F440908

General Info

Members Datasets Scaffolds Average Seq Length
425 239 424 77

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100670494|Ga0070683_1006704941
Length 87
Sequence MAIKLNLDRVMLERRISLTDLAEKVGITLANLSILKTNKARAIRFTTLDALCRELQCQPGELLEFVAQDAREEVQAEQVSSAPEGRS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
185 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
186 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.94
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10805110 3300005293 Bacteria 608
2 Ga0065707_10442474 3300005295 Bacteria 806
3 Ga0065707_10869266 3300005295 Bacteria 576
4 Ga0070658_10114041 3300005327 Bacteria 2241
5 Ga0070676_10023538 3300005328 Bacteria 3462
6 Ga0070676_11521100 3300005328 Unclassified 516
7 Ga0070683_100670494 3300005329 Bacteria 993
8 Ga0070680_100875598 3300005336 Bacteria 774
9 Ga0070680_100912955 3300005336 Bacteria 758
10 Ga0068868_100904554 3300005338 Unclassified 802
11 Ga0070660_100187617 3300005339 Unclassified 1674
12 Ga0070660_100204534 3300005339 Bacteria 1602
13 Ga0070691_10001156 3300005341 Bacteria 10999
14 Ga0070691_10157918 3300005341 Bacteria 1167
15 Ga0070668_100029505 3300005347 Bacteria 4167
16 Ga0070668_102250125 3300005347 Bacteria 504
17 Ga0070669_100176552 3300005353 Bacteria 1669
18 Ga0070669_100176736 3300005353 Bacteria 1668
19 Ga0070669_100565273 3300005353 Bacteria 950
20 Ga0070675_100067423 3300005354 Bacteria 2961
21 Ga0070674_100069755 3300005356 Bacteria 2480
22 Ga0070673_102040370 3300005364 Bacteria 544
23 Ga0070688_100873118 3300005365 Bacteria 708
24 Ga0070659_100100362 3300005366 Bacteria 2329
25 Ga0070709_10000184 3300005434 Bacteria 39762
26 Ga0070709_10073149 3300005434 Bacteria 2218
27 Ga0070714_100020356 3300005435 Bacteria 5417
28 Ga0070713_100000001 3300005436 Bacteria 257984
29 Ga0070713_100077226 3300005436 Bacteria 2831
30 Ga0070701_10591134 3300005438 Bacteria 734
31 Ga0070700_100347186 3300005441 Unclassified 1099
32 Ga0070694_100381687 3300005444 Bacteria 1099
33 Ga0070708_100617234 3300005445 Bacteria 1022
34 Ga0070678_100551693 3300005456 Bacteria 1023
35 Ga0070681_10018800 3300005458 Bacteria 6915
36 Ga0070681_10042791 3300005458 Bacteria 4538
37 Ga0070681_10419399 3300005458 Bacteria 1250
38 Ga0068867_100062517 3300005459 Bacteria 2766
39 Ga0068867_102252934 3300005459 Bacteria 517
40 Ga0070706_100993442 3300005467 Bacteria 774
41 Ga0070679_100032184 3300005530 Bacteria 5185
42 Ga0070679_100047438 3300005530 Bacteria 4282
43 Ga0070679_101237510 3300005530 Unclassified 692
44 Ga0070684_101188730 3300005535 Bacteria 717
45 Ga0070684_101315333 3300005535 Bacteria 680
46 Ga0068853_100022645 3300005539 Bacteria 5250
47 Ga0070672_100234078 3300005543 Bacteria 1544
48 Ga0070672_100555593 3300005543 Bacteria 997
49 Ga0070695_100006278 3300005545 Bacteria 7020
50 Ga0070696_101029055 3300005546 Bacteria 689
51 Ga0070696_101332276 3300005546 Bacteria 610
52 Ga0070693_100039396 3300005547 Bacteria 2647
53 Ga0070665_101706336 3300005548 Unclassified 637
54 Ga0070704_100681394 3300005549 Bacteria 910
55 Ga0070704_101406328 3300005549 Bacteria 640
56 Ga0068855_100014497 3300005563 Bacteria 9493
57 Ga0068855_100030199 3300005563 Bacteria 6483
58 Ga0068855_100531413 3300005563 Unclassified 1275
59 Ga0068855_102273942 3300005563 Bacteria 543
60 Ga0070664_100193204 3300005564 Bacteria 1814
61 Ga0070664_100396302 3300005564 Bacteria 1262
62 Ga0068857_100000821 3300005577 Bacteria 23249
63 Ga0068857_101439659 3300005577 Bacteria 671
64 Ga0068854_100029197 3300005578 Bacteria 3816
65 Ga0068856_100000182 3300005614 Bacteria 65421
66 Ga0068856_100003034 3300005614 Bacteria 17203
67 Ga0068852_100000764 3300005616 Bacteria 21174
68 Ga0068864_100436621 3300005618 Bacteria 1250
69 Ga0068864_102664886 3300005618 Bacteria 506
70 Ga0068861_100763014 3300005719 Bacteria 904
71 Ga0068870_11444876 3300005840 Bacteria 505
72 Ga0068863_100385075 3300005841 Bacteria 1370
73 Ga0068863_102355949 3300005841 Bacteria 542
74 Ga0068858_101545252 3300005842 Unclassified 655
75 Ga0068860_100236038 3300005843 Bacteria 1778
76 Ga0068860_100845392 3300005843 Bacteria 930
77 Ga0068862_100113306 3300005844 Bacteria 2382
78 Ga0081538_10011477 3300005981 Bacteria 7173
79 Ga0081539_10000164 3300005985 Bacteria 154639
80 Ga0081539_10020919 3300005985 Bacteria 4395
81 Ga0081539_10038911 3300005985 Bacteria 2812
82 Ga0070716_100378666 3300006173 Bacteria 1011
83 Ga0070712_100000026 3300006175 Bacteria 77190
84 Ga0097621_100357152 3300006237 Bacteria 1301
85 Ga0097621_102208325 3300006237 Unclassified 526
86 Ga0068871_100759497 3300006358 Bacteria 892
87 Ga0068871_101239213 3300006358 Bacteria 700
88 Ga0068871_101300274 3300006358 Bacteria 684
89 Ga0075428_100000003 3300006844 Bacteria 365483
90 Ga0075428_100028540 3300006844 Bacteria 6173
91 Ga0075428_100067914 3300006844 Bacteria 3901
92 Ga0075428_100068227 3300006844 Bacteria 3890
93 Ga0075428_100790923 3300006844 Bacteria 1008
94 Ga0075430_100037157 3300006846 Bacteria 4129
95 Ga0075430_100043221 3300006846 Bacteria 3809
96 Ga0075430_100470103 3300006846 Bacteria 1038
97 Ga0075430_101084522 3300006846 Bacteria 660
98 Ga0075430_101445236 3300006846 Bacteria 565
99 Ga0075431_100025474 3300006847 Bacteria 6063
100 Ga0075431_100134557 3300006847 Unclassified 2548
101 Ga0075431_100504234 3300006847 Bacteria 1201
102 Ga0075431_100966697 3300006847 Bacteria 819
103 Ga0075431_100991690 3300006847 Unclassified 807
104 Ga0075433_10008427 3300006852 Bacteria 8224
105 Ga0075434_100012298 3300006871 Bacteria 8108
106 Ga0075434_100565724 3300006871 Unclassified 1156
107 Ga0075434_100618685 3300006871 Bacteria 1102
108 Ga0075434_100813896 3300006871 Bacteria 950
109 Ga0075429_100048500 3300006880 Bacteria 3693
110 Ga0075429_100434661 3300006880 Bacteria 1150
111 Ga0075429_101490162 3300006880 Bacteria 589
112 Ga0075429_101555391 3300006880 Unclassified 575
113 Ga0068865_100887235 3300006881 Bacteria 775
114 Ga0068865_101045759 3300006881 Bacteria 717
115 Ga0075436_100000553 3300006914 Bacteria 24405
116 Ga0075436_101259552 3300006914 Bacteria 559
117 Ga0075435_100223388 3300007076 Bacteria 1599
118 Ga0105240_10008019 3300009093 Bacteria 15203
119 Ga0105240_10387068 3300009093 Bacteria 1578
120 Ga0111539_10000001 3300009094 Bacteria 1035431
121 Ga0111539_10829262 3300009094 Bacteria 1076
122 Ga0111539_12028521 3300009094 Bacteria 667
123 Ga0105245_10502602 3300009098 Bacteria 1229
124 Ga0105247_10068312 3300009101 Bacteria 2216
125 Ga0114129_10121171 3300009147 Bacteria 3600
126 Ga0114129_10441182 3300009147 Bacteria 1709
127 Ga0114129_10687039 3300009147 Bacteria 1317
128 Ga0114129_11504145 3300009147 Bacteria 827
129 Ga0105243_10977894 3300009148 Bacteria 847
130 Ga0105243_11223012 3300009148 Bacteria 765
131 Ga0105243_12898384 3300009148 Bacteria 520
132 Ga0105241_10006960 3300009174 Bacteria 8318
133 Ga0105241_10389705 3300009174 Bacteria 1219
134 Ga0105241_11722933 3300009174 Bacteria 609
135 Ga0105248_10779024 3300009177 Bacteria 1079
136 Ga0105248_11076539 3300009177 Bacteria 908
137 Ga0105237_10002519 3300009545 Bacteria 22690
138 Ga0105237_10370727 3300009545 Unclassified 1436
139 Ga0105238_10001440 3300009551 Bacteria 23914
140 Ga0105238_10805606 3300009551 Unclassified 955
141 Ga0105249_10279354 3300009553 Bacteria 1667
142 Ga0105249_10397630 3300009553 Bacteria 1407
143 Ga0105249_10933337 3300009553 Bacteria 935
144 Ga0105239_10010542 3300010375 Bacteria 10333
145 Ga0157373_10000547 3300013100 Bacteria 29443
146 Ga0157373_10566395 3300013100 Bacteria 825
147 Ga0157373_11522231 3300013100 Bacteria 511
148 Ga0157370_10078146 3300013104 Bacteria 3116
149 Ga0157369_10003538 3300013105 Bacteria 18565
150 Ga0157369_10263507 3300013105 Bacteria 1797
151 Ga0157378_10203117 3300013297 Bacteria 1875
152 Ga0163162_10023584 3300013306 Bacteria 6075
153 Ga0157372_10009996 3300013307 Bacteria 10091
154 Ga0157372_10688310 3300013307 Unclassified 1190
155 Ga0157372_10706126 3300013307 Bacteria 1173
156 Ga0157372_11253868 3300013307 Bacteria 856
157 Ga0157375_11439599 3300013308 Bacteria 812
158 Ga0157375_11843479 3300013308 Bacteria 717
159 Ga0163163_12712657 3300014325 Bacteria 552
160 Ga0157380_10010503 3300014326 Bacteria 6662
161 Ga0157380_10202970 3300014326 Bacteria 1760
162 Ga0157380_10371194 3300014326 Bacteria 1347
163 Ga0157380_10751674 3300014326 Bacteria 986
164 Ga0157377_11531792 3300014745 Bacteria 531
165 Ga0157379_10006014 3300014968 Bacteria 10463
166 Ga0157379_10006473 3300014968 Bacteria 10095
167 Ga0157379_10050566 3300014968 Bacteria 3711
168 Ga0157379_10493590 3300014968 Bacteria 1134
169 Ga0207682_10183387 3300025893 Bacteria 957
170 Ga0207682_10239944 3300025893 Bacteria 842
171 Ga0207710_10099184 3300025900 Bacteria 1372
172 Ga0207699_10000462 3300025906 Bacteria 20729
173 Ga0207699_10122796 3300025906 Bacteria 1682
174 Ga0207645_10030432 3300025907 Bacteria 3478
175 Ga0207645_10546636 3300025907 Bacteria 785
176 Ga0207705_10059843 3300025909 Bacteria 2750
177 Ga0207654_10033210 3300025911 Bacteria 2859
178 Ga0207707_10019799 3300025912 Bacteria 5875
179 Ga0207707_10024755 3300025912 Bacteria 5251
180 Ga0207707_10379490 3300025912 Bacteria 1215
181 Ga0207695_10006695 3300025913 Bacteria 14864
182 Ga0207671_10236644 3300025914 Bacteria 1434
183 Ga0207693_10000099 3300025915 Bacteria 77197
184 Ga0207663_10840690 3300025916 Bacteria 732
185 Ga0207660_10559556 3300025917 Bacteria 930
186 Ga0207660_10587046 3300025917 Bacteria 907
187 Ga0207657_10184782 3300025919 Unclassified 1684
188 Ga0207657_10195728 3300025919 Unclassified 1628
189 Ga0207649_11459339 3300025920 Unclassified 541
190 Ga0207652_10006632 3300025921 Bacteria 9325
191 Ga0207652_10017888 3300025921 Bacteria 5808
192 Ga0207652_11099218 3300025921 Unclassified 695
193 Ga0207646_11546758 3300025922 Bacteria 573
194 Ga0207681_10206441 3300025923 Bacteria 1511
195 Ga0207650_10828422 3300025925 Bacteria 785
196 Ga0207687_10102392 3300025927 Bacteria 2109
197 Ga0207700_10000015 3300025928 Bacteria 224772
198 Ga0207700_10060694 3300025928 Bacteria 2865
199 Ga0207664_10106961 3300025929 Bacteria 2320
200 Ga0207690_10171902 3300025932 Unclassified 1624
201 Ga0207706_10396576 3300025933 Bacteria 1197
202 Ga0207709_11348351 3300025935 Bacteria 590
203 Ga0207669_10046302 3300025937 Bacteria 2569
204 Ga0207669_11364870 3300025937 Bacteria 603
205 Ga0207704_10305410 3300025938 Bacteria 1221
206 Ga0207691_10039668 3300025940 Bacteria 4356
207 Ga0207667_10004523 3300025949 Bacteria 17035
208 Ga0207667_10021413 3300025949 Bacteria 7165
209 Ga0207667_11299460 3300025949 Bacteria 704
210 Ga0207668_10187930 3300025972 Bacteria 1635
211 Ga0207668_11346626 3300025972 Archaea 643
212 Ga0207640_10016906 3300025981 Bacteria 4255
213 Ga0207640_11151870 3300025981 Unclassified 688
214 Ga0207703_10098814 3300026035 Bacteria 2469
215 Ga0207703_12293159 3300026035 Bacteria 516
216 Ga0207639_10146793 3300026041 Bacteria 1971
217 Ga0207708_10024673 3300026075 Bacteria 4547
218 Ga0207708_10242706 3300026075 Bacteria 1449
219 Ga0207708_10876657 3300026075 Unclassified 776
220 Ga0207702_10000011 3300026078 Bacteria 284514
221 Ga0207702_10005646 3300026078 Bacteria 10911
222 Ga0207641_10430700 3300026088 Bacteria 1272
223 Ga0207641_10492730 3300026088 Bacteria 1189
224 Ga0207641_11217015 3300026088 Bacteria 753
225 Ga0207648_10908553 3300026089 Bacteria 823
226 Ga0207648_11142519 3300026089 Bacteria 731
227 Ga0207648_11598817 3300026089 Bacteria 613
228 Ga0207676_10489521 3300026095 Bacteria 1166
229 Ga0207674_10000004 3300026116 Bacteria 241430
230 Ga0207674_11931898 3300026116 Bacteria 556
231 Ga0207675_100731148 3300026118 Bacteria 1000
232 Ga0207675_101324947 3300026118 Bacteria 740
233 Ga0207698_10040316 3300026142 Bacteria 3468
234 Ga0209996_1075452 3300027395 Bacteria 526
235 Ga0209984_1027348 3300027424 Bacteria 799
236 Ga0209982_1006085 3300027552 Bacteria 1751
237 Ga0209970_1018564 3300027614 Bacteria 1168
238 Ga0210002_1004083 3300027617 Bacteria 2166
239 Ga0209983_1003533 3300027665 Bacteria 3327
240 Ga0209971_1111527 3300027682 Bacteria 671
241 Ga0209998_10030516 3300027717 Bacteria 1191
242 Ga0209998_10032852 3300027717 Bacteria 1155
243 Ga0209998_10054911 3300027717 Bacteria 929
244 Ga0209974_10001297 3300027876 Bacteria 8992
245 Ga0209974_10051491 3300027876 Bacteria 1385
246 Ga0207428_10000002 3300027907 Bacteria 854851
247 Ga0207428_10055520 3300027907 Bacteria 3149
248 Ga0268265_10200199 3300028380 Bacteria 1732
249 Ga0268265_10292042 3300028380 Bacteria 1464
250 Ga0268265_12284280 3300028380 Bacteria 548
251 Ga0268264_10198820 3300028381 Bacteria 1832
252 Ga0268264_11201891 3300028381 Bacteria 767
253 Ga0265319_1054272 3300028563 Bacteria 1314
254 Ga0265318_10237731 3300028577 Bacteria 665
255 Ga0265338_10159785 3300028800 Bacteria 1742
256 Ga0265338_10163209 3300028800 Bacteria 1718
257 Ga0265338_10526383 3300028800 Unclassified 830
258 Ga0265338_10953284 3300028800 Bacteria 582
259 Ga0265338_11150511 3300028800 Bacteria 521
260 Ga0265330_10095914 3300031235 Bacteria 1271
261 Ga0265330_10110169 3300031235 Bacteria 1176
262 Ga0265332_10132154 3300031238 Bacteria 1047
263 Ga0265332_10154098 3300031238 Bacteria 961
264 Ga0265332_10236675 3300031238 Bacteria 756
265 Ga0265320_10055270 3300031240 Bacteria 1911
266 Ga0265325_10000083 3300031241 Bacteria 66086
267 Ga0265325_10054651 3300031241 Bacteria 2043
268 Ga0265325_10383087 3300031241 Bacteria 618
269 Ga0265340_10000158 3300031247 Bacteria 34190
270 Ga0265340_10021953 3300031247 Bacteria 3268
271 Ga0265340_10033408 3300031247 Bacteria 2561
272 Ga0265340_10060528 3300031247 Bacteria 1813
273 Ga0265340_10355915 3300031247 Bacteria 647
274 Ga0265339_10001775 3300031249 Bacteria 15873
275 Ga0265339_10053047 3300031249 Bacteria 2206
276 Ga0265339_10334264 3300031249 Bacteria 716
277 Ga0265331_10046989 3300031250 Bacteria 2079
278 Ga0265331_10058374 3300031250 Bacteria 1827
279 Ga0265331_10512776 3300031250 Bacteria 540
280 Ga0265316_10005895 3300031344 Bacteria 11811
281 Ga0265316_10028451 3300031344 Bacteria 4611
282 Ga0265316_10042682 3300031344 Bacteria 3622
283 Ga0265316_10128116 3300031344 Bacteria 1913
284 Ga0265316_10254098 3300031344 Bacteria 1290
285 Ga0307408_100049458 3300031548 Bacteria 3020
286 Ga0265313_10000161 3300031595 Bacteria 70093
287 Ga0265313_10007112 3300031595 Bacteria 7716
288 Ga0265313_10018001 3300031595 Bacteria 3985
289 Ga0265313_10334295 3300031595 Bacteria 603
290 Ga0265314_10069582 3300031711 Bacteria 2361
291 Ga0265314_10169484 3300031711 Bacteria 1319
292 Ga0265314_10251918 3300031711 Unclassified 1013
293 Ga0265314_10321690 3300031711 Bacteria 860
294 Ga0265314_10371571 3300031711 Bacteria 781
295 Ga0265342_10053444 3300031712 Bacteria 2404
296 Ga0265342_10126988 3300031712 Bacteria 1431
297 Ga0265342_10213472 3300031712 Bacteria 1042
298 Ga0265342_10289924 3300031712 Bacteria 864
299 Ga0265342_10408904 3300031712 Bacteria 700
300 Ga0316576_10560627 3300031727 Bacteria 836
301 Ga0307516_10996305 3300031730 Unclassified 510
302 Ga0307405_10343100 3300031731 Bacteria 1149
303 Ga0307405_10971216 3300031731 Bacteria 723
304 Ga0307406_10570848 3300031901 Bacteria 928
305 Ga0307407_11150482 3300031903 Bacteria 605
306 Ga0307412_10669780 3300031911 Bacteria 887
307 Ga0307409_100041362 3300031995 Bacteria 3441
308 Ga0307409_100664821 3300031995 Bacteria 1037
309 Ga0307409_102624212 3300031995 Bacteria 532
310 Ga0307416_100058160 3300032002 Bacteria 3132
311 Ga0307416_100707472 3300032002 Bacteria 1097
312 Ga0307414_10479142 3300032004 Bacteria 1097
313 Ga0307414_11871633 3300032004 Bacteria 560
314 Ga0373928_0274246 3300035084 Bacteria 509
315 Ga0373932_0081011 3300035112 Bacteria 1025
316 Ga0373954_0201990 3300035118 Unclassified 977
317 Ga0373956_0478404 3300035119 Unclassified 594
318 Ga0373957_0099194 3300035120 Bacteria 1165
319 Ga0373957_0478186 3300035120 Unclassified 541
320 Ga0373955_0107049 3300035172 Unclassified 1613
321 Ga0316574_0973745 3300035398 Bacteria 511
322 Ga0373931_0340343 3300035691 Bacteria 936
323 Ga0373931_0724272 3300035691 Bacteria 658
324 Ga0373935_0381297 3300035692 Unclassified 1010
325 Ga0373933_0025692 3300035724 Bacteria 3379
326 Ga0373937_0023854 3300036401 Bacteria 5516
327 Ga0373937_0216076 3300036401 Bacteria 1804
328 Ga0373937_0576926 3300036401 Bacteria 1068
329 Ga0316582_0347647 3300036647 Bacteria 1020
330 Ga0316584_0062383 3300036712 Unclassified 2792
331 Ga0316584_0457646 3300036712 Bacteria 902
332 Ga0316584_1136565 3300036712 Unclassified 517
333 Ga0373925_0394337 3300037068 Unclassified 1128
334 Ga0373925_0812005 3300037068 Bacteria 771
335 Ga0400489_69221 3300039093 Bacteria 2104
336 Ga0436360_0217978 3300039438 Bacteria 2047
337 Ga0436362_0679709 3300039453 Bacteria 809
338 Ga0439439_0006247 3300041406 Bacteria 2752
339 Ga0439443_081046 3300042003 Bacteria 603
340 Ga0439445_0121157 3300042004 Bacteria 751
341 Ga0450913_007740 3300042117 Bacteria 814
342 Ga0450921_019736 3300042123 Bacteria 634
343 Ga0450890_048268 3300042127 Bacteria 644
344 Ga0450896_046234 3300042133 Bacteria 686
345 Ga0439446_0002984 3300042156 Bacteria 4141
346 Ga0439458_0046175 3300042157 Bacteria 1066
347 Ga0439434_0044116 3300042435 Bacteria 1373
348 Ga0439435_0046498 3300042436 Bacteria 1230
349 Ga0439444_0190912 3300042437 Bacteria 513
350 Ga0451577_0119458 3300042876 Bacteria 2361
351 Ga0466961_0797863 3300044693 Bacteria 564
352 Ga0466963_0203040 3300044694 Unclassified 1387
353 Ga0453684_0000101 3300044712 Bacteria 368298
354 Ga0453684_0015534 3300044712 Bacteria 12028
355 Ga0451576_1155149 3300045051 Bacteria 809
356 Ga0495651_0382884 3300046462 Bacteria 922
357 Ga0495608_0333892 3300046511 Bacteria 935
358 Ga0495630_0497422 3300046517 Bacteria 935
359 Ga0495630_1461159 3300046517 Bacteria 513
360 Ga0495586_0833249 3300046535 Bacteria 532
361 Ga0495657_0788865 3300046675 Bacteria 543
362 Ga0495623_0292446 3300046679 Bacteria 903
363 Ga0495647_0066430 3300046681 Bacteria 1435
364 Ga0495658_0946666 3300046683 Bacteria 550
365 Ga0495669_0001531 3300046684 Bacteria 9513
366 Ga0495636_0209885 3300047318 Unclassified 891
367 Ga0495675_0416720 3300047444 Bacteria 781
368 Ga0495602_0384148 3300048088 Bacteria 1005
369 Ga0496102_0888250 3300048905 Bacteria 813
370 Ga0496107_0430109 3300048910 Bacteria 981
371 Ga0496112_0380164 3300048915 Viruses 1353
372 Ga0496112_0931980 3300048915 Bacteria 790
373 Ga0501032_0008580 3300049569 Bacteria 7450
374 Ga0501036_0295710 3300049572 Bacteria 1354
375 Ga0501036_0493410 3300049572 Unclassified 1019
376 Ga0501038_0474386 3300049574 Bacteria 959
377 Ga0501039_0361479 3300049575 Bacteria 1140
378 Ga0501043_1302619 3300049579 Bacteria 507
379 Ga0501046_0270569 3300049580 Bacteria 1246
380 Ga0501047_0096336 3300049581 Bacteria 2837
381 Ga0501067_0058848 3300049583 Bacteria 2127
382 Ga0501068_0002967 3300049584 Bacteria 9041
383 Ga0501068_0433940 3300049584 Bacteria 849
384 Ga0501070_0814904 3300049586 Bacteria 732
385 Ga0501073_0059191 3300049589 Bacteria 2676
386 Ga0501073_0645076 3300049589 Bacteria 731
387 Ga0501073_0850565 3300049589 Bacteria 628
388 Ga0501076_1357717 3300049592 Bacteria 584
389 Ga0501077_0815264 3300049593 Bacteria 600
390 Ga0501077_0849098 3300049593 Bacteria 587
391 Ga0501083_0022338 3300049744 Bacteria 4391
392 Ga0501044_0302750 3300049823 Bacteria 1527
393 nmdc:mga00v17_675617_c1 3300050491 Bacteria 663
394 nmdc:mga05p37_1529914_c1 3300050507 Bacteria 662
395 nmdc:mga05p37_441330_c1 3300050507 Bacteria 1509
396 nmdc:mga09592_422098_c1 3300050508 Bacteria 1152
397 nmdc:mga09592_701022_c1 3300050508 Bacteria 862
398 nmdc:mga09592_788843_c1 3300050508 Unclassified 804
399 nmdc:mga0qj67_1008826_c1 3300050509 Bacteria 653
400 nmdc:mga0qj67_206446_c1 3300050509 Bacteria 1596
401 nmdc:mga0qj67_45700_c2 3300050509 Bacteria 2182
402 nmdc:mga0qj67_513599_c1 3300050509 Bacteria 963
403 nmdc:mga0qj67_828668_c1 3300050509 Bacteria 731
404 nmdc:mga06r32_116835_c1 3300050510 Unclassified 2629
405 nmdc:mga06r32_1551360_c1 3300050510 Bacteria 602
406 nmdc:mga06r32_160832_c1 3300050510 Unclassified 806
407 nmdc:mga06r32_165713_c1 3300050510 Bacteria 2193
408 nmdc:mga06r32_277314_c1 3300050510 Bacteria 1664
409 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
410 nmdc:mga08y16_736926_c1 3300050511 Bacteria 982
411 nmdc:mga0n895_15710_c1 3300050512 Bacteria 6918
412 nmdc:mga0n895_1690706_c1 3300050512 Bacteria 596
413 nmdc:mga0n895_20846_c1 3300050512 Bacteria 6122
414 nmdc:mga0n895_249489_c1 3300050512 Bacteria 1801
415 nmdc:mga0rr50_1132813_c1 3300050513 Bacteria 665
416 nmdc:mga0rr50_301924_c1 3300050513 Bacteria 1339
417 nmdc:mga0rr50_42538_c1 3300050513 Bacteria 3318
418 nmdc:mga0rr50_45079_c1 3300050513 Bacteria 3238
419 nmdc:mga08x19_250309_c1 3300050514 Bacteria 1223
420 nmdc:mga08x19_381_c1 3300050514 Bacteria 31108
421 nmdc:mga08x19_7934_c1 3300050514 Bacteria 6309
422 nmdc:mga0a205_1281397_c1 3300050515 Bacteria 581
423 Ga0495619_0067848 3300053085 Bacteria 2382
424 Ga0501082_0180560 3300060353 Bacteria 1836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10869266 Ga0065707_108692662 70
2 3300005354 Ga0070675_100067423 Ga0070675_1000674233 70
3 3300005365 Ga0070688_100873118 Ga0070688_1008731182 70
4 3300005456 Ga0070678_100551693 Ga0070678_1005516932 70
5 3300005564 Ga0070664_100396302 Ga0070664_1003963022 70
6 3300005618 Ga0068864_102664886 Ga0068864_1026648861 70
7 3300006237 Ga0097621_102208325 Ga0097621_1022083252 70
8 3300006358 Ga0068871_101239213 Ga0068871_1012392131 70
9 3300006881 Ga0068865_101045759 Ga0068865_1010457592 70
10 3300009098 Ga0105245_10502602 Ga0105245_105026022 70
11 3300009148 Ga0105243_12898384 Ga0105243_128983842 70
12 3300009177 Ga0105248_11076539 Ga0105248_110765392 70
13 3300009551 Ga0105238_10805606 Ga0105238_108056062 70
14 3300014968 Ga0157379_10493590 Ga0157379_104935902 70
15 3300005295 Ga0065707_10442474 Ga0065707_104424742 71
16 3300005328 Ga0070676_10023538 Ga0070676_100235385 71
17 3300005336 Ga0070680_100875598 Ga0070680_1008755982 71
18 3300005336 Ga0070680_100912955 Ga0070680_1009129552 71
19 3300005353 Ga0070669_100176552 Ga0070669_1001765524 71
20 3300005353 Ga0070669_100565273 Ga0070669_1005652732 71
21 3300005356 Ga0070674_100069755 Ga0070674_1000697553 71
22 3300005364 Ga0070673_102040370 Ga0070673_1020403702 71
23 3300005438 Ga0070701_10591134 Ga0070701_105911341 71
24 3300005441 Ga0070700_100347186 Ga0070700_1003471863 71
25 3300005459 Ga0068867_100062517 Ga0068867_1000625174 71
26 3300005535 Ga0070684_101188730 Ga0070684_1011887301 71
27 3300005543 Ga0070672_100234078 Ga0070672_1002340784 71
28 3300005549 Ga0070704_100681394 Ga0070704_1006813941 71
29 3300005549 Ga0070704_101406328 Ga0070704_1014063281 71
30 3300005719 Ga0068861_100763014 Ga0068861_1007630141 71
31 3300005840 Ga0068870_11444876 Ga0068870_114448762 71
32 3300006844 Ga0075428_100000003 Ga0075428_100000003311 71
33 3300006844 Ga0075428_100067914 Ga0075428_1000679144 71
34 3300006844 Ga0075428_100790923 Ga0075428_1007909233 71
35 3300006846 Ga0075430_100043221 Ga0075430_1000432212 71
36 3300006846 Ga0075430_101084522 Ga0075430_1010845222 71
37 3300006847 Ga0075431_100134557 Ga0075431_1001345571 71
38 3300006847 Ga0075431_100966697 Ga0075431_1009666972 71
39 3300006847 Ga0075431_100991690 Ga0075431_1009916902 71
40 3300006880 Ga0075429_100048500 Ga0075429_1000485003 71
41 3300006880 Ga0075429_101555391 Ga0075429_1015553912 71
42 3300006881 Ga0068865_100887235 Ga0068865_1008872352 71
43 3300009094 Ga0111539_10000001 Ga0111539_10000001567 71
44 3300009094 Ga0111539_10829262 Ga0111539_108292622 71
45 3300009147 Ga0114129_10687039 Ga0114129_106870391 71
46 3300009148 Ga0105243_11223012 Ga0105243_112230122 71
47 3300009553 Ga0105249_10397630 Ga0105249_103976303 71
48 3300009553 Ga0105249_10933337 Ga0105249_109333372 71
49 3300013308 Ga0157375_11843479 Ga0157375_118434792 71
50 3300014326 Ga0157380_10202970 Ga0157380_102029704 71
51 3300014326 Ga0157380_10371194 Ga0157380_103711942 71
52 3300014326 Ga0157380_10751674 Ga0157380_107516742 71
53 3300025893 Ga0207682_10183387 Ga0207682_101833872 71
54 3300025893 Ga0207682_10239944 Ga0207682_102399442 71
55 3300025907 Ga0207645_10030432 Ga0207645_100304326 71
56 3300025907 Ga0207645_10546636 Ga0207645_105466362 71
57 3300025917 Ga0207660_10559556 Ga0207660_105595562 71
58 3300025917 Ga0207660_10587046 Ga0207660_105870462 71
59 3300025923 Ga0207681_10206441 Ga0207681_102064412 71
60 3300025933 Ga0207706_10396576 Ga0207706_103965762 71
61 3300025937 Ga0207669_10046302 Ga0207669_100463024 71
62 3300025937 Ga0207669_11364870 Ga0207669_113648702 71
63 3300025938 Ga0207704_10305410 Ga0207704_103054102 71
64 3300025940 Ga0207691_10039668 Ga0207691_100396682 71
65 3300025972 Ga0207668_10187930 Ga0207668_101879304 71
66 3300025981 Ga0207640_11151870 Ga0207640_111518701 71
67 3300026075 Ga0207708_10024673 Ga0207708_100246735 71
68 3300026075 Ga0207708_10242706 Ga0207708_102427062 71
69 3300026075 Ga0207708_10876657 Ga0207708_108766572 71
70 3300026089 Ga0207648_10908553 Ga0207648_109085532 71
71 3300026089 Ga0207648_11598817 Ga0207648_115988172 71
72 3300026118 Ga0207675_100731148 Ga0207675_1007311482 71
73 3300026118 Ga0207675_101324947 Ga0207675_1013249471 71
74 3300027424 Ga0209984_1027348 Ga0209984_10273481 71
75 3300027552 Ga0209982_1006085 Ga0209982_10060853 71
76 3300027614 Ga0209970_1018564 Ga0209970_10185642 71
77 3300027617 Ga0210002_1004083 Ga0210002_10040832 71
78 3300027665 Ga0209983_1003533 Ga0209983_10035332 71
79 3300027682 Ga0209971_1111527 Ga0209971_11115272 71
80 3300027717 Ga0209998_10054911 Ga0209998_100549112 71
81 3300027876 Ga0209974_10001297 Ga0209974_100012976 71
82 3300027907 Ga0207428_10000002 Ga0207428_10000002579 71
83 3300028380 Ga0268265_10200199 Ga0268265_102001992 71
84 3300028380 Ga0268265_12284280 Ga0268265_122842802 71
85 3300028800 Ga0265338_10163209 Ga0265338_101632092 71
86 3300031238 Ga0265332_10132154 Ga0265332_101321541 71
87 3300031238 Ga0265332_10154098 Ga0265332_101540982 71
88 3300031241 Ga0265325_10000083 Ga0265325_1000008355 71
89 3300031247 Ga0265340_10355915 Ga0265340_103559152 71
90 3300031249 Ga0265339_10001775 Ga0265339_1000177510 71
91 3300031250 Ga0265331_10512776 Ga0265331_105127761 71
92 3300031344 Ga0265316_10005895 Ga0265316_100058952 71
93 3300031344 Ga0265316_10128116 Ga0265316_101281162 71
94 3300031595 Ga0265313_10018001 Ga0265313_100180012 71
95 3300031712 Ga0265342_10289924 Ga0265342_102899242 71
96 3300035118 Ga0373954_0201990 Ga0373954_0201990_740_955 71
97 3300042123 Ga0450921_019736 Ga0450921_019736_236_451 71
98 3300042133 Ga0450896_046234 Ga0450896_046234_230_445 71
99 3300044712 Ga0453684_0000101 Ga0453684_0000101_231516_231734 71
100 3300050507 nmdc:mga05p37_1529914_c1 nmdc:mga05p37_1529914_c1_95_310 71
101 3300050508 nmdc:mga09592_422098_c1 nmdc:mga09592_422098_c1_44_259 71
102 3300050508 nmdc:mga09592_701022_c1 nmdc:mga09592_701022_c1_376_591 71
103 3300050508 nmdc:mga09592_788843_c1 nmdc:mga09592_788843_c1_278_493 71
104 3300050509 nmdc:mga0qj67_206446_c1 nmdc:mga0qj67_206446_c1_667_882 71
105 3300050510 nmdc:mga06r32_116835_c1 nmdc:mga06r32_116835_c1_2377_2592 71
106 3300050510 nmdc:mga06r32_160832_c1 nmdc:mga06r32_160832_c1_145_360 71
107 3300050510 nmdc:mga06r32_277314_c1 nmdc:mga06r32_277314_c1_951_1166 71
108 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_619466_619681 71
109 3300050511 nmdc:mga08y16_736926_c1 nmdc:mga08y16_736926_c1_672_887 71
110 3300005338 Ga0068868_100904554 Ga0068868_1009045542 72
111 3300005347 Ga0070668_102250125 Ga0070668_1022501252 72
112 3300005353 Ga0070669_100176736 Ga0070669_1001767362 72
113 3300005444 Ga0070694_100381687 Ga0070694_1003816872 72
114 3300005459 Ga0068867_102252934 Ga0068867_1022529342 72
115 3300005543 Ga0070672_100555593 Ga0070672_1005555931 72
116 3300006871 Ga0075434_100565724 Ga0075434_1005657242 72
117 3300009094 Ga0111539_12028521 Ga0111539_120285212 72
118 3300014326 Ga0157380_10010503 Ga0157380_1001050310 72
119 3300014745 Ga0157377_11531792 Ga0157377_115317922 72
120 3300026088 Ga0207641_10492730 Ga0207641_104927302 72
121 3300026089 Ga0207648_11142519 Ga0207648_111425192 72
122 3300027395 Ga0209996_1075452 Ga0209996_10754522 72
123 3300027717 Ga0209998_10030516 Ga0209998_100305163 72
124 3300027876 Ga0209974_10051491 Ga0209974_100514912 72
125 3300031548 Ga0307408_100049458 Ga0307408_1000494582 72
126 3300031731 Ga0307405_10971216 Ga0307405_109712162 72
127 3300031901 Ga0307406_10570848 Ga0307406_105708482 72
128 3300031903 Ga0307407_11150482 Ga0307407_111504822 72
129 3300031911 Ga0307412_10669780 Ga0307412_106697802 72
130 3300031995 Ga0307409_102624212 Ga0307409_1026242122 72
131 3300032002 Ga0307416_100707472 Ga0307416_1007074722 72
132 3300036647 Ga0316582_0347647 Ga0316582_0347647_113_331 72
133 3300036712 Ga0316584_0062383 Ga0316584_0062383_1983_2201 72
134 3300036712 Ga0316584_1136565 Ga0316584_1136565_186_404 72
135 3300039093 Ga0400489_69221 Ga0400489_69221_826_1044 72
136 3300041406 Ga0439439_0006247 Ga0439439_0006247_1415_1633 72
137 3300042004 Ga0439445_0121157 Ga0439445_0121157_382_600 72
138 3300042117 Ga0450913_007740 Ga0450913_007740_449_667 72
139 3300042127 Ga0450890_048268 Ga0450890_048268_384_602 72
140 3300042156 Ga0439446_0002984 Ga0439446_0002984_3453_3671 72
141 3300042435 Ga0439434_0044116 Ga0439434_0044116_552_770 72
142 3300042437 Ga0439444_0190912 Ga0439444_0190912_151_369 72
143 3300042876 Ga0451577_0119458 Ga0451577_0119458_1884_2102 72
144 3300046684 Ga0495669_0001531 Ga0495669_0001531_1705_1923 72
145 3300050509 nmdc:mga0qj67_1008826_c1 nmdc:mga0qj67_1008826_c1_69_287 72
146 3300050512 nmdc:mga0n895_249489_c1 nmdc:mga0n895_249489_c1_214_432 72
147 3300050515 nmdc:mga0a205_1281397_c1 nmdc:mga0a205_1281397_c1_203_421 72
148 3300005530 Ga0070679_101237510 Ga0070679_1012375101 73
149 3300005546 Ga0070696_101332276 Ga0070696_1013322762 73
150 3300005577 Ga0068857_101439659 Ga0068857_1014396592 73
151 3300005843 Ga0068860_100236038 Ga0068860_1002360382 73
152 3300006844 Ga0075428_100068227 Ga0075428_1000682273 73
153 3300006846 Ga0075430_101445236 Ga0075430_1014452362 73
154 3300006847 Ga0075431_100504234 Ga0075431_1005042342 73
155 3300006852 Ga0075433_10008427 Ga0075433_1000842710 73
156 3300006871 Ga0075434_100012298 Ga0075434_1000122983 73
157 3300006880 Ga0075429_100434661 Ga0075429_1004346613 73
158 3300007076 Ga0075435_100223388 Ga0075435_1002233881 73
159 3300009101 Ga0105247_10068312 Ga0105247_100683121 73
160 3300009147 Ga0114129_10441182 Ga0114129_104411823 73
161 3300009177 Ga0105248_10779024 Ga0105248_107790242 73
162 3300014968 Ga0157379_10006014 Ga0157379_100060143 73
163 3300025900 Ga0207710_10099184 Ga0207710_100991842 73
164 3300026035 Ga0207703_10098814 Ga0207703_100988143 73
165 3300026116 Ga0207674_11931898 Ga0207674_119318982 73
166 3300027907 Ga0207428_10055520 Ga0207428_100555202 73
167 3300028381 Ga0268264_10198820 Ga0268264_101988202 73
168 3300039438 Ga0436360_0217978 Ga0436360_0217978_576_803 73
169 3300046517 Ga0495630_1461159 Ga0495630_1461159_76_297 73
170 3300046681 Ga0495647_0066430 Ga0495647_0066430_159_410 73
171 3300046683 Ga0495658_0946666 Ga0495658_0946666_178_399 73
172 3300048915 Ga0496112_0931980 Ga0496112_0931980_344_565 73
173 3300049584 Ga0501068_0433940 Ga0501068_0433940_49_270 73
174 3300050509 nmdc:mga0qj67_828668_c1 nmdc:mga0qj67_828668_c1_203_424 73
175 3300050512 nmdc:mga0n895_15710_c1 nmdc:mga0n895_15710_c1_469_690 73
176 3300050513 nmdc:mga0rr50_301924_c1 nmdc:mga0rr50_301924_c1_253_474 73
177 3300005436 Ga0070713_100077226 Ga0070713_1000772262 74
178 3300005563 Ga0068855_100531413 Ga0068855_1005314133 74
179 3300005981 Ga0081538_10011477 Ga0081538_100114772 74
180 3300005985 Ga0081539_10020919 Ga0081539_100209193 74
181 3300025919 Ga0207657_10195728 Ga0207657_101957283 74
182 3300025928 Ga0207700_10060694 Ga0207700_100606943 74
183 3300031712 Ga0265342_10126988 Ga0265342_101269882 74
184 3300031727 Ga0316576_10560627 Ga0316576_105606272 74
185 3300031731 Ga0307405_10343100 Ga0307405_103431002 74
186 3300031995 Ga0307409_100041362 Ga0307409_1000413623 74
187 3300031995 Ga0307409_100664821 Ga0307409_1006648212 74
188 3300032002 Ga0307416_100058160 Ga0307416_1000581602 74
189 3300032004 Ga0307414_10479142 Ga0307414_104791422 74
190 3300032004 Ga0307414_11871633 Ga0307414_118716332 74
191 3300035398 Ga0316574_0973745 Ga0316574_0973745_200_424 74
192 3300036712 Ga0316584_0457646 Ga0316584_0457646_453_677 74
193 3300042003 Ga0439443_081046 Ga0439443_081046_192_422 74
194 3300042157 Ga0439458_0046175 Ga0439458_0046175_542_772 74
195 3300042436 Ga0439435_0046498 Ga0439435_0046498_246_470 74
196 3300044694 Ga0466963_0203040 Ga0466963_0203040_712_936 74
197 3300049592 Ga0501076_1357717 Ga0501076_1357717_89_313 74
198 3300005327 Ga0070658_10114041 Ga0070658_101140411 75
199 3300005339 Ga0070660_100187617 Ga0070660_1001876173 75
200 3300005339 Ga0070660_100204534 Ga0070660_1002045342 75
201 3300005341 Ga0070691_10157918 Ga0070691_101579183 75
202 3300005366 Ga0070659_100100362 Ga0070659_1001003622 75
203 3300005458 Ga0070681_10018800 Ga0070681_100188005 75
204 3300005458 Ga0070681_10042791 Ga0070681_100427916 75
205 3300005530 Ga0070679_100032184 Ga0070679_1000321846 75
206 3300005530 Ga0070679_100047438 Ga0070679_1000474385 75
207 3300005535 Ga0070684_101315333 Ga0070684_1013153332 75
208 3300005563 Ga0068855_100030199 Ga0068855_1000301995 75
209 3300009093 Ga0105240_10387068 Ga0105240_103870683 75
210 3300009545 Ga0105237_10370727 Ga0105237_103707272 75
211 3300013105 Ga0157369_10263507 Ga0157369_102635072 75
212 3300013307 Ga0157372_10688310 Ga0157372_106883101 75
213 3300013307 Ga0157372_10706126 Ga0157372_107061262 75
214 3300025909 Ga0207705_10059843 Ga0207705_100598432 75
215 3300025912 Ga0207707_10019799 Ga0207707_100197996 75
216 3300025912 Ga0207707_10024755 Ga0207707_100247554 75
217 3300025919 Ga0207657_10184782 Ga0207657_101847823 75
218 3300025920 Ga0207649_11459339 Ga0207649_114593391 75
219 3300025921 Ga0207652_10017888 Ga0207652_100178885 75
220 3300025921 Ga0207652_11099218 Ga0207652_110992181 75
221 3300025932 Ga0207690_10171902 Ga0207690_101719024 75
222 3300025949 Ga0207667_10021413 Ga0207667_100214135 75
223 3300028800 Ga0265338_10953284 Ga0265338_109532842 75
224 3300031235 Ga0265330_10110169 Ga0265330_101101692 75
225 3300031247 Ga0265340_10000158 Ga0265340_100001589 75
226 3300031344 Ga0265316_10028451 Ga0265316_100284514 75
227 3300035120 Ga0373957_0099194 Ga0373957_0099194_389_616 75
228 3300036401 Ga0373937_0023854 Ga0373937_0023854_628_855 75
229 3300037068 Ga0373925_0812005 Ga0373925_0812005_176_403 75
230 3300045051 Ga0451576_1155149 Ga0451576_1155149_428_655 75
231 3300046675 Ga0495657_0788865 Ga0495657_0788865_45_272 75
232 3300047318 Ga0495636_0209885 Ga0495636_0209885_618_845 75
233 3300047444 Ga0495675_0416720 Ga0495675_0416720_339_566 75
234 3300048088 Ga0495602_0384148 Ga0495602_0384148_445_672 75
235 3300048915 Ga0496112_0380164 Ga0496112_0380164_1000_1227 75
236 3300049579 Ga0501043_1302619 Ga0501043_1302619_43_270 75
237 3300049589 Ga0501073_0850565 Ga0501073_0850565_302_529 75
238 3300049593 Ga0501077_0849098 Ga0501077_0849098_307_534 75
239 3300053085 Ga0495619_0067848 Ga0495619_0067848_1796_2023 75
240 3300005328 Ga0070676_11521100 Ga0070676_115211002 76
241 3300006844 Ga0075428_100028540 Ga0075428_1000285402 76
242 3300006846 Ga0075430_100470103 Ga0075430_1004701032 76
243 3300006871 Ga0075434_100813896 Ga0075434_1008138963 76
244 3300006914 Ga0075436_101259552 Ga0075436_1012595522 76
245 3300009147 Ga0114129_11504145 Ga0114129_115041452 76
246 3300013307 Ga0157372_11253868 Ga0157372_112538682 76
247 3300031235 Ga0265330_10095914 Ga0265330_100959143 76
248 3300031247 Ga0265340_10021953 Ga0265340_100219535 76
249 3300031249 Ga0265339_10334264 Ga0265339_103342642 76
250 3300031250 Ga0265331_10046989 Ga0265331_100469893 76
251 3300031344 Ga0265316_10042682 Ga0265316_100426824 76
252 3300031595 Ga0265313_10007112 Ga0265313_100071122 76
253 3300031712 Ga0265342_10213472 Ga0265342_102134722 76
254 3300044693 Ga0466961_0797863 Ga0466961_0797863_305_535 76
255 3300049569 Ga0501032_0008580 Ga0501032_0008580_5188_5418 76
256 3300049572 Ga0501036_0295710 Ga0501036_0295710_332_562 76
257 3300049574 Ga0501038_0474386 Ga0501038_0474386_470_700 76
258 3300049575 Ga0501039_0361479 Ga0501039_0361479_684_914 76
259 3300049580 Ga0501046_0270569 Ga0501046_0270569_996_1226 76
260 3300049581 Ga0501047_0096336 Ga0501047_0096336_1768_1998 76
261 3300049583 Ga0501067_0058848 Ga0501067_0058848_1469_1699 76
262 3300049584 Ga0501068_0002967 Ga0501068_0002967_8660_8890 76
263 3300049586 Ga0501070_0814904 Ga0501070_0814904_169_399 76
264 3300049589 Ga0501073_0059191 Ga0501073_0059191_1116_1346 76
265 3300049593 Ga0501077_0815264 Ga0501077_0815264_260_490 76
266 3300049744 Ga0501083_0022338 Ga0501083_0022338_3281_3511 76
267 3300049823 Ga0501044_0302750 Ga0501044_0302750_69_299 76
268 3300050509 nmdc:mga0qj67_513599_c1 nmdc:mga0qj67_513599_c1_667_897 76
269 3300050510 nmdc:mga06r32_1551360_c1 nmdc:mga06r32_1551360_c1_347_577 76
270 3300050512 nmdc:mga0n895_1690706_c1 nmdc:mga0n895_1690706_c1_279_509 76
271 3300050513 nmdc:mga0rr50_45079_c1 nmdc:mga0rr50_45079_c1_1855_2085 76
272 3300050514 nmdc:mga08x19_250309_c1 nmdc:mga08x19_250309_c1_782_1012 76
273 3300060353 Ga0501082_0180560 Ga0501082_0180560_522_752 76
274 3300031711 Ga0265314_10251918 Ga0265314_102519181 77
275 3300039453 Ga0436362_0679709 Ga0436362_0679709_121_354 77
276 3300028381 Ga0268264_11201891 Ga0268264_112018912 78
277 3300028800 Ga0265338_11150511 Ga0265338_111505112 78
278 3300031241 Ga0265325_10383087 Ga0265325_103830872 78
279 3300031344 Ga0265316_10128116 Ga0265316_101281165 78
280 3300031344 Ga0265316_10254098 Ga0265316_102540982 78
281 3300031711 Ga0265314_10069582 Ga0265314_100695822 78
282 3300031711 Ga0265314_10169484 Ga0265314_101694843 78
283 3300031712 Ga0265342_10408904 Ga0265342_104089042 78
284 3300025921 Ga0207652_10006632 Ga0207652_100066323 79
285 3300027717 Ga0209998_10032852 Ga0209998_100328522 79
286 3300028563 Ga0265319_1054272 Ga0265319_10542722 79
287 3300028800 Ga0265338_10526383 Ga0265338_105263832 79
288 3300031240 Ga0265320_10055270 Ga0265320_100552702 79
289 3300031250 Ga0265331_10058374 Ga0265331_100583743 79
290 3300031595 Ga0265313_10000161 Ga0265313_1000016111 79
291 3300036401 Ga0373937_0576926 Ga0373937_0576926_726_968 79
292 3300046462 Ga0495651_0382884 Ga0495651_0382884_53_295 79
293 3300046511 Ga0495608_0333892 Ga0495608_0333892_195_437 79
294 3300046517 Ga0495630_0497422 Ga0495630_0497422_43_285 79
295 3300049572 Ga0501036_0493410 Ga0501036_0493410_647_886 79
296 3300049589 Ga0501073_0645076 Ga0501073_0645076_33_272 79
297 3300009553 Ga0105249_10279354 Ga0105249_102793542 80
298 3300031247 Ga0265340_10033408 Ga0265340_100334082 80
299 3300046535 Ga0495586_0833249 Ga0495586_0833249_100_342 80
300 3300005843 Ga0068860_100845392 Ga0068860_1008453922 81
301 3300028577 Ga0265318_10237731 Ga0265318_102377312 81
302 3300028800 Ga0265338_10159785 Ga0265338_101597853 81
303 3300031238 Ga0265332_10236675 Ga0265332_102366752 81
304 3300031241 Ga0265325_10054651 Ga0265325_100546513 81
305 3300031247 Ga0265340_10060528 Ga0265340_100605282 81
306 3300031249 Ga0265339_10053047 Ga0265339_100530474 81
307 3300031595 Ga0265313_10334295 Ga0265313_103342952 81
308 3300031711 Ga0265314_10321690 Ga0265314_103216901 81
309 3300031711 Ga0265314_10371571 Ga0265314_103715712 81
310 3300031712 Ga0265342_10053444 Ga0265342_100534442 81
311 3300035119 Ga0373956_0478404 Ga0373956_0478404_121_366 81
312 3300035120 Ga0373957_0478186 Ga0373957_0478186_185_430 81
313 3300035172 Ga0373955_0107049 Ga0373955_0107049_296_541 81
314 3300035724 Ga0373933_0025692 Ga0373933_0025692_2853_3098 81
315 3300036401 Ga0373937_0216076 Ga0373937_0216076_1176_1421 81
316 3300044712 Ga0453684_0015534 Ga0453684_0015534_6524_6775 81
317 3300046679 Ga0495623_0292446 Ga0495623_0292446_282_527 81
318 3300005293 Ga0065715_10805110 Ga0065715_108051102 82
319 3300005329 Ga0070683_100670494 Ga0070683_1006704941 82
320 3300005341 Ga0070691_10001156 Ga0070691_100011563 82
321 3300005347 Ga0070668_100029505 Ga0070668_1000295051 82
322 3300005434 Ga0070709_10000184 Ga0070709_1000018439 82
323 3300005434 Ga0070709_10073149 Ga0070709_100731494 82
324 3300005435 Ga0070714_100020356 Ga0070714_1000203563 82
325 3300005436 Ga0070713_100000001 Ga0070713_100000001247 82
326 3300005445 Ga0070708_100617234 Ga0070708_1006172342 82
327 3300005458 Ga0070681_10419399 Ga0070681_104193991 82
328 3300005467 Ga0070706_100993442 Ga0070706_1009934423 82
329 3300005539 Ga0068853_100022645 Ga0068853_1000226453 82
330 3300005545 Ga0070695_100006278 Ga0070695_1000062789 82
331 3300005546 Ga0070696_101029055 Ga0070696_1010290552 82
332 3300005547 Ga0070693_100039396 Ga0070693_1000393963 82
333 3300005548 Ga0070665_101706336 Ga0070665_1017063362 82
334 3300005563 Ga0068855_100014497 Ga0068855_1000144974 82
335 3300005563 Ga0068855_102273942 Ga0068855_1022739422 82
336 3300005564 Ga0070664_100193204 Ga0070664_1001932045 82
337 3300005577 Ga0068857_100000821 Ga0068857_10000082112 82
338 3300005578 Ga0068854_100029197 Ga0068854_1000291975 82
339 3300005614 Ga0068856_100000182 Ga0068856_1000001827 82
340 3300005614 Ga0068856_100003034 Ga0068856_10000303411 82
341 3300005616 Ga0068852_100000764 Ga0068852_1000007644 82
342 3300005618 Ga0068864_100436621 Ga0068864_1004366213 82
343 3300005841 Ga0068863_100385075 Ga0068863_1003850752 82
344 3300005841 Ga0068863_102355949 Ga0068863_1023559492 82
345 3300005842 Ga0068858_101545252 Ga0068858_1015452522 82
346 3300005844 Ga0068862_100113306 Ga0068862_1001133063 82
347 3300005985 Ga0081539_10000164 Ga0081539_100001647 82
348 3300005985 Ga0081539_10038911 Ga0081539_100389114 82
349 3300006173 Ga0070716_100378666 Ga0070716_1003786661 82
350 3300006175 Ga0070712_100000026 Ga0070712_10000002616 82
351 3300006237 Ga0097621_100357152 Ga0097621_1003571522 82
352 3300006358 Ga0068871_100759497 Ga0068871_1007594972 82
353 3300006358 Ga0068871_101300274 Ga0068871_1013002742 82
354 3300006846 Ga0075430_100037157 Ga0075430_1000371575 82
355 3300006847 Ga0075431_100025474 Ga0075431_1000254747 82
356 3300006871 Ga0075434_100618685 Ga0075434_1006186852 82
357 3300006880 Ga0075429_101490162 Ga0075429_1014901622 82
358 3300006914 Ga0075436_100000553 Ga0075436_10000055326 82
359 3300009093 Ga0105240_10008019 Ga0105240_1000801910 82
360 3300009147 Ga0114129_10121171 Ga0114129_101211713 82
361 3300009148 Ga0105243_10977894 Ga0105243_109778942 82
362 3300009174 Ga0105241_10006960 Ga0105241_100069604 82
363 3300009174 Ga0105241_10389705 Ga0105241_103897052 82
364 3300009174 Ga0105241_11722933 Ga0105241_117229332 82
365 3300009545 Ga0105237_10002519 Ga0105237_1000251922 82
366 3300009551 Ga0105238_10001440 Ga0105238_1000144016 82
367 3300010375 Ga0105239_10010542 Ga0105239_100105424 82
368 3300013100 Ga0157373_10000547 Ga0157373_1000054727 82
369 3300013100 Ga0157373_10566395 Ga0157373_105663952 82
370 3300013100 Ga0157373_11522231 Ga0157373_115222311 82
371 3300013104 Ga0157370_10078146 Ga0157370_100781464 82
372 3300013105 Ga0157369_10003538 Ga0157369_1000353810 82
373 3300013297 Ga0157378_10203117 Ga0157378_102031173 82
374 3300013306 Ga0163162_10023584 Ga0163162_100235848 82
375 3300013307 Ga0157372_10009996 Ga0157372_100099962 82
376 3300013308 Ga0157375_11439599 Ga0157375_114395992 82
377 3300014325 Ga0163163_12712657 Ga0163163_127126572 82
378 3300014968 Ga0157379_10006473 Ga0157379_100064735 82
379 3300014968 Ga0157379_10050566 Ga0157379_100505662 82
380 3300025906 Ga0207699_10000462 Ga0207699_1000046213 82
381 3300025906 Ga0207699_10122796 Ga0207699_101227962 82
382 3300025911 Ga0207654_10033210 Ga0207654_100332102 82
383 3300025912 Ga0207707_10379490 Ga0207707_103794903 82
384 3300025913 Ga0207695_10006695 Ga0207695_1000669511 82
385 3300025914 Ga0207671_10236644 Ga0207671_102366442 82
386 3300025915 Ga0207693_10000099 Ga0207693_1000009964 82
387 3300025916 Ga0207663_10840690 Ga0207663_108406902 82
388 3300025922 Ga0207646_11546758 Ga0207646_115467581 82
389 3300025925 Ga0207650_10828422 Ga0207650_108284222 82
390 3300025927 Ga0207687_10102392 Ga0207687_101023922 82
391 3300025928 Ga0207700_10000015 Ga0207700_1000001519 82
392 3300025929 Ga0207664_10106961 Ga0207664_101069613 82
393 3300025935 Ga0207709_11348351 Ga0207709_113483512 82
394 3300025949 Ga0207667_10004523 Ga0207667_100045235 82
395 3300025949 Ga0207667_11299460 Ga0207667_112994602 82
396 3300025972 Ga0207668_11346626 Ga0207668_113466261 82
397 3300025981 Ga0207640_10016906 Ga0207640_100169064 82
398 3300026035 Ga0207703_12293159 Ga0207703_122931592 82
399 3300026041 Ga0207639_10146793 Ga0207639_101467933 82
400 3300026078 Ga0207702_10000011 Ga0207702_1000001114 82
401 3300026078 Ga0207702_10005646 Ga0207702_100056462 82
402 3300026088 Ga0207641_10430700 Ga0207641_104307001 82
403 3300026088 Ga0207641_11217015 Ga0207641_112170152 82
404 3300026095 Ga0207676_10489521 Ga0207676_104895213 82
405 3300026116 Ga0207674_10000004 Ga0207674_10000004159 82
406 3300026142 Ga0207698_10040316 Ga0207698_100403164 82
407 3300028380 Ga0268265_10292042 Ga0268265_102920422 82
408 3300031730 Ga0307516_10996305 Ga0307516_109963051 82
409 3300035084 Ga0373928_0274246 Ga0373928_0274246_38_286 82
410 3300035112 Ga0373932_0081011 Ga0373932_0081011_488_736 82
411 3300035691 Ga0373931_0340343 Ga0373931_0340343_281_529 82
412 3300035691 Ga0373931_0724272 Ga0373931_0724272_327_590 82
413 3300035692 Ga0373935_0381297 Ga0373935_0381297_702_950 82
414 3300037068 Ga0373925_0394337 Ga0373925_0394337_219_467 82
415 3300048905 Ga0496102_0888250 Ga0496102_0888250_52_300 82
416 3300048910 Ga0496107_0430109 Ga0496107_0430109_680_928 82
417 3300050491 nmdc:mga00v17_675617_c1 nmdc:mga00v17_675617_c1_189_440 82
418 3300050507 nmdc:mga05p37_441330_c1 nmdc:mga05p37_441330_c1_453_704 82
419 3300050509 nmdc:mga0qj67_45700_c2 nmdc:mga0qj67_45700_c2_1219_1470 82
420 3300050510 nmdc:mga06r32_165713_c1 nmdc:mga06r32_165713_c1_767_1018 82
421 3300050512 nmdc:mga0n895_20846_c1 nmdc:mga0n895_20846_c1_337_585 82
422 3300050513 nmdc:mga0rr50_1132813_c1 nmdc:mga0rr50_1132813_c1_306_569 82
423 3300050513 nmdc:mga0rr50_42538_c1 nmdc:mga0rr50_42538_c1_2186_2434 82
424 3300050514 nmdc:mga08x19_381_c1 nmdc:mga08x19_381_c1_7952_8200 82
425 3300050514 nmdc:mga08x19_7934_c1 nmdc:mga08x19_7934_c1_5314_5577 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9465 7 61
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9456 5 66
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.9372 3 64
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9346 7 57
1utx-assembly1.cif.gz_B regulation of cytolysin expression by enterococcus faecalis: role of cylr2 0.9273 3 68
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9465 7 61 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9373 7 61 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9346 7 57 1.10.260.40
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9257 8 59 1.10.260.40
3omtB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9205 7 65 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A2M8WQ62-F1-model_v4 Xre family transcriptional regulator 0.9924 3 64 GO:0003677
AF-A0A7X6U6X3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9896 2 64 GO:0003677
AF-A0A412LL25-F1-model_v4 Transcriptional regulator 0.9892 3 66 GO:0003677
AF-A0A328UAV5-F1-model_v4 Transcriptional regulator 0.9858 3 66 GO:0003677
AF-A0A1H9FDC5-F1-model_v4 Putative transcriptional regulator 0.9849 2 64 GO:0003677

Feature Viewer

pLDDT pTM Quality
78.98 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map