F440950

General Info

Members Datasets Scaffolds Average Seq Length
425 230 850 317

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100046596|Ga0075428_1000465962
Length 315
Sequence MPDKKIIAVMGATGAQGGGLVRAIQGDKSGALKARAVTRSAGSDKAKALAALGAEVVEADMDDEASLKKAFAGAHGAFCITNFWEHFSPEKEYGQARAQAQAAKHAGVRHVIWSTLEDTRRWVPLDNKRMPTLMGKYKVPHFDAKGEADQVFAQLGVPTTFLLTSFYWENFIQFGMAPKQGEGGLAITLPMGDKKLSGIAVEDIGKCAYGILNQGAAHIGKRIGIAGEHLTGVEMAAHFTRALERQVRYNAVPPEVFRSFGFPGAEDIGNMFQFNQDFEKEVCGARDPQVARGLNPELQTFAQWLGWNKSRIPLE

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
174 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
175 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.53
Rhizosphere 95.53
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100046596 3300006844 Bacteria 4761
2 JGI25404J52841_10017464 3300003659 Bacteria 1556
3 Ga0065715_10314258 3300005293 Bacteria 1014
4 Ga0065707_10003279 3300005295 Bacteria 4485
5 Ga0070676_10000148 3300005328 Bacteria 27670
6 Ga0070676_10026020 3300005328 Bacteria 3312
7 Ga0070676_10061436 3300005328 Bacteria 2233
8 Ga0070676_10062914 3300005328 Bacteria 2209
9 Ga0070690_100003591 3300005330 Bacteria 8520
10 Ga0070690_100006883 3300005330 Bacteria 6469
11 Ga0070690_100132490 3300005330 Unclassified 1685
12 Ga0070670_100007425 3300005331 Bacteria 9309
13 Ga0070670_100008887 3300005331 Bacteria 8576
14 Ga0070670_100028361 3300005331 Bacteria 4818
15 Ga0070670_100124592 3300005331 Bacteria 2224
16 Ga0070670_100437997 3300005331 Bacteria 1157
17 Ga0070677_10006375 3300005333 Bacteria 3917
18 Ga0068869_100009151 3300005334 Bacteria 6419
19 Ga0070666_10002840 3300005335 Bacteria 10465
20 Ga0070666_10007356 3300005335 Bacteria 6784
21 Ga0070680_100018042 3300005336 Bacteria 5574
22 Ga0070680_100062380 3300005336 Bacteria 3052
23 Ga0068868_100012398 3300005338 Bacteria 6231
24 Ga0068868_100016321 3300005338 Bacteria 5512
25 Ga0068868_100021074 3300005338 Bacteria 4907
26 Ga0068868_100068617 3300005338 Bacteria 2823
27 Ga0068868_100082723 3300005338 Bacteria 2575
28 Ga0068868_100198821 3300005338 Bacteria 1670
29 Ga0070660_100011157 3300005339 Bacteria 6374
30 Ga0070689_100017939 3300005340 Bacteria 5204
31 Ga0070689_100141704 3300005340 Bacteria 1933
32 Ga0070689_100237815 3300005340 Bacteria 1499
33 Ga0070691_10011821 3300005341 Bacteria 3994
34 Ga0070687_100019517 3300005343 Bacteria 3155
35 Ga0070687_100079917 3300005343 Bacteria 1781
36 Ga0070692_10034342 3300005345 Bacteria 2561
37 Ga0070668_100001207 3300005347 Bacteria 18349
38 Ga0070669_100001803 3300005353 Bacteria 15411
39 Ga0070669_100017196 3300005353 Bacteria 5160
40 Ga0070669_100019232 3300005353 Bacteria 4878
41 Ga0070675_100013140 3300005354 Bacteria 6506
42 Ga0070675_100017626 3300005354 Bacteria 5678
43 Ga0070675_100084156 3300005354 Bacteria 2656
44 Ga0070675_100160374 3300005354 Bacteria 1933
45 Ga0070671_100011048 3300005355 Bacteria 7247
46 Ga0070671_100031892 3300005355 Bacteria 4356
47 Ga0070674_100004850 3300005356 Bacteria 7710
48 Ga0070674_100025648 3300005356 Bacteria 3840
49 Ga0070674_100031073 3300005356 Bacteria 3535
50 Ga0070674_100226728 3300005356 Bacteria 1456
51 Ga0070673_100000190 3300005364 Bacteria 30180
52 Ga0070673_100007549 3300005364 Bacteria 7186
53 Ga0070673_100035673 3300005364 Bacteria 3772
54 Ga0070673_100057052 3300005364 Bacteria 3084
55 Ga0070688_100001402 3300005365 Bacteria 12008
56 Ga0070688_100020596 3300005365 Bacteria 3836
57 Ga0070659_100134539 3300005366 Bacteria 2010
58 Ga0070667_100005386 3300005367 Bacteria 10689
59 Ga0070709_10004681 3300005434 Bacteria 7388
60 Ga0070710_10013123 3300005437 Bacteria 4138
61 Ga0070701_10062238 3300005438 Bacteria 1971
62 Ga0070711_100007895 3300005439 Bacteria 6487
63 Ga0070711_100090127 3300005439 Bacteria 2208
64 Ga0070705_100022094 3300005440 Bacteria 3394
65 Ga0070700_100011353 3300005441 Bacteria 4932
66 Ga0070700_100174133 3300005441 Bacteria 1492
67 Ga0070694_100048281 3300005444 Bacteria 2864
68 Ga0070694_100060823 3300005444 Bacteria 2577
69 Ga0070694_100146493 3300005444 Bacteria 1720
70 Ga0070708_100027058 3300005445 Bacteria 4916
71 Ga0070708_100341323 3300005445 Bacteria 1411
72 Ga0070678_100004075 3300005456 Bacteria 8229
73 Ga0070678_100006956 3300005456 Bacteria 6677
74 Ga0070678_100011193 3300005456 Bacteria 5523
75 Ga0070678_100014354 3300005456 Bacteria 4996
76 Ga0070678_100131640 3300005456 Bacteria 1988
77 Ga0070662_100012235 3300005457 Bacteria 5682
78 Ga0070662_100035141 3300005457 Bacteria 3537
79 Ga0070681_10011183 3300005458 Bacteria 8881
80 Ga0070681_10102607 3300005458 Bacteria 2805
81 Ga0068867_100000611 3300005459 Bacteria 23660
82 Ga0068867_100002859 3300005459 Bacteria 12143
83 Ga0068867_100034309 3300005459 Unclassified 3677
84 Ga0068867_100049195 3300005459 Bacteria 3103
85 Ga0068867_100071010 3300005459 Bacteria 2604
86 Ga0070706_100256696 3300005467 Bacteria 1632
87 Ga0070707_100001133 3300005468 Bacteria 26210
88 Ga0070699_100055147 3300005518 Bacteria 3442
89 Ga0070699_100266530 3300005518 Unclassified 1532
90 Ga0070679_100090580 3300005530 Bacteria 3047
91 Ga0070684_100135910 3300005535 Bacteria 2221
92 Ga0070697_100036867 3300005536 Bacteria 3950
93 Ga0070697_100084940 3300005536 Bacteria 2611
94 Ga0070697_100227342 3300005536 Bacteria 1591
95 Ga0070672_100002173 3300005543 Bacteria 12365
96 Ga0070672_100003057 3300005543 Bacteria 10785
97 Ga0070672_100019961 3300005543 Bacteria 4878
98 Ga0070672_100042078 3300005543 Bacteria 3516
99 Ga0070672_100112100 3300005543 Bacteria 2224
100 Ga0070672_100305684 3300005543 Bacteria 1349
101 Ga0070686_100027721 3300005544 Bacteria 3430
102 Ga0070696_100019706 3300005546 Bacteria 4570
103 Ga0070693_100003646 3300005547 Bacteria 7193
104 Ga0070665_100020144 3300005548 Bacteria 6697
105 Ga0070665_100047322 3300005548 Bacteria 4317
106 Ga0070704_100059331 3300005549 Bacteria 2729
107 Ga0070664_100130148 3300005564 Bacteria 2210
108 Ga0070664_100136989 3300005564 Bacteria 2153
109 Ga0070664_100290056 3300005564 Bacteria 1477
110 Ga0068857_100093477 3300005577 Bacteria 2693
111 Ga0070702_100012125 3300005615 Bacteria 4307
112 Ga0070702_100048381 3300005615 Bacteria 2420
113 Ga0070702_100112728 3300005615 Bacteria 1689
114 Ga0068859_100025898 3300005617 Bacteria 5885
115 Ga0068859_100059754 3300005617 Bacteria 3840
116 Ga0068864_100021770 3300005618 Bacteria 5371
117 Ga0068864_100024349 3300005618 Bacteria 5092
118 Ga0068864_100182770 3300005618 Unclassified 1918
119 Ga0068866_10053608 3300005718 Bacteria 2062
120 Ga0068861_100051516 3300005719 Bacteria 3125
121 Ga0068870_10051317 3300005840 Bacteria 2183
122 Ga0068863_100003067 3300005841 Bacteria 16514
123 Ga0068863_100028217 3300005841 Bacteria 5358
124 Ga0068860_100028937 3300005843 Bacteria 5331
125 Ga0068860_100109594 3300005843 Bacteria 2639
126 Ga0068862_100127723 3300005844 Bacteria 2246
127 Ga0081540_1000289 3300005983 Bacteria 52703
128 Ga0070715_10119388 3300006163 Bacteria 1255
129 Ga0070716_100023960 3300006173 Bacteria 3244
130 Ga0070716_100085170 3300006173 Bacteria 1897
131 Ga0097621_100006586 3300006237 Bacteria 8251
132 Ga0097621_100253681 3300006237 Bacteria 1541
133 Ga0068871_100006092 3300006358 Bacteria 8488
134 Ga0068871_100014917 3300006358 Bacteria 5808
135 Ga0068871_100061975 3300006358 Bacteria 3056
136 Ga0075428_100022000 3300006844 Bacteria 7058
137 Ga0075428_100314064 3300006844 Bacteria 1684
138 Ga0075428_100716774 3300006844 Bacteria 1065
139 Ga0075431_100141214 3300006847 Bacteria 2482
140 Ga0075433_10004145 3300006852 Bacteria 11249
141 Ga0075433_10021348 3300006852 Bacteria 5430
142 Ga0075433_10056490 3300006852 Bacteria 3429
143 Ga0075434_100004393 3300006871 Bacteria 12704
144 Ga0075434_100125611 3300006871 Unclassified 2582
145 Ga0075434_100389065 3300006871 Bacteria 1415
146 Ga0075434_100449680 3300006871 Bacteria 1309
147 Ga0075429_100349479 3300006880 Bacteria 1294
148 Ga0075429_100392933 3300006880 Bacteria 1214
149 Ga0068865_100005371 3300006881 Bacteria 7763
150 Ga0068865_100033225 3300006881 Bacteria 3453
151 Ga0068865_100066630 3300006881 Bacteria 2541
152 Ga0075436_100010508 3300006914 Bacteria 6349
153 Ga0075436_100014711 3300006914 Bacteria 5362
154 Ga0075436_100162305 3300006914 Bacteria 1575
155 Ga0075436_100193675 3300006914 Bacteria 1439
156 Ga0097620_100025898 3300006931 Bacteria 5885
157 Ga0097620_100059755 3300006931 Bacteria 3840
158 Ga0075435_100034283 3300007076 Bacteria 4021
159 Ga0075435_100145693 3300007076 Bacteria 1989
160 Ga0075435_100427219 3300007076 Bacteria 1141
161 Ga0075435_100518104 3300007076 Bacteria 1031
162 Ga0105240_10002475 3300009093 Bacteria 29688
163 Ga0105240_10074135 3300009093 Bacteria 4202
164 Ga0111539_10000106 3300009094 Bacteria 90149
165 Ga0111539_10131050 3300009094 Unclassified 2936
166 Ga0111539_10133399 3300009094 Bacteria 2908
167 Ga0111539_10404135 3300009094 Unclassified 1591
168 Ga0105245_10198749 3300009098 Bacteria 1924
169 Ga0105245_10574788 3300009098 Bacteria 1151
170 Ga0114129_10177407 3300009147 Bacteria 2901
171 Ga0105243_10038136 3300009148 Bacteria 3741
172 Ga0105243_10258926 3300009148 Bacteria 1557
173 Ga0105241_10396286 3300009174 Bacteria 1210
174 Ga0105242_10014524 3300009176 Bacteria 6102
175 Ga0105242_10114602 3300009176 Bacteria 2303
176 Ga0105242_10175197 3300009176 Bacteria 1888
177 Ga0105248_10015838 3300009177 Bacteria 8310
178 Ga0105248_10293549 3300009177 Unclassified 1831
179 Ga0105237_10008799 3300009545 Bacteria 10888
180 Ga0105249_10068930 3300009553 Bacteria 3263
181 Ga0105249_10310447 3300009553 Unclassified 1585
182 Ga0105246_10022420 3300011119 Bacteria 4073
183 Ga0157373_10124330 3300013100 Bacteria 1814
184 Ga0157369_10000189 3300013105 Bacteria 85144
185 Ga0157369_10005030 3300013105 Bacteria 15477
186 Ga0157369_10309458 3300013105 Bacteria 1643
187 Ga0157374_10015174 3300013296 Bacteria 6756
188 Ga0157374_10023008 3300013296 Bacteria 5566
189 Ga0157374_10098485 3300013296 Bacteria 2800
190 Ga0157378_10005614 3300013297 Bacteria 10990
191 Ga0157378_10013146 3300013297 Bacteria 7242
192 Ga0157378_10042795 3300013297 Bacteria 4020
193 Ga0157378_10079729 3300013297 Bacteria 2956
194 Ga0157378_10106241 3300013297 Bacteria 2568
195 Ga0157378_10190935 3300013297 Bacteria 1932
196 Ga0163162_10023593 3300013306 Bacteria 6074
197 Ga0163162_10025268 3300013306 Bacteria 5869
198 Ga0163162_10402198 3300013306 Bacteria 1502
199 Ga0157372_10005165 3300013307 Bacteria 13883
200 Ga0157375_10008633 3300013308 Bacteria 8924
201 Ga0157375_10032336 3300013308 Bacteria 4961
202 Ga0157375_10094728 3300013308 Bacteria 3055
203 Ga0163163_10094552 3300014325 Bacteria 3007
204 Ga0163163_10108590 3300014325 Bacteria 2802
205 Ga0163163_10120410 3300014325 Bacteria 2658
206 Ga0157380_10034062 3300014326 Bacteria 3927
207 Ga0157377_10114918 3300014745 Bacteria 1623
208 Ga0157377_10151512 3300014745 Bacteria 1434
209 Ga0157379_10008803 3300014968 Bacteria 8803
210 Ga0157376_10001532 3300014969 Bacteria 15244
211 Ga0157376_10008171 3300014969 Bacteria 7529
212 Ga0157376_10027324 3300014969 Bacteria 4521
213 Ga0213876_10004541 3300021384 Bacteria 7752
214 Ga0207692_10184801 3300025898 Bacteria 1216
215 Ga0207680_10002902 3300025903 Bacteria 8044
216 Ga0207680_10017798 3300025903 Bacteria 3762
217 Ga0207685_10126906 3300025905 Bacteria 1127
218 Ga0207645_10000549 3300025907 Bacteria 31247
219 Ga0207645_10007808 3300025907 Bacteria 7527
220 Ga0207645_10014856 3300025907 Bacteria 5195
221 Ga0207645_10016040 3300025907 Bacteria 4962
222 Ga0207645_10041180 3300025907 Bacteria 2958
223 Ga0207643_10033642 3300025908 Bacteria 2869
224 Ga0207643_10044748 3300025908 Bacteria 2499
225 Ga0207705_10264566 3300025909 Bacteria 1314
226 Ga0207684_10086550 3300025910 Unclassified 2669
227 Ga0207684_10313181 3300025910 Bacteria 1353
228 Ga0207707_10013557 3300025912 Bacteria 7104
229 Ga0207695_10022554 3300025913 Bacteria 7142
230 Ga0207695_10055788 3300025913 Bacteria 4115
231 Ga0207663_10001762 3300025916 Bacteria 10206
232 Ga0207660_10008345 3300025917 Bacteria 6698
233 Ga0207660_10130334 3300025917 Bacteria 1913
234 Ga0207662_10009703 3300025918 Bacteria 5307
235 Ga0207662_10030070 3300025918 Bacteria 3150
236 Ga0207662_10105400 3300025918 Bacteria 1752
237 Ga0207657_10011721 3300025919 Bacteria 8685
238 Ga0207649_10038882 3300025920 Bacteria 2883
239 Ga0207652_10269383 3300025921 Bacteria 1536
240 Ga0207646_10000213 3300025922 Bacteria 79744
241 Ga0207681_10010222 3300025923 Bacteria 5746
242 Ga0207681_10015640 3300025923 Bacteria 4734
243 Ga0207650_10019124 3300025925 Bacteria 4813
244 Ga0207650_10059680 3300025925 Bacteria 2844
245 Ga0207659_10021042 3300025926 Bacteria 4323
246 Ga0207659_10324646 3300025926 Bacteria 1271
247 Ga0207687_10067443 3300025927 Bacteria 2545
248 Ga0207644_10022042 3300025931 Bacteria 4347
249 Ga0207690_10160177 3300025932 Bacteria 1677
250 Ga0207706_10001007 3300025933 Bacteria 28711
251 Ga0207706_10014688 3300025933 Bacteria 7092
252 Ga0207706_10041253 3300025933 Bacteria 4091
253 Ga0207686_10070612 3300025934 Bacteria 2245
254 Ga0207709_10060340 3300025935 Bacteria 2364
255 Ga0207709_10070784 3300025935 Bacteria 2212
256 Ga0207670_10040839 3300025936 Bacteria 3047
257 Ga0207670_10091320 3300025936 Bacteria 2153
258 Ga0207670_10177667 3300025936 Bacteria 1601
259 Ga0207670_10229226 3300025936 Bacteria 1426
260 Ga0207669_10014737 3300025937 Bacteria 3924
261 Ga0207669_10071151 3300025937 Bacteria 2184
262 Ga0207704_10016136 3300025938 Bacteria 3829
263 Ga0207665_10000623 3300025939 Bacteria 23690
264 Ga0207691_10000015 3300025940 Bacteria 142014
265 Ga0207691_10000105 3300025940 Bacteria 74790
266 Ga0207691_10003224 3300025940 Bacteria 15914
267 Ga0207691_10005661 3300025940 Bacteria 12082
268 Ga0207691_10016860 3300025940 Bacteria 6931
269 Ga0207691_10202324 3300025940 Bacteria 1728
270 Ga0207691_10461921 3300025940 Bacteria 1080
271 Ga0207711_10245865 3300025941 Unclassified 1641
272 Ga0207689_10004705 3300025942 Bacteria 12322
273 Ga0207689_10010412 3300025942 Bacteria 8005
274 Ga0207689_10093992 3300025942 Bacteria 2463
275 Ga0207679_10140369 3300025945 Bacteria 1952
276 Ga0207651_10000209 3300025960 Bacteria 25205
277 Ga0207651_10007169 3300025960 Bacteria 5923
278 Ga0207651_10025721 3300025960 Bacteria 3663
279 Ga0207651_10107948 3300025960 Bacteria 2082
280 Ga0207668_10017261 3300025972 Bacteria 4518
281 Ga0207658_10018184 3300025986 Bacteria 4849
282 Ga0207658_10046355 3300025986 Bacteria 3174
283 Ga0207658_10065131 3300025986 Bacteria 2736
284 Ga0207677_10018497 3300026023 Bacteria 4183
285 Ga0207677_10131982 3300026023 Bacteria 1898
286 Ga0207677_10177549 3300026023 Bacteria 1672
287 Ga0207703_10016101 3300026035 Bacteria 5829
288 Ga0207703_10073657 3300026035 Bacteria 2826
289 Ga0207708_10011292 3300026075 Bacteria 6648
290 Ga0207641_10008114 3300026088 Bacteria 8695
291 Ga0207641_10058653 3300026088 Unclassified 3277
292 Ga0207648_10000320 3300026089 Bacteria 52595
293 Ga0207648_10001445 3300026089 Bacteria 26161
294 Ga0207648_10054642 3300026089 Unclassified 3487
295 Ga0207648_10056694 3300026089 Bacteria 3418
296 Ga0207648_10087739 3300026089 Bacteria 2715
297 Ga0207676_10028733 3300026095 Bacteria 4157
298 Ga0207676_10180127 3300026095 Unclassified 1850
299 Ga0207674_10046583 3300026116 Bacteria 4451
300 Ga0207675_100077386 3300026118 Bacteria 3116
301 Ga0207675_100532247 3300026118 Bacteria 1173
302 Ga0207683_10000648 3300026121 Bacteria 31842
303 Ga0207683_10005891 3300026121 Bacteria 10508
304 Ga0207683_10009796 3300026121 Bacteria 8171
305 Ga0207683_10022861 3300026121 Bacteria 5371
306 Ga0209973_1002502 3300027252 Unclassified 1730
307 Ga0209969_1000113 3300027360 Bacteria 10228
308 Ga0209981_1000260 3300027378 Bacteria 6786
309 Ga0209981_1001009 3300027378 Bacteria 3550
310 Ga0209996_1000935 3300027395 Bacteria 3453
311 Ga0209996_1002047 3300027395 Bacteria 2484
312 Ga0209996_1007230 3300027395 Bacteria 1444
313 Ga0210000_1001409 3300027462 Bacteria 3397
314 Ga0210000_1013952 3300027462 Bacteria 1201
315 Ga0209995_1004124 3300027471 Bacteria 2318
316 Ga0209999_1000922 3300027543 Bacteria 4945
317 Ga0209999_1016381 3300027543 Bacteria 1349
318 Ga0209970_1001994 3300027614 Unclassified 3511
319 Ga0209983_1000496 3300027665 Bacteria 8471
320 Ga0209971_1031008 3300027682 Bacteria 1281
321 Ga0209966_1001703 3300027695 Unclassified 3739
322 Ga0209998_10000329 3300027717 Bacteria 14121
323 Ga0209998_10006303 3300027717 Bacteria 2465
324 Ga0209974_10070621 3300027876 Bacteria 1191
325 Ga0207428_10007796 3300027907 Bacteria 9747
326 Ga0207428_10099244 3300027907 Bacteria 2252
327 Ga0207428_10165158 3300027907 Unclassified 1679
328 Ga0207428_10298865 3300027907 Bacteria 1192
329 Ga0268266_10014369 3300028379 Bacteria 6810
330 Ga0268265_10069152 3300028380 Bacteria 2741
331 Ga0268264_10046380 3300028381 Bacteria 3609
332 Ga0265330_10010068 3300031235 Bacteria 4469
333 Ga0265332_10014403 3300031238 Bacteria 3498
334 Ga0265320_10012809 3300031240 Bacteria 4857
335 Ga0265329_10054845 3300031242 Bacteria 1265
336 Ga0265331_10040830 3300031250 Bacteria 2256
337 Ga0307408_100186049 3300031548 Bacteria 1670
338 Ga0316579_10011731 3300031691 Bacteria 3732
339 Ga0265314_10048209 3300031711 Bacteria 2991
340 Ga0265342_10002834 3300031712 Bacteria 14645
341 Ga0316578_10153624 3300031728 Bacteria 1387
342 Ga0316577_10011078 3300031733 Bacteria 4879
343 Ga0316577_10058803 3300031733 Bacteria 2146
344 Ga0307409_100405957 3300031995 Bacteria 1303
345 Ga0316583_10035689 3300032133 Bacteria 1764
346 Ga0316585_10027896 3300032137 Bacteria 1764
347 Ga0316593_10010980 3300032168 Bacteria 2618
348 Ga0316592_1012749 3300033524 Bacteria 1727
349 Ga0316586_1017285 3300033527 Bacteria 1163
350 Ga0373959_0021242 3300034820 Bacteria 1245
351 Ga0373941_0017522 3300035115 Bacteria 1964
352 Ga0373941_0047643 3300035115 Bacteria 1351
353 Ga0316574_0036613 3300035398 Bacteria 3004
354 Ga0316574_0059164 3300035398 Bacteria 2402
355 Ga0373937_0070074 3300036401 Bacteria 3234
356 Ga0373937_0115931 3300036401 Bacteria 2495
357 Ga0373937_0151738 3300036401 Bacteria 2170
358 Ga0316582_0079166 3300036647 Bacteria 2142
359 Ga0316582_0138714 3300036647 Bacteria 1638
360 Ga0436365_0059155 3300039437 Bacteria 7767
361 Ga0451853_2816284 3300041512 Bacteria 1761
362 Ga0451577_0332220 3300042876 Unclassified 1379
363 Ga0453683_0208082 3300044673 Bacteria 1243
364 Ga0466966_0115124 3300044684 Bacteria 1655
365 Ga0453684_0008094 3300044712 Bacteria 18996
366 Ga0453684_0081081 3300044712 Bacteria 4048
367 Ga0466959_0081256 3300045049 Bacteria 2336
368 Ga0451576_0045393 3300045051 Bacteria 4628
369 Ga0495628_0060873 3300046516 Bacteria 2962
370 Ga0495637_0095218 3300046520 Bacteria 1169
371 Ga0495621_0106789 3300046539 Bacteria 1070
372 Ga0495625_0010393 3300046660 Bacteria 7707
373 Ga0495625_0051526 3300046660 Bacteria 2951
374 Ga0495657_0190666 3300046675 Unclassified 1253
375 Ga0495623_0147893 3300046679 Bacteria 1391
376 Ga0495604_0015536 3300047317 Bacteria 6077
377 Ga0495636_0086974 3300047318 Bacteria 1352
378 Ga0495675_0051836 3300047444 Bacteria 2606
379 Ga0495602_0137597 3300048088 Bacteria 1938
380 Ga0496101_0105565 3300048904 Bacteria 2114
381 Ga0496104_0059536 3300048907 Bacteria 3616
382 Ga0496106_0085269 3300048909 Bacteria 2432
383 Ga0496107_0126600 3300048910 Bacteria 1884
384 Ga0496108_0038598 3300048911 Bacteria 3979
385 Ga0496108_0069857 3300048911 Bacteria 2964
386 Ga0496109_0048049 3300048912 Bacteria 3882
387 Ga0496109_0062845 3300048912 Bacteria 3396
388 Ga0496110_0134661 3300048913 Bacteria 2232
389 Ga0496112_0005108 3300048915 Bacteria 11276
390 Ga0496112_0062907 3300048915 Bacteria 3661
391 Ga0496112_0086220 3300048915 Bacteria 3107
392 Ga0496113_0113823 3300048916 Bacteria 2109
393 Ga0496114_0005304 3300048917 Bacteria 10073
394 Ga0496115_0393586 3300048918 Bacteria 1125
395 Ga0501037_0020623 3300049573 Bacteria 4866
396 Ga0501042_0076761 3300049578 Unclassified 2392
397 Ga0501043_0180081 3300049579 Bacteria 1647
398 Ga0501048_0185340 3300049582 Bacteria 1475
399 Ga0501076_0020838 3300049592 Bacteria 5021
400 Ga0501083_0001421 3300049744 Bacteria 16334
401 nmdc:mga05p37_114707_c1 3300050507 Bacteria 3312
402 nmdc:mga05p37_132366_c1 3300050507 Bacteria 3060
403 nmdc:mga05p37_575319_c1 3300050507 Bacteria 1277
404 nmdc:mga05p37_77211_c1 3300050507 Bacteria 4100
405 nmdc:mga09592_463536_c1 3300050508 Bacteria 1093
406 nmdc:mga06r32_405273_c1 3300050510 Bacteria 1346
407 nmdc:mga08y16_132647_c1 3300050511 Bacteria 2590
408 nmdc:mga08y16_15416_c1 3300050511 Bacteria 8038
409 nmdc:mga08y16_157457_c1 3300050511 Bacteria 2361
410 nmdc:mga0n895_105562_c1 3300050512 Bacteria 2830
411 nmdc:mga0n895_21303_c1 3300050512 Bacteria 6058
412 nmdc:mga0n895_56356_c1 3300050512 Bacteria 3872
413 nmdc:mga0rr50_313257_c1 3300050513 Bacteria 1315
414 nmdc:mga08x19_114232_c1 3300050514 Bacteria 1804
415 nmdc:mga08x19_301010_c1 3300050514 Bacteria 1114
416 nmdc:mga08x19_43154_c1 3300050514 Bacteria 2877
417 nmdc:mga08x19_59053_c1 3300050514 Bacteria 2483
418 nmdc:mga0a205_495763_c1 3300050515 Bacteria 1079
419 nmdc:mga0a205_8168_c1 3300050515 Bacteria 9507
420 nmdc:mga0a205_8784_c1 3300050515 Bacteria 9206
421 Ga0495601_0087923 3300053077 Bacteria 1998
422 Ga0495619_0050011 3300053085 Bacteria 2758
423 Ga0500641_0005992 3300053096 Bacteria 4300
424 Ga0501084_0148557 3300054114 Bacteria 1975
425 Ga0501082_0006280 3300060353 Bacteria 10312
426 Ga0075428_100046596
427 JGI25404J52841_10017464
428 Ga0065715_10314258
429 Ga0065707_10003279
430 Ga0070676_10000148
431 Ga0070676_10026020
432 Ga0070676_10061436
433 Ga0070676_10062914
434 Ga0070690_100003591
435 Ga0070690_100006883
436 Ga0070690_100132490
437 Ga0070670_100007425
438 Ga0070670_100008887
439 Ga0070670_100028361
440 Ga0070670_100124592
441 Ga0070670_100437997
442 Ga0070677_10006375
443 Ga0068869_100009151
444 Ga0070666_10002840
445 Ga0070666_10007356
446 Ga0070680_100018042
447 Ga0070680_100062380
448 Ga0068868_100012398
449 Ga0068868_100016321
450 Ga0068868_100021074
451 Ga0068868_100068617
452 Ga0068868_100082723
453 Ga0068868_100198821
454 Ga0070660_100011157
455 Ga0070689_100017939
456 Ga0070689_100141704
457 Ga0070689_100237815
458 Ga0070691_10011821
459 Ga0070687_100019517
460 Ga0070687_100079917
461 Ga0070692_10034342
462 Ga0070668_100001207
463 Ga0070669_100001803
464 Ga0070669_100017196
465 Ga0070669_100019232
466 Ga0070675_100013140
467 Ga0070675_100017626
468 Ga0070675_100084156
469 Ga0070675_100160374
470 Ga0070671_100011048
471 Ga0070671_100031892
472 Ga0070674_100004850
473 Ga0070674_100025648
474 Ga0070674_100031073
475 Ga0070674_100226728
476 Ga0070673_100000190
477 Ga0070673_100007549
478 Ga0070673_100035673
479 Ga0070673_100057052
480 Ga0070688_100001402
481 Ga0070688_100020596
482 Ga0070659_100134539
483 Ga0070667_100005386
484 Ga0070709_10004681
485 Ga0070710_10013123
486 Ga0070701_10062238
487 Ga0070711_100007895
488 Ga0070711_100090127
489 Ga0070705_100022094
490 Ga0070700_100011353
491 Ga0070700_100174133
492 Ga0070694_100048281
493 Ga0070694_100060823
494 Ga0070694_100146493
495 Ga0070708_100027058
496 Ga0070708_100341323
497 Ga0070678_100004075
498 Ga0070678_100006956
499 Ga0070678_100011193
500 Ga0070678_100014354
501 Ga0070678_100131640
502 Ga0070662_100012235
503 Ga0070662_100035141
504 Ga0070681_10011183
505 Ga0070681_10102607
506 Ga0068867_100000611
507 Ga0068867_100002859
508 Ga0068867_100034309
509 Ga0068867_100049195
510 Ga0068867_100071010
511 Ga0070706_100256696
512 Ga0070707_100001133
513 Ga0070699_100055147
514 Ga0070699_100266530
515 Ga0070679_100090580
516 Ga0070684_100135910
517 Ga0070697_100036867
518 Ga0070697_100084940
519 Ga0070697_100227342
520 Ga0070672_100002173
521 Ga0070672_100003057
522 Ga0070672_100019961
523 Ga0070672_100042078
524 Ga0070672_100112100
525 Ga0070672_100305684
526 Ga0070686_100027721
527 Ga0070696_100019706
528 Ga0070693_100003646
529 Ga0070665_100020144
530 Ga0070665_100047322
531 Ga0070704_100059331
532 Ga0070664_100130148
533 Ga0070664_100136989
534 Ga0070664_100290056
535 Ga0068857_100093477
536 Ga0070702_100012125
537 Ga0070702_100048381
538 Ga0070702_100112728
539 Ga0068859_100025898
540 Ga0068859_100059754
541 Ga0068864_100021770
542 Ga0068864_100024349
543 Ga0068864_100182770
544 Ga0068866_10053608
545 Ga0068861_100051516
546 Ga0068870_10051317
547 Ga0068863_100003067
548 Ga0068863_100028217
549 Ga0068860_100028937
550 Ga0068860_100109594
551 Ga0068862_100127723
552 Ga0081540_1000289
553 Ga0070715_10119388
554 Ga0070716_100023960
555 Ga0070716_100085170
556 Ga0097621_100006586
557 Ga0097621_100253681
558 Ga0068871_100006092
559 Ga0068871_100014917
560 Ga0068871_100061975
561 Ga0075428_100022000
562 Ga0075428_100314064
563 Ga0075428_100716774
564 Ga0075431_100141214
565 Ga0075433_10004145
566 Ga0075433_10021348
567 Ga0075433_10056490
568 Ga0075434_100004393
569 Ga0075434_100125611
570 Ga0075434_100389065
571 Ga0075434_100449680
572 Ga0075429_100349479
573 Ga0075429_100392933
574 Ga0068865_100005371
575 Ga0068865_100033225
576 Ga0068865_100066630
577 Ga0075436_100010508
578 Ga0075436_100014711
579 Ga0075436_100162305
580 Ga0075436_100193675
581 Ga0097620_100025898
582 Ga0097620_100059755
583 Ga0075435_100034283
584 Ga0075435_100145693
585 Ga0075435_100427219
586 Ga0075435_100518104
587 Ga0105240_10002475
588 Ga0105240_10074135
589 Ga0111539_10000106
590 Ga0111539_10131050
591 Ga0111539_10133399
592 Ga0111539_10404135
593 Ga0105245_10198749
594 Ga0105245_10574788
595 Ga0114129_10177407
596 Ga0105243_10038136
597 Ga0105243_10258926
598 Ga0105241_10396286
599 Ga0105242_10014524
600 Ga0105242_10114602
601 Ga0105242_10175197
602 Ga0105248_10015838
603 Ga0105248_10293549
604 Ga0105237_10008799
605 Ga0105249_10068930
606 Ga0105249_10310447
607 Ga0105246_10022420
608 Ga0157373_10124330
609 Ga0157369_10000189
610 Ga0157369_10005030
611 Ga0157369_10309458
612 Ga0157374_10015174
613 Ga0157374_10023008
614 Ga0157374_10098485
615 Ga0157378_10005614
616 Ga0157378_10013146
617 Ga0157378_10042795
618 Ga0157378_10079729
619 Ga0157378_10106241
620 Ga0157378_10190935
621 Ga0163162_10023593
622 Ga0163162_10025268
623 Ga0163162_10402198
624 Ga0157372_10005165
625 Ga0157375_10008633
626 Ga0157375_10032336
627 Ga0157375_10094728
628 Ga0163163_10094552
629 Ga0163163_10108590
630 Ga0163163_10120410
631 Ga0157380_10034062
632 Ga0157377_10114918
633 Ga0157377_10151512
634 Ga0157379_10008803
635 Ga0157376_10001532
636 Ga0157376_10008171
637 Ga0157376_10027324
638 Ga0213876_10004541
639 Ga0207692_10184801
640 Ga0207680_10002902
641 Ga0207680_10017798
642 Ga0207685_10126906
643 Ga0207645_10000549
644 Ga0207645_10007808
645 Ga0207645_10014856
646 Ga0207645_10016040
647 Ga0207645_10041180
648 Ga0207643_10033642
649 Ga0207643_10044748
650 Ga0207705_10264566
651 Ga0207684_10086550
652 Ga0207684_10313181
653 Ga0207707_10013557
654 Ga0207695_10022554
655 Ga0207695_10055788
656 Ga0207663_10001762
657 Ga0207660_10008345
658 Ga0207660_10130334
659 Ga0207662_10009703
660 Ga0207662_10030070
661 Ga0207662_10105400
662 Ga0207657_10011721
663 Ga0207649_10038882
664 Ga0207652_10269383
665 Ga0207646_10000213
666 Ga0207681_10010222
667 Ga0207681_10015640
668 Ga0207650_10019124
669 Ga0207650_10059680
670 Ga0207659_10021042
671 Ga0207659_10324646
672 Ga0207687_10067443
673 Ga0207644_10022042
674 Ga0207690_10160177
675 Ga0207706_10001007
676 Ga0207706_10014688
677 Ga0207706_10041253
678 Ga0207686_10070612
679 Ga0207709_10060340
680 Ga0207709_10070784
681 Ga0207670_10040839
682 Ga0207670_10091320
683 Ga0207670_10177667
684 Ga0207670_10229226
685 Ga0207669_10014737
686 Ga0207669_10071151
687 Ga0207704_10016136
688 Ga0207665_10000623
689 Ga0207691_10000015
690 Ga0207691_10000105
691 Ga0207691_10003224
692 Ga0207691_10005661
693 Ga0207691_10016860
694 Ga0207691_10202324
695 Ga0207691_10461921
696 Ga0207711_10245865
697 Ga0207689_10004705
698 Ga0207689_10010412
699 Ga0207689_10093992
700 Ga0207679_10140369
701 Ga0207651_10000209
702 Ga0207651_10007169
703 Ga0207651_10025721
704 Ga0207651_10107948
705 Ga0207668_10017261
706 Ga0207658_10018184
707 Ga0207658_10046355
708 Ga0207658_10065131
709 Ga0207677_10018497
710 Ga0207677_10131982
711 Ga0207677_10177549
712 Ga0207703_10016101
713 Ga0207703_10073657
714 Ga0207708_10011292
715 Ga0207641_10008114
716 Ga0207641_10058653
717 Ga0207648_10000320
718 Ga0207648_10001445
719 Ga0207648_10054642
720 Ga0207648_10056694
721 Ga0207648_10087739
722 Ga0207676_10028733
723 Ga0207676_10180127
724 Ga0207674_10046583
725 Ga0207675_100077386
726 Ga0207675_100532247
727 Ga0207683_10000648
728 Ga0207683_10005891
729 Ga0207683_10009796
730 Ga0207683_10022861
731 Ga0209973_1002502
732 Ga0209969_1000113
733 Ga0209981_1000260
734 Ga0209981_1001009
735 Ga0209996_1000935
736 Ga0209996_1002047
737 Ga0209996_1007230
738 Ga0210000_1001409
739 Ga0210000_1013952
740 Ga0209995_1004124
741 Ga0209999_1000922
742 Ga0209999_1016381
743 Ga0209970_1001994
744 Ga0209983_1000496
745 Ga0209971_1031008
746 Ga0209966_1001703
747 Ga0209998_10000329
748 Ga0209998_10006303
749 Ga0209974_10070621
750 Ga0207428_10007796
751 Ga0207428_10099244
752 Ga0207428_10165158
753 Ga0207428_10298865
754 Ga0268266_10014369
755 Ga0268265_10069152
756 Ga0268264_10046380
757 Ga0265330_10010068
758 Ga0265332_10014403
759 Ga0265320_10012809
760 Ga0265329_10054845
761 Ga0265331_10040830
762 Ga0307408_100186049
763 Ga0316579_10011731
764 Ga0265314_10048209
765 Ga0265342_10002834
766 Ga0316578_10153624
767 Ga0316577_10011078
768 Ga0316577_10058803
769 Ga0307409_100405957
770 Ga0316583_10035689
771 Ga0316585_10027896
772 Ga0316593_10010980
773 Ga0316592_1012749
774 Ga0316586_1017285
775 Ga0373959_0021242
776 Ga0373941_0017522
777 Ga0373941_0047643
778 Ga0316574_0036613
779 Ga0316574_0059164
780 Ga0373937_0070074
781 Ga0373937_0115931
782 Ga0373937_0151738
783 Ga0316582_0079166
784 Ga0316582_0138714
785 Ga0436365_0059155
786 Ga0451853_2816284
787 Ga0451577_0332220
788 Ga0453683_0208082
789 Ga0466966_0115124
790 Ga0453684_0008094
791 Ga0453684_0081081
792 Ga0466959_0081256
793 Ga0451576_0045393
794 Ga0495628_0060873
795 Ga0495637_0095218
796 Ga0495621_0106789
797 Ga0495625_0010393
798 Ga0495625_0051526
799 Ga0495657_0190666
800 Ga0495623_0147893
801 Ga0495604_0015536
802 Ga0495636_0086974
803 Ga0495675_0051836
804 Ga0495602_0137597
805 Ga0496101_0105565
806 Ga0496104_0059536
807 Ga0496106_0085269
808 Ga0496107_0126600
809 Ga0496108_0038598
810 Ga0496108_0069857
811 Ga0496109_0048049
812 Ga0496109_0062845
813 Ga0496110_0134661
814 Ga0496112_0005108
815 Ga0496112_0062907
816 Ga0496112_0086220
817 Ga0496113_0113823
818 Ga0496114_0005304
819 Ga0496115_0393586
820 Ga0501037_0020623
821 Ga0501042_0076761
822 Ga0501043_0180081
823 Ga0501048_0185340
824 Ga0501076_0020838
825 Ga0501083_0001421
826 nmdc:mga05p37_114707_c1
827 nmdc:mga05p37_132366_c1
828 nmdc:mga05p37_575319_c1
829 nmdc:mga05p37_77211_c1
830 nmdc:mga09592_463536_c1
831 nmdc:mga06r32_405273_c1
832 nmdc:mga08y16_132647_c1
833 nmdc:mga08y16_15416_c1
834 nmdc:mga08y16_157457_c1
835 nmdc:mga0n895_105562_c1
836 nmdc:mga0n895_21303_c1
837 nmdc:mga0n895_56356_c1
838 nmdc:mga0rr50_313257_c1
839 nmdc:mga08x19_114232_c1
840 nmdc:mga08x19_301010_c1
841 nmdc:mga08x19_43154_c1
842 nmdc:mga08x19_59053_c1
843 nmdc:mga0a205_495763_c1
844 nmdc:mga0a205_8168_c1
845 nmdc:mga0a205_8784_c1
846 Ga0495601_0087923
847 Ga0495619_0050011
848 Ga0500641_0005992
849 Ga0501084_0148557
850 Ga0501082_0006280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

7

251

0.87

PF13460

NAD_binding_10

NAD(P)H-binding

11

214

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wmd-assembly1.cif.gz_A-2 crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid 0.9334 4 315
3dxf-assembly2.cif.gz_B crystal structure of the hscarg r37a mutant 0.9307 4 312
2wmd-assembly1.cif.gz_A-2 crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid 0.9304 4 315
3e5m-assembly1.cif.gz_A crystal structure of the hscarg y81a mutant 0.9298 5 315
3dxf-assembly1.cif.gz_A crystal structure of the hscarg r37a mutant 0.9293 4 312
ID Description Score Start End Superfamily
3dxfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9081 4 231 3.40.50.720
5f5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9021 4 310 3.40.50.720
5f5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8813 4 310 3.40.50.720
3e48B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8659 5 225 3.40.50.720
3dxfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.849 4 231 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N5EU77-F1-model_v4 NmrA/HSCARG family protein 0.9888 4 242
AF-A0A3A4QZP1-F1-model_v4 NmrA/HSCARG family protein 0.9861 4 313
AF-A0A495VFS8-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.986 1 315
AF-A0A2S5A443-F1-model_v4 Nucleoside-diphosphate sugar epimerase 0.986 1 313
AF-A0A359C8M0-F1-model_v4 Nucleoside-diphosphate sugar epimerase 0.9856 1 168

Map