F440922

General Info

Members Datasets Scaffolds Average Seq Length
425 212 413 255

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100005342|Ga0070659_1000053422
Length 243
Sequence MNGNNYVIEVNDLVKRYGDFTAVNGISFNVSCGEIFGLLGPNGAGKTTTLEIIETLRDKTSGSVKVLGYDVSKDADQIKKRIGVQLQAAGYYPALTLIELLDLFIGLYNVRTDKAKAKYKTLSGGQKQRFSICTTLIHQPDIVFLDEPTTGLDPQARRNLWDLIREIKAQGTTVVITTHYMDEAEYLCERVGIMEKGQIVAMNSPAQLIDNLLDSGFTPQRRVKEATLEDVFLNLTGQEWRDE

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0.24
Isolates 2.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 0
Rhizoplane 1.18
Rhizosphere 83.06
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000417 3300001990 Bacteria 14567
2 JGI24737J22298_10045543 3300001990 Bacteria 1340
3 JGI24735J21928_10000009 3300002067 Bacteria 247425
4 JGI24735J21928_10000036 3300002067 Bacteria 65596
5 JGI24744J21845_10010452 3300002077 Bacteria 1901
6 JGI24744J21845_10044030 3300002077 Bacteria 831
7 JGI25162J39368_1000039 3300002737 Bacteria 175976
8 JGI25162J39368_1001763 3300002737 Bacteria 10299
9 JGI25157J39369_1010248 3300002741 Bacteria 1239
10 JGI25164J39214_1006176 3300002772 Bacteria 1268
11 JGI25150J39212_1000014 3300002774 Bacteria 170955
12 JGI25151J46595_10000042 3300003187 Bacteria 170955
13 JGI25165J46597_1001210 3300003214 Bacteria 15558
14 JGI25153J46596_10000009 3300003215 Bacteria 340925
15 rootH1_10104634 3300003316 Bacteria 1253
16 rootH2_10006136 3300003320 Bacteria 3007
17 rootH2_10012931 3300003320 Bacteria 16278
18 rootH2_10016648 3300003320 Bacteria 6385
19 rootL2_10006283 3300003322 Bacteria 1308
20 rootL2_10021764 3300003322 Bacteria 4402
21 rootH1_10015584 3300003323 Bacteria 15010
22 rootH1_10092206 3300003323 Bacteria 6162
23 rootH1_10185113 3300003323 Bacteria 1851
24 JGI25160J50197_1012173 3300003354 Bacteria 3005
25 Ga0058862_12860242 3300004803 Bacteria 1381
26 Ga0065714_10126855 3300005288 Bacteria 1287
27 Ga0065714_10133279 3300005288 Bacteria 1214
28 Ga0070658_10000041 3300005327 Bacteria 134208
29 Ga0070676_10004846 3300005328 Bacteria 7121
30 Ga0070683_100251701 3300005329 Bacteria 1680
31 Ga0070690_100020035 3300005330 Bacteria 4071
32 Ga0070670_100087129 3300005331 Unclassified 2683
33 Ga0070670_100094325 3300005331 Bacteria 2574
34 Ga0068869_100024637 3300005334 Bacteria 4169
35 Ga0070666_10000192 3300005335 Bacteria 41657
36 Ga0070666_10130020 3300005335 Bacteria 1749
37 Ga0070680_100018619 3300005336 Bacteria 5490
38 Ga0068868_100000091 3300005338 Bacteria 55405
39 Ga0068868_100475205 3300005338 Bacteria 1091
40 Ga0070668_100000043 3300005347 Bacteria 78564
41 Ga0070675_100164321 3300005354 Bacteria 1911
42 Ga0070671_100014392 3300005355 Bacteria 6392
43 Ga0070671_100116527 3300005355 Bacteria 2246
44 Ga0070674_100066456 3300005356 Bacteria 2534
45 Ga0070674_100362212 3300005356 Bacteria 1174
46 Ga0070673_100006626 3300005364 Bacteria 7544
47 Ga0070673_100019605 3300005364 Bacteria 4858
48 Ga0070673_100254000 3300005364 Bacteria 1533
49 Ga0070688_100007899 3300005365 Bacteria 5751
50 Ga0070659_100000094 3300005366 Bacteria 66823
51 Ga0070659_100005342 3300005366 Bacteria 9217
52 Ga0070667_100000086 3300005367 Bacteria 114861
53 Ga0070678_100018717 3300005456 Bacteria 4495
54 Ga0070678_100186837 3300005456 Bacteria 1701
55 Ga0070662_100004021 3300005457 Bacteria 9226
56 Ga0070662_100014656 3300005457 Bacteria 5240
57 Ga0070662_100302139 3300005457 Bacteria 1301
58 Ga0070681_10000745 3300005458 Bacteria 27011
59 Ga0070681_10209776 3300005458 Unclassified 1864
60 Ga0068867_100006741 3300005459 Bacteria 8120
61 Ga0068867_100165928 3300005459 Bacteria 1745
62 Ga0068867_100235086 3300005459 Bacteria 1483
63 Ga0070679_100000522 3300005530 Bacteria 32678
64 Ga0070679_100016279 3300005530 Bacteria 7166
65 Ga0070684_100388363 3300005535 Bacteria 1286
66 Ga0068853_100006204 3300005539 Bacteria 9466
67 Ga0068853_100019354 3300005539 Bacteria 5644
68 Ga0068853_100111147 3300005539 Bacteria 2434
69 Ga0070672_100000160 3300005543 Bacteria 37362
70 Ga0070665_100000147 3300005548 Bacteria 129683
71 Ga0070665_100000350 3300005548 Bacteria 69455
72 Ga0070665_100418149 3300005548 Unclassified 1349
73 Ga0068855_100000009 3300005563 Bacteria 246035
74 Ga0068855_100015925 3300005563 Bacteria 9046
75 Ga0068855_100017030 3300005563 Bacteria 8742
76 Ga0068855_100032435 3300005563 Bacteria 6237
77 Ga0068855_100051232 3300005563 Bacteria 4863
78 Ga0068855_100077278 3300005563 Bacteria 3862
79 Ga0068855_100082742 3300005563 Bacteria 3720
80 Ga0068855_100109555 3300005563 Bacteria 3171
81 Ga0068855_100571381 3300005563 Bacteria 1222
82 Ga0068855_100688325 3300005563 Bacteria 1095
83 Ga0068854_100132561 3300005578 Bacteria 1904
84 Ga0068856_100001199 3300005614 Bacteria 27292
85 Ga0068856_100074635 3300005614 Bacteria 3358
86 Ga0068852_100107272 3300005616 Bacteria 2533
87 Ga0068852_100162363 3300005616 Bacteria 2087
88 Ga0068852_100189607 3300005616 Bacteria 1939
89 Ga0068852_100289317 3300005616 Bacteria 1582
90 Ga0068859_100663568 3300005617 Bacteria 1134
91 Ga0068864_100002177 3300005618 Bacteria 16181
92 Ga0068861_100025193 3300005719 Bacteria 4312
93 Ga0068851_10000487 3300005834 Bacteria 17401
94 Ga0068863_100002653 3300005841 Bacteria 17694
95 Ga0068863_100099349 3300005841 Bacteria 2765
96 Ga0068858_100000662 3300005842 Bacteria 35985
97 Ga0068860_100031205 3300005843 Bacteria 5123
98 Ga0068860_100036681 3300005843 Bacteria 4695
99 Ga0068860_100043527 3300005843 Bacteria 4283
100 Ga0075366_10000199 3300006195 Bacteria 26493
101 Ga0075366_10000458 3300006195 Bacteria 18985
102 Ga0075366_10010964 3300006195 Bacteria 5102
103 Ga0075366_10158525 3300006195 Bacteria 1371
104 Ga0097621_100000390 3300006237 Bacteria 30528
105 Ga0097621_100000695 3300006237 Bacteria 23615
106 Ga0097621_100002307 3300006237 Bacteria 13071
107 Ga0075370_10157698 3300006353 Bacteria 1331
108 Ga0068871_100000091 3300006358 Bacteria 52582
109 Ga0068871_100002236 3300006358 Bacteria 13149
110 Ga0068871_100006651 3300006358 Bacteria 8199
111 Ga0068865_100000552 3300006881 Bacteria 20801
112 Ga0068865_100003134 3300006881 Bacteria 9893
113 Ga0068865_100217174 3300006881 Bacteria 1493
114 Ga0097620_100663647 3300006931 Bacteria 1134
115 Ga0105240_10000858 3300009093 Bacteria 54783
116 Ga0105240_10007945 3300009093 Bacteria 15307
117 Ga0105240_10010208 3300009093 Bacteria 13217
118 Ga0105240_10051892 3300009093 Bacteria 5158
119 Ga0105240_10052915 3300009093 Bacteria 5101
120 Ga0105240_10140042 3300009093 Bacteria 2893
121 Ga0105240_10314266 3300009093 Bacteria 1788
122 Ga0105240_10647942 3300009093 Bacteria 1158
123 Ga0105240_10848261 3300009093 Bacteria 986
124 Ga0105247_10008942 3300009101 Bacteria 6104
125 Ga0105241_10072754 3300009174 Bacteria 2673
126 Ga0105241_10093855 3300009174 Bacteria 2372
127 Ga0105241_10120691 3300009174 Bacteria 2110
128 Ga0105241_10125473 3300009174 Bacteria 2072
129 Ga0105241_10559961 3300009174 Bacteria 1027
130 Ga0105242_10004303 3300009176 Bacteria 11098
131 Ga0105242_10203142 3300009176 Bacteria 1761
132 Ga0105242_10443213 3300009176 Bacteria 1222
133 Ga0105248_10158919 3300009177 Bacteria 2550
134 Ga0105237_10000254 3300009545 Bacteria 75712
135 Ga0105237_10002047 3300009545 Bacteria 25648
136 Ga0105237_10005495 3300009545 Bacteria 14291
137 Ga0105237_10026046 3300009545 Bacteria 5977
138 Ga0105237_10026147 3300009545 Bacteria 5965
139 Ga0105237_10030103 3300009545 Bacteria 5515
140 Ga0105237_10355337 3300009545 Bacteria 1470
141 Ga0105238_10011246 3300009551 Bacteria 9007
142 Ga0105238_10195146 3300009551 Bacteria 2000
143 Ga0105249_10004235 3300009553 Bacteria 12404
144 Ga0105239_10000009 3300010375 Bacteria 361182
145 Ga0105239_10000015 3300010375 Bacteria 319892
146 Ga0105239_10020486 3300010375 Bacteria 7295
147 Ga0105239_10028430 3300010375 Bacteria 6150
148 Ga0105239_10102160 3300010375 Bacteria 3173
149 Ga0105239_10302714 3300010375 Bacteria 1801
150 Ga0157373_10000034 3300013100 Bacteria 124053
151 Ga0157373_10004164 3300013100 Bacteria 10907
152 Ga0157373_10135447 3300013100 Bacteria 1732
153 Ga0157371_10000220 3300013102 Bacteria 83813
154 Ga0157371_10001097 3300013102 Bacteria 29365
155 Ga0157371_10010755 3300013102 Bacteria 7107
156 Ga0157371_10055935 3300013102 Bacteria 2798
157 Ga0157371_10071381 3300013102 Bacteria 2458
158 Ga0157371_10081469 3300013102 Bacteria 2292
159 Ga0157370_10001898 3300013104 Bacteria 25725
160 Ga0157370_10008899 3300013104 Bacteria 10786
161 Ga0157370_10016508 3300013104 Bacteria 7471
162 Ga0157370_10246110 3300013104 Unclassified 1654
163 Ga0157369_10005281 3300013105 Bacteria 15054
164 Ga0157369_10216883 3300013105 Bacteria 2004
165 Ga0157369_10217475 3300013105 Bacteria 2001
166 Ga0157369_10314366 3300013105 Unclassified 1629
167 Ga0157374_10000003 3300013296 Bacteria 854471
168 Ga0157374_10000084 3300013296 Bacteria 94138
169 Ga0157374_10009739 3300013296 Bacteria 8251
170 Ga0157374_10018538 3300013296 Bacteria 6143
171 Ga0157374_10023271 3300013296 Bacteria 5539
172 Ga0157374_10366680 3300013296 Bacteria 1433
173 Ga0157378_10027250 3300013297 Bacteria 5043
174 Ga0157378_10081785 3300013297 Bacteria 2920
175 Ga0157378_10175738 3300013297 Bacteria 2011
176 Ga0157378_10407162 3300013297 Bacteria 1342
177 Ga0157378_10451309 3300013297 Bacteria 1276
178 Ga0163162_10000113 3300013306 Bacteria 71491
179 Ga0163162_10000434 3300013306 Bacteria 38574
180 Ga0163162_10001293 3300013306 Bacteria 23397
181 Ga0163162_10003002 3300013306 Bacteria 16127
182 Ga0163162_10016972 3300013306 Bacteria 7122
183 Ga0163162_10043833 3300013306 Bacteria 4479
184 Ga0163162_10085978 3300013306 Bacteria 3222
185 Ga0163162_10122918 3300013306 Bacteria 2701
186 Ga0163162_10392146 3300013306 Bacteria 1521
187 Ga0163162_10477779 3300013306 Bacteria 1378
188 Ga0157372_10000099 3300013307 Bacteria 89946
189 Ga0157372_10000632 3300013307 Bacteria 38535
190 Ga0157372_10001816 3300013307 Bacteria 23157
191 Ga0157372_10158370 3300013307 Bacteria 2616
192 Ga0157372_10161383 3300013307 Bacteria 2591
193 Ga0157375_10000118 3300013308 Bacteria 77255
194 Ga0157375_10006522 3300013308 Bacteria 10156
195 Ga0157375_10021380 3300013308 Bacteria 5931
196 Ga0157375_10080186 3300013308 Bacteria 3301
197 Ga0157375_10382334 3300013308 Bacteria 1574
198 Ga0157375_10679034 3300013308 Bacteria 1185
199 Ga0163163_10000306 3300014325 Bacteria 48215
200 Ga0157380_10000003 3300014326 Bacteria 224643
201 Ga0157377_10286995 3300014745 Bacteria 1081
202 Ga0157379_10000245 3300014968 Bacteria 42570
203 Ga0157376_10000276 3300014969 Bacteria 35001
204 Ga0157376_10001630 3300014969 Bacteria 14867
205 Ga0157376_10003326 3300014969 Bacteria 11066
206 Ga0157376_10132998 3300014969 Bacteria 2222
207 Ga0182006_1004929 3300015261 Bacteria 6457
208 Ga0183373_1004 3300015682 Bacteria 537398
209 Ga0163161_10002287 3300017792 Bacteria 13739
210 Ga0163161_10046885 3300017792 Bacteria 3119
211 Ga0213872_10027850 3300021361 Bacteria 2593
212 Ga0209436_101314 3300025208 Bacteria 8826
213 Ga0207427_100323 3300025231 Bacteria 32232
214 Ga0209437_100093 3300025233 Bacteria 239733
215 Ga0209437_100135 3300025233 Bacteria 176455
216 Ga0207425_1000023 3300025245 Bacteria 341339
217 Ga0209026_1000419 3300025250 Bacteria 36170
218 Ga0209026_1001598 3300025250 Bacteria 9719
219 Ga0209026_1001946 3300025250 Bacteria 8321
220 Ga0209026_1019470 3300025250 Bacteria 1063
221 Ga0209148_1029653 3300025254 Bacteria 825
222 Ga0209129_1000032 3300025258 Bacteria 341150
223 Ga0209233_1000486 3300025261 Bacteria 24139
224 Ga0209233_1001137 3300025261 Bacteria 10850
225 Ga0209455_1003654 3300025272 Bacteria 5336
226 Ga0209130_1004879 3300025284 Bacteria 4882
227 Ga0209025_1000047 3300025294 Bacteria 341150
228 Ga0209758_1000145 3300025297 Bacteria 170553
229 Ga0207426_1000002 3300025302 Bacteria 1249660
230 Ga0207426_1000139 3300025302 Bacteria 195835
231 Ga0207656_10003536 3300025321 Bacteria 5380
232 Ga0207656_10062796 3300025321 Bacteria 1634
233 Ga0207656_10180075 3300025321 Bacteria 1014
234 Ga0207647_10000771 3300025904 Bacteria 24978
235 Ga0207647_10047550 3300025904 Bacteria 2668
236 Ga0207647_10149143 3300025904 Bacteria 1367
237 Ga0207645_10003611 3300025907 Bacteria 11703
238 Ga0207705_10000068 3300025909 Bacteria 134316
239 Ga0207705_10003864 3300025909 Bacteria 11391
240 Ga0207705_10229763 3300025909 Bacteria 1411
241 Ga0207654_10030866 3300025911 Bacteria 2946
242 Ga0207654_10094206 3300025911 Bacteria 1832
243 Ga0207654_10205957 3300025911 Bacteria 1298
244 Ga0207654_10314623 3300025911 Bacteria 1068
245 Ga0207695_10000875 3300025913 Bacteria 54793
246 Ga0207695_10012940 3300025913 Bacteria 9979
247 Ga0207695_10016019 3300025913 Bacteria 8799
248 Ga0207695_10059303 3300025913 Bacteria 3969
249 Ga0207695_10209683 3300025913 Bacteria 1859
250 Ga0207671_10002281 3300025914 Bacteria 20744
251 Ga0207671_10005134 3300025914 Bacteria 12196
252 Ga0207671_10006618 3300025914 Bacteria 10279
253 Ga0207671_10012004 3300025914 Bacteria 7000
254 Ga0207671_10031445 3300025914 Bacteria 3956
255 Ga0207671_10123074 3300025914 Bacteria 1984
256 Ga0207671_10249139 3300025914 Bacteria 1396
257 Ga0207660_10023218 3300025917 Bacteria 4188
258 Ga0207657_10047929 3300025919 Bacteria 3732
259 Ga0207652_10001055 3300025921 Bacteria 25081
260 Ga0207652_10184630 3300025921 Bacteria 1875
261 Ga0207652_10280444 3300025921 Bacteria 1503
262 Ga0207694_10025015 3300025924 Bacteria 4537
263 Ga0207694_10244771 3300025924 Bacteria 1466
264 Ga0207650_10101432 3300025925 Bacteria 2216
265 Ga0207659_10066275 3300025926 Bacteria 2620
266 Ga0207687_10479954 3300025927 Bacteria 1035
267 Ga0207644_10009650 3300025931 Bacteria 6342
268 Ga0207644_10018165 3300025931 Bacteria 4756
269 Ga0207644_10303308 3300025931 Bacteria 1288
270 Ga0207690_10000280 3300025932 Bacteria 36230
271 Ga0207706_10000694 3300025933 Bacteria 35171
272 Ga0207706_10008752 3300025933 Bacteria 9316
273 Ga0207686_10184746 3300025934 Bacteria 1481
274 Ga0207709_10453335 3300025935 Bacteria 992
275 Ga0207669_10049149 3300025937 Bacteria 2512
276 Ga0207704_10000036 3300025938 Bacteria 94574
277 Ga0207691_10001704 3300025940 Bacteria 21708
278 Ga0207711_10406412 3300025941 Bacteria 1265
279 Ga0207689_10035637 3300025942 Bacteria 4132
280 Ga0207661_10217489 3300025944 Bacteria 1687
281 Ga0207667_10000045 3300025949 Bacteria 246053
282 Ga0207667_10001978 3300025949 Bacteria 25682
283 Ga0207667_10008452 3300025949 Bacteria 12227
284 Ga0207667_10019284 3300025949 Bacteria 7620
285 Ga0207667_10065191 3300025949 Bacteria 3800
286 Ga0207667_10110039 3300025949 Bacteria 2842
287 Ga0207667_10562977 3300025949 Bacteria 1152
288 Ga0207651_10007629 3300025960 Bacteria 5775
289 Ga0207651_10064672 3300025960 Bacteria 2561
290 Ga0207651_10569539 3300025960 Bacteria 987
291 Ga0207712_10050626 3300025961 Bacteria 2901
292 Ga0207668_10000520 3300025972 Bacteria 24120
293 Ga0207640_10134212 3300025981 Bacteria 1794
294 Ga0207658_10000559 3300025986 Bacteria 33814
295 Ga0207677_10002274 3300026023 Bacteria 10090
296 Ga0207677_10015881 3300026023 Bacteria 4444
297 Ga0207677_10240989 3300026023 Bacteria 1463
298 Ga0207703_10005041 3300026035 Bacteria 10702
299 Ga0207639_10022682 3300026041 Bacteria 4524
300 Ga0207639_10047167 3300026041 Bacteria 3254
301 Ga0207639_10061245 3300026041 Bacteria 2905
302 Ga0207639_10072886 3300026041 Bacteria 2690
303 Ga0207639_10451494 3300026041 Bacteria 1167
304 Ga0207678_10879119 3300026067 Bacteria 792
305 Ga0207702_10006949 3300026078 Bacteria 9693
306 Ga0207702_10038486 3300026078 Bacteria 4005
307 Ga0207641_10010315 3300026088 Bacteria 7680
308 Ga0207641_10337951 3300026088 Bacteria 1432
309 Ga0207648_10004475 3300026089 Bacteria 14339
310 Ga0207648_10221721 3300026089 Bacteria 1681
311 Ga0207676_10002689 3300026095 Bacteria 12636
312 Ga0207675_100038941 3300026118 Bacteria 4436
313 Ga0207683_10037327 3300026121 Bacteria 4230
314 Ga0207683_10049502 3300026121 Bacteria 3679
315 Ga0207698_10056935 3300026142 Bacteria 3021
316 Ga0207698_10194179 3300026142 Bacteria 1812
317 Ga0207698_10383916 3300026142 Bacteria 1337
318 Ga0268266_10000603 3300028379 Bacteria 49111
319 Ga0268266_10010442 3300028379 Bacteria 8113
320 Ga0268264_10020813 3300028381 Bacteria 5360
321 Ga0268264_10056876 3300028381 Bacteria 3270
322 Ga0268264_10483270 3300028381 Bacteria 1205
323 Ga0268264_10519809 3300028381 Bacteria 1163
324 Ga0265334_10033667 3300028573 Bacteria 2038
325 Ga0307517_10000571 3300028786 Bacteria 62870
326 Ga0307515_10001136 3300028794 Bacteria 61007
327 Ga0307515_10003664 3300028794 Bacteria 32272
328 Ga0265338_10078547 3300028800 Bacteria 2783
329 Ga0265327_10000338 3300031251 Bacteria 88898
330 Ga0307510_10001914 3300033180 Bacteria 23402
331 Ga0395899_0000002 3300037312 Bacteria 1324310
332 Ga0395899_0000569 3300037312 Bacteria 39364
333 Ga0395899_0004255 3300037312 Bacteria 11200
334 Ga0395899_0007798 3300037312 Bacteria 8256
335 Ga0395900_0000245 3300037418 Bacteria 85245
336 Ga0395900_0000441 3300037418 Bacteria 59413
337 Ga0395900_0008053 3300037418 Bacteria 10850
338 Ga0395898_0011251 3300037466 Bacteria 9311
339 Ga0395898_0027634 3300037466 Bacteria 5691
340 Ga0395905_0000971 3300037471 Bacteria 36768
341 Ga0395905_0002190 3300037471 Bacteria 22056
342 Ga0395901_0000706 3300038443 Bacteria 38128
343 Ga0395901_0009928 3300038443 Bacteria 9650
344 Ga0436361_0153467 3300039447 Bacteria 3514
345 Ga0451793_0779921 3300041452 Bacteria 1025
346 Ga0439448_0046078 3300042005 Bacteria 1420
347 Ga0466972_0000020 3300044658 Bacteria 197336
348 Ga0466966_0149235 3300044684 Bacteria 1426
349 Ga0466966_0273155 3300044684 Bacteria 1017
350 Ga0466970_0013659 3300044765 Bacteria 4166
351 Ga0466959_0015637 3300045049 Bacteria 5533
352 Ga0466959_0050293 3300045049 Bacteria 3060
353 Ga0495627_012891 3300046453 Bacteria 2951
354 Ga0495650_0000023 3300046471 Bacteria 527763
355 Ga0495580_0102128 3300046472 Bacteria 1994
356 Ga0495585_0000065 3300046492 Bacteria 108945
357 Ga0495585_0000268 3300046492 Bacteria 52128
358 Ga0495583_0017229 3300046506 Bacteria 3846
359 Ga0495606_0000264 3300046507 Bacteria 92733
360 Ga0495606_0010401 3300046507 Bacteria 7727
361 Ga0495606_0017383 3300046507 Bacteria 5438
362 Ga0495610_0001102 3300046512 Bacteria 24590
363 Ga0495616_0000743 3300046513 Bacteria 23851
364 Ga0495616_0018525 3300046513 Bacteria 3820
365 Ga0495637_0032813 3300046520 Bacteria 2285
366 Ga0495644_0031761 3300046523 Bacteria 1996
367 Ga0495648_0001997 3300046524 Bacteria 19320
368 Ga0495648_0128139 3300046524 Bacteria 1353
369 Ga0495609_0003038 3300046538 Bacteria 9878
370 Ga0495633_0000032 3300046558 Bacteria 193765
371 Ga0495633_0000289 3300046558 Bacteria 57849
372 Ga0495633_0057068 3300046558 Bacteria 1834
373 Ga0495668_0000009 3300046616 Bacteria 492623
374 Ga0495625_0000211 3300046660 Bacteria 92222
375 Ga0495625_0001964 3300046660 Bacteria 23219
376 Ga0495625_0003233 3300046660 Bacteria 16491
377 Ga0495625_0016628 3300046660 Bacteria 5781
378 Ga0495625_0024615 3300046660 Bacteria 4579
379 Ga0495625_0053177 3300046660 Bacteria 2898
380 Ga0495661_0000555 3300046665 Bacteria 38650
381 Ga0495661_0001542 3300046665 Bacteria 19060
382 Ga0495658_0005234 3300046683 Bacteria 6383
383 Ga0495671_0248984 3300046692 Bacteria 858
384 Ga0495649_0000090 3300046694 Bacteria 78509
385 Ga0495660_0027641 3300046810 Bacteria 3209
386 Ga0495683_0041080 3300047323 Bacteria 2335
387 Ga0495687_001641 3300047443 Bacteria 20132
388 Ga0495687_035598 3300047443 Bacteria 2236
389 Ga0495686_0001404 3300047472 Bacteria 26590
390 Ga0495686_0001532 3300047472 Bacteria 24780
391 Ga0495686_0156335 3300047472 Bacteria 1335
392 Ga0495686_0167045 3300047472 Bacteria 1282
393 Ga0495614_0023097 3300048089 Bacteria 2682
394 Ga0496102_0605327 3300048905 Bacteria 1019
395 Ga0496105_0299842 3300048908 Bacteria 1292
396 Ga0496114_0198610 3300048917 Bacteria 1756
397 Ga0501033_0012262 3300049570 Bacteria 6542
398 Ga0501033_0157334 3300049570 Bacteria 1637
399 Ga0501034_0035119 3300049571 Bacteria 5084
400 nmdc:mga0k408_1631_c2 3300050493 Bacteria 4915
401 nmdc:mga0k408_354_c1 3300050493 Bacteria 25193
402 nmdc:mga0k408_61_c1 3300050493 Bacteria 53671
403 nmdc:mga0k408_73181_c1 3300050493 Bacteria 2001
404 Ga0500635_0001467 3300053080 Bacteria 5669
405 Ga0500635_0001644 3300053080 Bacteria 5395
406 Ga0500608_028795 3300053122 Bacteria 2624
407 Ga0500618_000079 3300053125 Bacteria 79415
408 Ga0500618_024829 3300053125 Bacteria 1441
409 Ga0500642_0101676 3300053130 Bacteria 1337
410 Ga0500561_0094920 3300053137 Bacteria 887
411 Ga0500616_0045339 3300053153 Bacteria 2343
412 Ga0500622_0000312 3300053156 Bacteria 49537
413 Ga0500624_001224 3300053157 Bacteria 4581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10104634 rootH1_101046341 242
2 3300005366 Ga0070659_100005342 Ga0070659_1000053422 242
3 3300025931 Ga0207644_10303308 Ga0207644_103033082 248
4 3300009093 Ga0105240_10848261 Ga0105240_108482611 249
5 iso_pu_bacteria 2977232053 2977235932 249
6 iso_pu_bacteria 2738541302 2738856190 250
7 iso_pu_bacteria 2818991460 2819678993 250
8 iso_pu_bacteria 2852623160 2852626722 250
9 iso_pu_bacteria 2857627736 2857629333 250
10 iso_pu_bacteria 2884933994 2884934045 250
11 iso_pu_bacteria 2919437846 2919442890 250
12 iso_pu_bacteria 2928078545 2928082402 250
13 iso_pu_bacteria 2928147474 2928149013 250
14 iso_pu_bacteria 2929239360 2929242935 250
15 3300005459 Ga0068867_100235086 Ga0068867_1002350862 251
16 3300026089 Ga0207648_10221721 Ga0207648_102217212 251
17 3300002077 JGI24744J21845_10044030 JGI24744J21845_100440301 252
18 3300005330 Ga0070690_100020035 Ga0070690_1000200355 252
19 3300005331 Ga0070670_100087129 Ga0070670_1000871293 252
20 3300005456 Ga0070678_100018717 Ga0070678_1000187174 252
21 3300005458 Ga0070681_10209776 Ga0070681_102097763 252
22 3300005530 Ga0070679_100000522 Ga0070679_10000052225 252
23 3300005539 Ga0068853_100019354 Ga0068853_1000193543 252
24 3300005548 Ga0070665_100418149 Ga0070665_1004181492 252
25 3300013104 Ga0157370_10008899 Ga0157370_100088992 252
26 3300013296 Ga0157374_10000003 Ga0157374_10000003656 252
27 3300013306 Ga0163162_10392146 Ga0163162_103921462 252
28 3300014326 Ga0157380_10000003 Ga0157380_100000033 252
29 3300014969 Ga0157376_10001630 Ga0157376_1000163012 252
30 3300025921 Ga0207652_10001055 Ga0207652_1000105515 252
31 3300026041 Ga0207639_10072886 Ga0207639_100728863 252
32 3300026067 Ga0207678_10879119 Ga0207678_108791191 252
33 3300026121 Ga0207683_10037327 Ga0207683_100373274 252
34 3300028381 Ga0268264_10483270 Ga0268264_104832702 252
35 3300037312 Ga0395899_0007798 Ga0395899_0007798_7185_7943 252
36 3300037418 Ga0395900_0000245 Ga0395900_0000245_5628_6386 252
37 3300037466 Ga0395898_0011251 Ga0395898_0011251_4048_4806 252
38 3300038443 Ga0395901_0009928 Ga0395901_0009928_1380_2138 252
39 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001499 253
40 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004299 253
41 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000999 253
42 3300005335 Ga0070666_10130020 Ga0070666_101300202 253
43 3300005355 Ga0070671_100116527 Ga0070671_1001165272 253
44 3300005356 Ga0070674_100066456 Ga0070674_1000664563 253
45 3300005459 Ga0068867_100165928 Ga0068867_1001659281 253
46 3300005616 Ga0068852_100289317 Ga0068852_1002893173 253
47 3300005841 Ga0068863_100099349 Ga0068863_1000993492 253
48 3300006237 Ga0097621_100000695 Ga0097621_1000006956 253
49 3300006358 Ga0068871_100000091 Ga0068871_10000009142 253
50 3300006881 Ga0068865_100217174 Ga0068865_1002171742 253
51 3300013102 Ga0157371_10000220 Ga0157371_100002202 253
52 3300013104 Ga0157370_10001898 Ga0157370_1000189814 253
53 3300013104 Ga0157370_10016508 Ga0157370_100165082 253
54 3300013297 Ga0157378_10027250 Ga0157378_100272502 253
55 3300013306 Ga0163162_10000434 Ga0163162_100004345 253
56 3300013306 Ga0163162_10085978 Ga0163162_100859783 253
57 3300013308 Ga0157375_10000118 Ga0157375_1000011862 253
58 3300014969 Ga0157376_10003326 Ga0157376_100033265 253
59 3300015261 Ga0182006_1004929 Ga0182006_10049297 253
60 3300015682 Ga0183373_1004 Ga0183373_1004381 253
61 3300025245 Ga0207425_1000023 Ga0207425_100002398 253
62 3300025258 Ga0209129_1000032 Ga0209129_1000032175 253
63 3300025294 Ga0209025_1000047 Ga0209025_1000047175 253
64 3300025297 Ga0209758_1000145 Ga0209758_100014598 253
65 3300025302 Ga0207426_1000002 Ga0207426_1000002953 253
66 3300025909 Ga0207705_10229763 Ga0207705_102297632 253
67 3300025931 Ga0207644_10018165 Ga0207644_100181652 253
68 3300025935 Ga0207709_10453335 Ga0207709_104533352 253
69 3300025937 Ga0207669_10049149 Ga0207669_100491493 253
70 3300025941 Ga0207711_10406412 Ga0207711_104064122 253
71 3300026088 Ga0207641_10337951 Ga0207641_103379512 253
72 3300028381 Ga0268264_10519809 Ga0268264_105198092 253
73 3300028573 Ga0265334_10033667 Ga0265334_100336672 253
74 3300037312 Ga0395899_0000002 Ga0395899_0000002_288484_289245 253
75 3300044658 Ga0466972_0000020 Ga0466972_0000020_133015_133776 253
76 3300044765 Ga0466970_0013659 Ga0466970_0013659_2241_3002 253
77 3300048905 Ga0496102_0605327 Ga0496102_0605327_130_891 253
78 3300048908 Ga0496105_0299842 Ga0496105_0299842_174_935 253
79 3300048917 Ga0496114_0198610 Ga0496114_0198610_768_1529 253
80 3300049570 Ga0501033_0012262 Ga0501033_0012262_4137_4898 253
81 3300049570 Ga0501033_0157334 Ga0501033_0157334_429_1190 253
82 3300049571 Ga0501034_0035119 Ga0501034_0035119_580_1341 253
83 3300001990 JGI24737J22298_10000417 JGI24737J22298_1000041717 254
84 3300001990 JGI24737J22298_10045543 JGI24737J22298_100455432 254
85 3300002067 JGI24735J21928_10000009 JGI24735J21928_1000000980 254
86 3300002067 JGI24735J21928_10000036 JGI24735J21928_100000361 254
87 3300002077 JGI24744J21845_10010452 JGI24744J21845_100104523 254
88 3300002737 JGI25162J39368_1000039 JGI25162J39368_1000039152 254
89 3300002737 JGI25162J39368_1001763 JGI25162J39368_100176310 254
90 3300002741 JGI25157J39369_1010248 JGI25157J39369_10102481 254
91 3300002772 JGI25164J39214_1006176 JGI25164J39214_10061761 254
92 3300003214 JGI25165J46597_1001210 JGI25165J46597_100121010 254
93 3300003320 rootH2_10006136 rootH2_100061361 254
94 3300003320 rootH2_10012931 rootH2_100129312 254
95 3300003320 rootH2_10016648 rootH2_100166485 254
96 3300003322 rootL2_10006283 rootL2_100062831 254
97 3300003322 rootL2_10021764 rootL2_100217641 254
98 3300003323 rootH1_10015584 rootH1_1001558418 254
99 3300003323 rootH1_10092206 rootH1_100922064 254
100 3300003323 rootH1_10185113 rootH1_101851131 254
101 3300003354 JGI25160J50197_1012173 JGI25160J50197_10121733 254
102 3300004803 Ga0058862_12860242 Ga0058862_128602421 254
103 3300005288 Ga0065714_10126855 Ga0065714_101268551 254
104 3300005288 Ga0065714_10133279 Ga0065714_101332791 254
105 3300005327 Ga0070658_10000041 Ga0070658_100000415 254
106 3300005328 Ga0070676_10004846 Ga0070676_100048464 254
107 3300005329 Ga0070683_100251701 Ga0070683_1002517011 254
108 3300005331 Ga0070670_100094325 Ga0070670_1000943254 254
109 3300005334 Ga0068869_100024637 Ga0068869_1000246374 254
110 3300005335 Ga0070666_10000192 Ga0070666_1000019230 254
111 3300005336 Ga0070680_100018619 Ga0070680_1000186192 254
112 3300005338 Ga0068868_100000091 Ga0068868_10000009137 254
113 3300005338 Ga0068868_100475205 Ga0068868_1004752051 254
114 3300005347 Ga0070668_100000043 Ga0070668_10000004372 254
115 3300005354 Ga0070675_100164321 Ga0070675_1001643213 254
116 3300005355 Ga0070671_100014392 Ga0070671_1000143924 254
117 3300005356 Ga0070674_100362212 Ga0070674_1003622122 254
118 3300005364 Ga0070673_100006626 Ga0070673_1000066266 254
119 3300005364 Ga0070673_100019605 Ga0070673_1000196055 254
120 3300005364 Ga0070673_100254000 Ga0070673_1002540002 254
121 3300005365 Ga0070688_100007899 Ga0070688_1000078994 254
122 3300005366 Ga0070659_100000094 Ga0070659_10000009419 254
123 3300005367 Ga0070667_100000086 Ga0070667_10000008612 254
124 3300005456 Ga0070678_100186837 Ga0070678_1001868372 254
125 3300005457 Ga0070662_100004021 Ga0070662_1000040219 254
126 3300005457 Ga0070662_100014656 Ga0070662_1000146563 254
127 3300005457 Ga0070662_100302139 Ga0070662_1003021391 254
128 3300005458 Ga0070681_10000745 Ga0070681_100007457 254
129 3300005459 Ga0068867_100006741 Ga0068867_1000067416 254
130 3300005530 Ga0070679_100016279 Ga0070679_1000162791 254
131 3300005535 Ga0070684_100388363 Ga0070684_1003883631 254
132 3300005539 Ga0068853_100006204 Ga0068853_1000062046 254
133 3300005539 Ga0068853_100111147 Ga0068853_1001111472 254
134 3300005543 Ga0070672_100000160 Ga0070672_10000016032 254
135 3300005548 Ga0070665_100000147 Ga0070665_10000014734 254
136 3300005548 Ga0070665_100000350 Ga0070665_10000035040 254
137 3300005563 Ga0068855_100000009 Ga0068855_10000000945 254
138 3300005563 Ga0068855_100015925 Ga0068855_1000159258 254
139 3300005563 Ga0068855_100017030 Ga0068855_1000170305 254
140 3300005563 Ga0068855_100032435 Ga0068855_1000324352 254
141 3300005563 Ga0068855_100051232 Ga0068855_1000512322 254
142 3300005563 Ga0068855_100077278 Ga0068855_1000772783 254
143 3300005563 Ga0068855_100082742 Ga0068855_1000827421 254
144 3300005563 Ga0068855_100109555 Ga0068855_1001095554 254
145 3300005563 Ga0068855_100571381 Ga0068855_1005713812 254
146 3300005563 Ga0068855_100688325 Ga0068855_1006883252 254
147 3300005578 Ga0068854_100132561 Ga0068854_1001325613 254
148 3300005614 Ga0068856_100001199 Ga0068856_10000119923 254
149 3300005614 Ga0068856_100074635 Ga0068856_1000746353 254
150 3300005616 Ga0068852_100107272 Ga0068852_1001072722 254
151 3300005616 Ga0068852_100162363 Ga0068852_1001623631 254
152 3300005616 Ga0068852_100189607 Ga0068852_1001896071 254
153 3300005617 Ga0068859_100663568 Ga0068859_1006635682 254
154 3300005618 Ga0068864_100002177 Ga0068864_10000217715 254
155 3300005719 Ga0068861_100025193 Ga0068861_1000251935 254
156 3300005834 Ga0068851_10000487 Ga0068851_100004879 254
157 3300005841 Ga0068863_100002653 Ga0068863_1000026539 254
158 3300005842 Ga0068858_100000662 Ga0068858_10000066219 254
159 3300005843 Ga0068860_100031205 Ga0068860_1000312054 254
160 3300005843 Ga0068860_100036681 Ga0068860_1000366816 254
161 3300005843 Ga0068860_100043527 Ga0068860_1000435273 254
162 3300006195 Ga0075366_10000199 Ga0075366_100001994 254
163 3300006195 Ga0075366_10000458 Ga0075366_1000045810 254
164 3300006195 Ga0075366_10010964 Ga0075366_100109646 254
165 3300006195 Ga0075366_10158525 Ga0075366_101585252 254
166 3300006237 Ga0097621_100000390 Ga0097621_10000039019 254
167 3300006237 Ga0097621_100002307 Ga0097621_1000023075 254
168 3300006353 Ga0075370_10157698 Ga0075370_101576982 254
169 3300006358 Ga0068871_100002236 Ga0068871_1000022366 254
170 3300006358 Ga0068871_100006651 Ga0068871_1000066515 254
171 3300006881 Ga0068865_100000552 Ga0068865_10000055219 254
172 3300006881 Ga0068865_100003134 Ga0068865_1000031347 254
173 3300006931 Ga0097620_100663647 Ga0097620_1006636472 254
174 3300009093 Ga0105240_10000858 Ga0105240_100008586 254
175 3300009093 Ga0105240_10007945 Ga0105240_1000794515 254
176 3300009093 Ga0105240_10010208 Ga0105240_1001020812 254
177 3300009093 Ga0105240_10051892 Ga0105240_100518924 254
178 3300009093 Ga0105240_10052915 Ga0105240_100529152 254
179 3300009093 Ga0105240_10140042 Ga0105240_101400421 254
180 3300009093 Ga0105240_10314266 Ga0105240_103142661 254
181 3300009093 Ga0105240_10647942 Ga0105240_106479421 254
182 3300009101 Ga0105247_10008942 Ga0105247_100089424 254
183 3300009174 Ga0105241_10072754 Ga0105241_100727542 254
184 3300009174 Ga0105241_10093855 Ga0105241_100938552 254
185 3300009174 Ga0105241_10120691 Ga0105241_101206912 254
186 3300009174 Ga0105241_10125473 Ga0105241_101254732 254
187 3300009174 Ga0105241_10559961 Ga0105241_105599612 254
188 3300009176 Ga0105242_10004303 Ga0105242_1000430310 254
189 3300009176 Ga0105242_10203142 Ga0105242_102031422 254
190 3300009176 Ga0105242_10443213 Ga0105242_104432131 254
191 3300009177 Ga0105248_10158919 Ga0105248_101589193 254
192 3300009545 Ga0105237_10000254 Ga0105237_1000025441 254
193 3300009545 Ga0105237_10002047 Ga0105237_100020474 254
194 3300009545 Ga0105237_10005495 Ga0105237_100054951 254
195 3300009545 Ga0105237_10026046 Ga0105237_100260462 254
196 3300009545 Ga0105237_10026147 Ga0105237_100261471 254
197 3300009545 Ga0105237_10030103 Ga0105237_100301033 254
198 3300009545 Ga0105237_10355337 Ga0105237_103553371 254
199 3300009551 Ga0105238_10011246 Ga0105238_100112463 254
200 3300009551 Ga0105238_10195146 Ga0105238_101951462 254
201 3300009553 Ga0105249_10004235 Ga0105249_1000423513 254
202 3300010375 Ga0105239_10000009 Ga0105239_100000093 254
203 3300010375 Ga0105239_10000015 Ga0105239_1000001591 254
204 3300010375 Ga0105239_10020486 Ga0105239_100204863 254
205 3300010375 Ga0105239_10028430 Ga0105239_100284304 254
206 3300010375 Ga0105239_10102160 Ga0105239_101021604 254
207 3300010375 Ga0105239_10302714 Ga0105239_103027142 254
208 3300013100 Ga0157373_10000034 Ga0157373_1000003490 254
209 3300013100 Ga0157373_10004164 Ga0157373_1000416410 254
210 3300013100 Ga0157373_10135447 Ga0157373_101354471 254
211 3300013102 Ga0157371_10001097 Ga0157371_1000109725 254
212 3300013102 Ga0157371_10010755 Ga0157371_100107551 254
213 3300013102 Ga0157371_10055935 Ga0157371_100559352 254
214 3300013102 Ga0157371_10071381 Ga0157371_100713812 254
215 3300013102 Ga0157371_10081469 Ga0157371_100814691 254
216 3300013104 Ga0157370_10246110 Ga0157370_102461102 254
217 3300013105 Ga0157369_10005281 Ga0157369_100052813 254
218 3300013105 Ga0157369_10216883 Ga0157369_102168832 254
219 3300013105 Ga0157369_10217475 Ga0157369_102174752 254
220 3300013105 Ga0157369_10314366 Ga0157369_103143661 254
221 3300013296 Ga0157374_10000084 Ga0157374_1000008440 254
222 3300013296 Ga0157374_10009739 Ga0157374_100097391 254
223 3300013296 Ga0157374_10018538 Ga0157374_100185381 254
224 3300013296 Ga0157374_10023271 Ga0157374_100232714 254
225 3300013296 Ga0157374_10366680 Ga0157374_103666801 254
226 3300013297 Ga0157378_10081785 Ga0157378_100817852 254
227 3300013297 Ga0157378_10175738 Ga0157378_101757382 254
228 3300013297 Ga0157378_10407162 Ga0157378_104071621 254
229 3300013297 Ga0157378_10451309 Ga0157378_104513091 254
230 3300013306 Ga0163162_10000113 Ga0163162_1000011326 254
231 3300013306 Ga0163162_10001293 Ga0163162_100012936 254
232 3300013306 Ga0163162_10003002 Ga0163162_100030024 254
233 3300013306 Ga0163162_10016972 Ga0163162_100169729 254
234 3300013306 Ga0163162_10043833 Ga0163162_100438332 254
235 3300013306 Ga0163162_10122918 Ga0163162_101229182 254
236 3300013306 Ga0163162_10477779 Ga0163162_104777791 254
237 3300013307 Ga0157372_10000099 Ga0157372_1000009942 254
238 3300013307 Ga0157372_10000632 Ga0157372_1000063215 254
239 3300013307 Ga0157372_10001816 Ga0157372_100018164 254
240 3300013307 Ga0157372_10158370 Ga0157372_101583704 254
241 3300013307 Ga0157372_10161383 Ga0157372_101613833 254
242 3300013308 Ga0157375_10006522 Ga0157375_100065224 254
243 3300013308 Ga0157375_10021380 Ga0157375_100213803 254
244 3300013308 Ga0157375_10080186 Ga0157375_100801864 254
245 3300013308 Ga0157375_10382334 Ga0157375_103823342 254
246 3300013308 Ga0157375_10679034 Ga0157375_106790342 254
247 3300014325 Ga0163163_10000306 Ga0163163_1000030625 254
248 3300014745 Ga0157377_10286995 Ga0157377_102869952 254
249 3300014968 Ga0157379_10000245 Ga0157379_1000024539 254
250 3300014969 Ga0157376_10000276 Ga0157376_1000027622 254
251 3300014969 Ga0157376_10132998 Ga0157376_101329983 254
252 3300017792 Ga0163161_10002287 Ga0163161_100022875 254
253 3300017792 Ga0163161_10046885 Ga0163161_100468855 254
254 3300021361 Ga0213872_10027850 Ga0213872_100278502 254
255 3300025208 Ga0209436_101314 Ga0209436_1013145 254
256 3300025231 Ga0207427_100323 Ga0207427_10032310 254
257 3300025233 Ga0209437_100093 Ga0209437_1000939 254
258 3300025233 Ga0209437_100135 Ga0209437_10013530 254
259 3300025250 Ga0209026_1000419 Ga0209026_100041923 254
260 3300025250 Ga0209026_1001598 Ga0209026_10015981 254
261 3300025250 Ga0209026_1001946 Ga0209026_10019465 254
262 3300025250 Ga0209026_1019470 Ga0209026_10194702 254
263 3300025254 Ga0209148_1029653 Ga0209148_10296531 254
264 3300025261 Ga0209233_1000486 Ga0209233_10004869 254
265 3300025261 Ga0209233_1001137 Ga0209233_10011376 254
266 3300025272 Ga0209455_1003654 Ga0209455_10036545 254
267 3300025284 Ga0209130_1004879 Ga0209130_10048794 254
268 3300025302 Ga0207426_1000139 Ga0207426_100013945 254
269 3300025321 Ga0207656_10003536 Ga0207656_100035362 254
270 3300025321 Ga0207656_10062796 Ga0207656_100627961 254
271 3300025321 Ga0207656_10180075 Ga0207656_101800751 254
272 3300025904 Ga0207647_10000771 Ga0207647_1000077126 254
273 3300025904 Ga0207647_10047550 Ga0207647_100475503 254
274 3300025904 Ga0207647_10149143 Ga0207647_101491431 254
275 3300025907 Ga0207645_10003611 Ga0207645_100036118 254
276 3300025909 Ga0207705_10000068 Ga0207705_10000068118 254
277 3300025909 Ga0207705_10003864 Ga0207705_1000386411 254
278 3300025911 Ga0207654_10030866 Ga0207654_100308662 254
279 3300025911 Ga0207654_10094206 Ga0207654_100942062 254
280 3300025911 Ga0207654_10205957 Ga0207654_102059571 254
281 3300025911 Ga0207654_10314623 Ga0207654_103146231 254
282 3300025913 Ga0207695_10000875 Ga0207695_1000087545 254
283 3300025913 Ga0207695_10012940 Ga0207695_100129407 254
284 3300025913 Ga0207695_10016019 Ga0207695_100160196 254
285 3300025913 Ga0207695_10059303 Ga0207695_100593033 254
286 3300025913 Ga0207695_10209683 Ga0207695_102096832 254
287 3300025914 Ga0207671_10002281 Ga0207671_1000228116 254
288 3300025914 Ga0207671_10005134 Ga0207671_100051344 254
289 3300025914 Ga0207671_10006618 Ga0207671_100066188 254
290 3300025914 Ga0207671_10012004 Ga0207671_100120043 254
291 3300025914 Ga0207671_10031445 Ga0207671_100314452 254
292 3300025914 Ga0207671_10123074 Ga0207671_101230742 254
293 3300025914 Ga0207671_10249139 Ga0207671_102491392 254
294 3300025917 Ga0207660_10023218 Ga0207660_100232182 254
295 3300025919 Ga0207657_10047929 Ga0207657_100479294 254
296 3300025921 Ga0207652_10184630 Ga0207652_101846302 254
297 3300025921 Ga0207652_10280444 Ga0207652_102804441 254
298 3300025924 Ga0207694_10025015 Ga0207694_100250151 254
299 3300025924 Ga0207694_10244771 Ga0207694_102447712 254
300 3300025925 Ga0207650_10101432 Ga0207650_101014322 254
301 3300025926 Ga0207659_10066275 Ga0207659_100662752 254
302 3300025927 Ga0207687_10479954 Ga0207687_104799541 254
303 3300025931 Ga0207644_10009650 Ga0207644_100096503 254
304 3300025932 Ga0207690_10000280 Ga0207690_1000028010 254
305 3300025933 Ga0207706_10000694 Ga0207706_100006942 254
306 3300025933 Ga0207706_10008752 Ga0207706_100087529 254
307 3300025934 Ga0207686_10184746 Ga0207686_101847462 254
308 3300025938 Ga0207704_10000036 Ga0207704_1000003616 254
309 3300025940 Ga0207691_10001704 Ga0207691_100017047 254
310 3300025942 Ga0207689_10035637 Ga0207689_100356373 254
311 3300025944 Ga0207661_10217489 Ga0207661_102174892 254
312 3300025949 Ga0207667_10000045 Ga0207667_10000045187 254
313 3300025949 Ga0207667_10001978 Ga0207667_100019785 254
314 3300025949 Ga0207667_10008452 Ga0207667_100084525 254
315 3300025949 Ga0207667_10019284 Ga0207667_100192849 254
316 3300025949 Ga0207667_10065191 Ga0207667_100651914 254
317 3300025949 Ga0207667_10110039 Ga0207667_101100392 254
318 3300025949 Ga0207667_10562977 Ga0207667_105629771 254
319 3300025960 Ga0207651_10007629 Ga0207651_100076293 254
320 3300025960 Ga0207651_10064672 Ga0207651_100646723 254
321 3300025960 Ga0207651_10569539 Ga0207651_105695391 254
322 3300025961 Ga0207712_10050626 Ga0207712_100506263 254
323 3300025972 Ga0207668_10000520 Ga0207668_1000052016 254
324 3300025981 Ga0207640_10134212 Ga0207640_101342121 254
325 3300025986 Ga0207658_10000559 Ga0207658_1000055912 254
326 3300026023 Ga0207677_10002274 Ga0207677_100022742 254
327 3300026023 Ga0207677_10015881 Ga0207677_100158812 254
328 3300026023 Ga0207677_10240989 Ga0207677_102409891 254
329 3300026035 Ga0207703_10005041 Ga0207703_100050414 254
330 3300026041 Ga0207639_10022682 Ga0207639_100226826 254
331 3300026041 Ga0207639_10047167 Ga0207639_100471672 254
332 3300026041 Ga0207639_10061245 Ga0207639_100612452 254
333 3300026041 Ga0207639_10451494 Ga0207639_104514942 254
334 3300026078 Ga0207702_10006949 Ga0207702_1000694912 254
335 3300026078 Ga0207702_10038486 Ga0207702_100384863 254
336 3300026088 Ga0207641_10010315 Ga0207641_100103157 254
337 3300026089 Ga0207648_10004475 Ga0207648_100044754 254
338 3300026095 Ga0207676_10002689 Ga0207676_100026894 254
339 3300026118 Ga0207675_100038941 Ga0207675_1000389414 254
340 3300026121 Ga0207683_10049502 Ga0207683_100495023 254
341 3300026142 Ga0207698_10056935 Ga0207698_100569354 254
342 3300026142 Ga0207698_10194179 Ga0207698_101941792 254
343 3300026142 Ga0207698_10383916 Ga0207698_103839162 254
344 3300028379 Ga0268266_10000603 Ga0268266_1000060335 254
345 3300028379 Ga0268266_10010442 Ga0268266_100104423 254
346 3300028381 Ga0268264_10020813 Ga0268264_100208134 254
347 3300028381 Ga0268264_10056876 Ga0268264_100568763 254
348 3300028786 Ga0307517_10000571 Ga0307517_1000057119 254
349 3300028794 Ga0307515_10001136 Ga0307515_1000113646 254
350 3300028794 Ga0307515_10003664 Ga0307515_1000366425 254
351 3300028800 Ga0265338_10078547 Ga0265338_100785473 254
352 3300031251 Ga0265327_10000338 Ga0265327_1000033855 254
353 3300033180 Ga0307510_10001914 Ga0307510_1000191424 254
354 3300037312 Ga0395899_0000569 Ga0395899_0000569_18674_19438 254
355 3300037312 Ga0395899_0004255 Ga0395899_0004255_509_1273 254
356 3300037418 Ga0395900_0000441 Ga0395900_0000441_56781_57545 254
357 3300037418 Ga0395900_0008053 Ga0395900_0008053_1993_2757 254
358 3300037466 Ga0395898_0027634 Ga0395898_0027634_4383_5147 254
359 3300037471 Ga0395905_0000971 Ga0395905_0000971_33072_33836 254
360 3300037471 Ga0395905_0002190 Ga0395905_0002190_19362_20126 254
361 3300038443 Ga0395901_0000706 Ga0395901_0000706_6049_6813 254
362 3300039447 Ga0436361_0153467 Ga0436361_0153467_1648_2412 254
363 3300041452 Ga0451793_0779921 Ga0451793_0779921_44_808 254
364 3300042005 Ga0439448_0046078 Ga0439448_0046078_521_1285 254
365 3300044684 Ga0466966_0149235 Ga0466966_0149235_40_804 254
366 3300044684 Ga0466966_0273155 Ga0466966_0273155_44_808 254
367 3300045049 Ga0466959_0015637 Ga0466959_0015637_925_1689 254
368 3300045049 Ga0466959_0050293 Ga0466959_0050293_922_1686 254
369 3300046453 Ga0495627_012891 Ga0495627_012891_30_794 254
370 3300046471 Ga0495650_0000023 Ga0495650_0000023_105927_106691 254
371 3300046472 Ga0495580_0102128 Ga0495580_0102128_926_1690 254
372 3300046492 Ga0495585_0000065 Ga0495585_0000065_47004_47768 254
373 3300046492 Ga0495585_0000268 Ga0495585_0000268_7564_8328 254
374 3300046506 Ga0495583_0017229 Ga0495583_0017229_2091_2855 254
375 3300046507 Ga0495606_0000264 Ga0495606_0000264_32958_33722 254
376 3300046507 Ga0495606_0010401 Ga0495606_0010401_1120_1884 254
377 3300046507 Ga0495606_0017383 Ga0495606_0017383_3641_4405 254
378 3300046512 Ga0495610_0001102 Ga0495610_0001102_2985_3749 254
379 3300046513 Ga0495616_0000743 Ga0495616_0000743_14389_15153 254
380 3300046513 Ga0495616_0018525 Ga0495616_0018525_247_1011 254
381 3300046520 Ga0495637_0032813 Ga0495637_0032813_912_1676 254
382 3300046523 Ga0495644_0031761 Ga0495644_0031761_725_1489 254
383 3300046524 Ga0495648_0001997 Ga0495648_0001997_16907_17671 254
384 3300046524 Ga0495648_0128139 Ga0495648_0128139_547_1311 254
385 3300046538 Ga0495609_0003038 Ga0495609_0003038_785_1549 254
386 3300046558 Ga0495633_0000032 Ga0495633_0000032_99880_100644 254
387 3300046558 Ga0495633_0000289 Ga0495633_0000289_17183_17947 254
388 3300046558 Ga0495633_0057068 Ga0495633_0057068_291_1055 254
389 3300046616 Ga0495668_0000009 Ga0495668_0000009_283542_284306 254
390 3300046660 Ga0495625_0000211 Ga0495625_0000211_59526_60290 254
391 3300046660 Ga0495625_0001964 Ga0495625_0001964_11323_12087 254
392 3300046660 Ga0495625_0003233 Ga0495625_0003233_7502_8266 254
393 3300046660 Ga0495625_0016628 Ga0495625_0016628_1059_1823 254
394 3300046660 Ga0495625_0024615 Ga0495625_0024615_437_1201 254
395 3300046660 Ga0495625_0053177 Ga0495625_0053177_1665_2444 254
396 3300046665 Ga0495661_0000555 Ga0495661_0000555_23690_24454 254
397 3300046665 Ga0495661_0001542 Ga0495661_0001542_17347_18111 254
398 3300046683 Ga0495658_0005234 Ga0495658_0005234_875_1639 254
399 3300046692 Ga0495671_0248984 Ga0495671_0248984_57_821 254
400 3300046694 Ga0495649_0000090 Ga0495649_0000090_59794_60558 254
401 3300046810 Ga0495660_0027641 Ga0495660_0027641_1203_1967 254
402 3300047323 Ga0495683_0041080 Ga0495683_0041080_1201_1965 254
403 3300047443 Ga0495687_001641 Ga0495687_001641_12600_13364 254
404 3300047443 Ga0495687_035598 Ga0495687_035598_175_939 254
405 3300047472 Ga0495686_0001404 Ga0495686_0001404_17522_18361 254
406 3300047472 Ga0495686_0001532 Ga0495686_0001532_22732_23496 254
407 3300047472 Ga0495686_0156335 Ga0495686_0156335_339_1199 254
408 3300047472 Ga0495686_0167045 Ga0495686_0167045_153_992 254
409 3300048089 Ga0495614_0023097 Ga0495614_0023097_462_1226 254
410 3300050493 nmdc:mga0k408_1631_c2 nmdc:mga0k408_1631_c2_2884_3648 254
411 3300050493 nmdc:mga0k408_354_c1 nmdc:mga0k408_354_c1_19291_20112 254
412 3300050493 nmdc:mga0k408_61_c1 nmdc:mga0k408_61_c1_7707_8471 254
413 3300050493 nmdc:mga0k408_73181_c1 nmdc:mga0k408_73181_c1_187_951 254
414 3300053080 Ga0500635_0001467 Ga0500635_0001467_610_1374 254
415 3300053080 Ga0500635_0001644 Ga0500635_0001644_1554_2318 254
416 3300053122 Ga0500608_028795 Ga0500608_028795_1167_1946 254
417 3300053125 Ga0500618_000079 Ga0500618_000079_27613_28392 254
418 3300053125 Ga0500618_024829 Ga0500618_024829_160_924 254
419 3300053130 Ga0500642_0101676 Ga0500642_0101676_206_970 254
420 3300053137 Ga0500561_0094920 Ga0500561_0094920_69_833 254
421 3300053153 Ga0500616_0045339 Ga0500616_0045339_464_1228 254
422 3300053156 Ga0500622_0000312 Ga0500622_0000312_19694_20485 254
423 3300053157 Ga0500624_001224 Ga0500624_001224_2411_3175 254
424 iso_pu_bacteria 2599185184 2599479285 254
425 iso_pu_bacteria 2932082852 2932087544 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

23

150

0.93

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

68

181

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9232 4 215
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9209 4 219
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.916 4 254
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.915 4 215
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9136 5 219
ID Description Score Start End Superfamily
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9374 1 218 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9327 7 215 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9293 2 248 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9291 1 208 3.40.50.300
af_Q54R52_468_723_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.929 3 224 3.40.50.300
ID Description Score Start End GO Terms
AF-X0U0N2-F1-model_v4 ABC transporter domain-containing protein 0.9716 114 219 GO:0005524
GO:0005886
GO:0016887
AF-X1FYS8-F1-model_v4 ATPase AAA-type core domain-containing protein 0.9658 131 245 GO:0005524
GO:0016887
AF-A0A653IHJ7-F1-model_v4 ABC transporter ATP-binding protein 0.9569 4 219 GO:0005524
GO:0016887
AF-A0A0U3H3Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9559 4 248 GO:0005524
GO:0016887
AF-A0A820X1S1-F1-model_v4 ABC transporter domain-containing protein 0.9553 2 222 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359

Feature Viewer

pLDDT pTM Quality
89.65 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map