000134
815 Ga0500592_000653
816 Ga0500592_000869
817 Ga0500608_003694
818 Ga0500655_006723
819 Ga0500559_0001479
820 Ga0500559_0033290
821 Ga0500590_020369
822 Ga0500604_0076415
823 Ga0500627_0000230
824 Ga0500637_0167800
825 Ga0500625_000004
826 Ga0500645_003846
827 Ga0587066_010533
828 Ga0587077_013038
829 Ga0587080_025466
830 Ga0587082_005893
831 Ga0587106_014356
832 Ga0587072_015040
833 Ga0587075_012495
834 Ga0587079_034795
835 Ga0587100_005045
836 Ga0466962_0025480
837 Ga0466962_0187539
838 2600228766
839 2643731326
840 2644038090
841 2644042346
842 2644394012
843 2819715938
844 2842339372
845 2842340837
846 2879163298
847 2882809126
848 2883359331
849 2928529980
850 2928970598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

258

0.97

PF00106

adh_short

short chain dehydrogenase

23

212

0.96

PF08659

KR

KR domain

24

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kms-assembly1.cif.gz_B-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.9571 1 236
4kms-assembly1.cif.gz_A-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.9557 1 236
4wk6-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9438 3 240
4wk6-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9423 3 236
4wk6-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9408 3 240
ID Description Score Start End Superfamily
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 1 236 3.40.50.720
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 1 236 3.40.50.720
4rziB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9312 3 238 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 2 237 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9277 3 236 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G4UGZ1-F1-model_v4 deleted 0.9539 2 237
AF-N0B6H7-F1-model_v4 Acetoacetyl-CoA reductase 0.9535 1 237 GO:0005737
GO:0018454
GO:0042619
AF-A0A6I3T1P8-F1-model_v4 Acetoacetyl-CoA reductase (EC 1.1.1.36) 0.9535 1 237 GO:0005737
GO:0018454
GO:0042619
AF-A0A6A5LF29-F1-model_v4 deleted 0.9522 1 227
AF-A0A2U8BRP6-F1-model_v4 Acetoacetyl-CoA reductase 0.9512 1 236 GO:0016491

Map